3ZYIA

Netring2 in complex with ngl2
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
398
structure length
395
Chain Sequence
QNCPSVCSCSNQFSKVVCTRRGLSEVPQGIPSNTRYLNLMENNIQMIQADTFRHLHHLEVLQLGRNSIRQIEVGAFNGLASLNTLELFDNWLTVIPSGAFEYLSKLRELWLRNNPIESIPSYAFNRVPSLMRLDLGELKKLEYISEGAFEGLFNLKYLNLGMCNIKDMPNLTPLVGLEELEMSGNHFPEIRPGSFHGLSSLKKLWVMNSQVSLIERNAFDGLASLVELNLAHNNLSSLPHDLFTPLRYLVELHLHHNPWNCDCDILWLAWWLREYISTCCGRCHAPMHMRGRYLVEVDQASFQCSAPFIMDAPRDLNISEGRMAELKCRTPPMSSVKWLLPNGTVLSHASRHPRISVLNDGTLNFSHVLLSDTGVYTCMVTNVAGNSNASAYLNV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LEUCINE-RICH REPEAT-CONTAINING PROTEIN 4
publication title Structural Basis for Cell Surface Patterning Through Netring-Ngl Interactions
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
total genus 109
structure length 395
sequence length 398
ec nomenclature
pdb deposition date 2011-08-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07679 I-set Immunoglobulin I-set domain
A PF13855 LRR_8 Leucine rich repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3zyiA02
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 3zyiA01
4JM2B 4UT6L 4K7FA 5DD3H 5MP6H 4D94A 1OAUL 4ARRA 2A1WH 2MPAH 4XBEH 1Z5LA 3GJFB 2FX8L 3HUJB 3MRMB 5GS1B 4F15B 2QLVB 4HKJB 3N1MC 1DVFC 2OR9L 2Z91A 3RNQA 4LU5L 4QC0A 2DLEA 2LVCA 5C0ND 3HPLA 2GK0B 2Q76B 3HMWL 5KVDH 1F11B 1N6VA 1TZHA 4RX4A 3MYJA 4UNTA 3VFUA 5DRZA 5DSCA 4G3YL 4XP9L 5I74B 3VA2C 3S8WA 4G9DB 3UJTL 2XZCH 3IKCA 3SPVA 5DFTA 1GGCH 2ZUTA 4Y5VB 1MIEL 3C6SA 2QQLH 5T3XE 4KK6D 2J88L 3MJ7A 4KVCH 2OMXA 5IF0B 1RJZB 3CZFA 2J5LB 4Y8DC 2R0LH 3QEHB 5EIIB 1U8KA 1BFTA 4U1SB 1CD9B 3WIFA 5FYLL 5EZLB 4A2MA 3KJ4B 4D9LH 3TYFA 1XGTA 4QT5A 2DS4A 4LLUB 2AJSH 5ETUB 5BS0E 4OZIA 2D03L 2FJGA 5F89A 1NL0H 2CK0H 1DCEA 1MHPL 1DVFA 5T1MB 4CGTA 4Y1AB 1ZHLA 3MACL 4FQIL 3L3HB 4OF8A 5DRWA 1U6AH 3VJ6B 2PCPA 2PYED 3W11C 4YPGB 4P59L 1MCLA 5E8DL 2Y6SC 1YECL 3S3SA 3DVNB 4Y7MA 4H1LA 3T2NL 4LHQB 4M62L 4PS4H 3VFMB 5E2VL 1A5FL 3IFOB 4Z7UA 5ELIA 3UTZB 3LS4H 4MX7B 4BSUA 4U3CA 4MNHA 1N64H 1U8PA 3MV9B 3QDJA 4PRAB 3BVNB 1LNUB 1IM3A 1FNSH 4ODHL 1B90A 4HUWA 5C0GB 5IHZA 4FP8L 5TE6H 4PG9B 3QEGL 1KCVH 3ARGD 3TBTA 1G6RH 1EMTH 4LKCB 1HYSC 4A6YA 4HBQA 3T3MF 3RFEA 5IEHA 2NX5B 4H0GA 5GISH 1NAML 3TIEB 3G39A 5CUSL 2FO4A 2NY6D 4N1CA 4UILL 5D72L 3L5IA 5INDA 1ZT4A 3VD3A 4M7ZC 3P40A 3RGXA 1C1EL 2VXQH 3QCTL 3U7WL 3O3BB 1CICB 1KLGB 4N1EA 5E24E 3V6FB 2NR6C 1QSEB 1SBSL 2W65B 3L3IA 4TOYH 1KPUA 1T5WA 1XF4B 4OZHE 1NCWH 5KSVB 1FNLA 2P8PA 4CVWA 2V7HB 4LDEB 3VE0A 4U0QB 3WEXB 4JFDD 2JB6A 5CZKA 4UZGA 3RP1A 5L2KD 3AAZA 2W0FB 2APVA 4JHBA 3FXIA 2XTJC 4JKWA 2JJSC 3GNMH 3QXDA 3RIAF 4EN3B 1K6QL 3ARXA 4PV8A 1IAIM 4K71C 5TGBA 5BVJA 4J3WA 5DK2B 4F9LC 4MSWA 43C9B 1K5GC 2D9CA 1IGFL 4KZDL 4K23H 1AQKH 2IG2H 3DGCR 4U1NB 3EYOA 1QA9A 2BJML 1F3DH 1D3CA 4S0TD 4HC1H 3TH3T 3LPGA 3FT4A 4DN4H 1AI1L 4OQTL 2FLRT 4HAFA 1JHKH 1P7QB 1PKQB 4GQPH 3MV7D 4O9HH 1K9TA 4DUWA 4KQ4H 1CK0L 3MBXH 4WCYH 3O3AA 2V5YA 2XA8H 1YEJH 2QKIA 1OAKH 2ILLA 2I5YL 4I4WB 2VRAA 3H3PL 4OLWH 4XMLL 4L3EB 1NCDH 3S35L 3T8XA 3TWCH 3VWJB 4FQ1H 4E5XA 2PYEE 4PJ9D 3D85A 1AO7A 5D1XC 2JJSA 3HPLB 3GRWL 3VXUD 4QHUB 4F9LA 3K4DA 4UAOC 1TZHB 4G6AC 3ZKND 1AFVL 1B2WH 3OZ9L 4JG1H 1R5IB 1QFHA 3MYJB 5DRZB 4IMLB 5ERWB 3TM6A 3W5NA 2DAVA 1ZEAH 1U3ZA 3E8UH 1QFWI 2MHAA 4O51B 3RWIB 3JWDL 3JV4A 2ZOLB 4MXVE 3S7GA 5T1LA 3OJMB 1ZHNA 2P1QB 4I77H 4KPHL 5J12C 2AI0H 2MQCA 2V2WA 3GJEA 3RPIB 1MI5B 3T08A 2APBA 3MJ7B 3P4NA 1MAMH 4APQB 3BXNB 2XN9A 4X5WA 5IGXL 2QR0A 3HTLX 2JJVA 5D2LF 2OZ4A 4GRWE 3QUMA 1RZIA 1JPFA 1AIFA 1XGTB 4OZIB 1IGJA 4XP4L 4KHXH 4EJ1C 2H2SC 1IC5L 4FFZH 1HCVA 4KAQH 1H8OA 1J5OH 3KYOA 1QSZA 4HLZH 1P9MC 2NY3B 4XT1C 5D1XA 3LCYA 5HBBA 4YHOH 1JN6B 5DRWB 5SWSB 4KJPC 5C2BH 2AXGB 3UJJL 4GG6E 4P4RA 4MB4A 3CVIL 2EO1A 1JGUL 2YEZA 3LQAC 4P0DA 3GSVA 1FAIL 1TIUA 4H1LB 4X8JA 3X3FL 4JFDE 4X6DF 4JY5L 1FV1A 4MQXD 2BXYA 4GW4A 3C5ZD 4PJIA 3IFLL 2IBBA 2EDHA 4LRNH 4Z7UB 1XF5A 1U8PB 1OW0C 2W1NA 1WBXA 5C0CB 3I84A 4OFVA 1ZGLM 1MCOL 4LCWA 2EDNA 1WFOA 1Q9LA 2D31A 4MVBC 3IU3A 4XXDA 1KJ3L 3TA3C 3MV7E 3BPLB 2VH5H 3FMGH 3HZKA 4OD1H 1YEDA 3IJYA 5L6YH 4PY7A 3VFOA 4YDKL 2FO4B 3RVVD 1P9MA 1C5DA 4JO1L 4HS6B 1G84A 3CAFA 3ZL4L 5J1SC 1ZT4B 2E3VA 1W8NA 5GHWH 3QCVL 2FSEA 5JNYA 2IF7A 2R1WA 3VFSA 4BSSA 4X6CA 1A3LL 1AD0A 1KPUB 1T5WB 3ZKSD 5IB2A 1R3IL 1MF2L 3I9GL 4MJIA 2VXVH 3VXUE 5HYQB 4E9LA 3REWB 1DE4A 3GDBA 5EBLB 3T2OA 1KIQB 1NC4A 5HHMB 1OW0A 3QI9C 1A7RH 4I2XE 1FZKA 3KPOB 2PW1A 2GCYB 4YHML 4UDTB 3QXDB 2IQAB 3EGSA 4XVUC 3QFDB 4PJDE 1C08A 1UACL 5BVJB 4MSWB 5DJ2B 3LB6C 2X89A 3C09B 3FO1A 1JBJA 2DQUL 2BC4B 1QA9B 4M61A 3NPZB 5CSZA 3TA3A 1QKZH 2WBWB 4MA3A 4PJ7B 3FT4B 4HWNA 2WQVA 3HNTL 3L1OH 1I7ZA 1AKJA 2IPUG 1RQ5A 1V7ML 3DX6A 3K2UL 1A9EA 2H3NA 4DOHE 4YIQB 5EC1A 1BVLA 5F88B 5EULV 2ICWB 4BH7B 1SM3H 5B4MD 4K9EH 1ZANL 4YDJA 5CZVH 4MNQE 1MJ8H 1PW3A 3CGTA 2NY1D 3LRSA 5CMNA 4ZODA 5D7IA 1N7ML 4DGYH 4G7VL 2ZCLL 3I3BA 3P11L 1PZ5B 1INEH 4GXVL 5FGCB 1U8OB 1JGDB 2XA3A 1RUAH 4BFBD 4Y4KA 1NUFA 2YA0A 1EO8L 2IQ9H 5EH1A 5J11C 4MD5A 1VFBA 3QI9A 1I8LC 4YHIB 3D85B 4E5XB 5J56B 3VQ2A 3AB0C 4GS7C 4BFIB 4JRXE 3M18A 5INCB 1AHWB 4HS3B 4I1NB 3PGCA 1Z6JT 5J57B 4YWGH 3IDYB 3GSRA 2DQIL 1BVZA 4E42A 3ARQA 2P44B 3G5ZB 2DD8H 1K8IA 4IRJD 2ESVA 1AJ7L 3JV4B 1KJ2H 5T1LB 4GRLD 3GI9H 3NFPB 4JKMA 4OLYL 3WDJA 4ENEC 4OZHF 1P4BL 2OMYA 4NM4L 3GJEB 4CU8A 3E1F1 4QXGH 1EZVY 3L3KA 3C60D 1LO3H 1SJHA 2E7CA 2F8VA 2XN9B 5KJRL 3TNNA 1ZA3A 3IXAB 5F9OL 3TFKC 4LXRA 5DMYA 2IFFH 4NKIL 1DBJL 1T7YA 5GRVK 5KVGH 1KIUA 3PHSA 1JZ4A 4F37K 4OBSA 2YPKB 2AQ2A 3ULVC 4PY8I 4ELMA 4PJEA 3UC0H 3U46A 1OTMA 5HPMA 4FRWA 4H8WC 1YJDL 3VXMD 1I8LA 2G2RA 1FYTD 2YPLA 4WFEE 5DVMA 3QG7L 1ZLUK 4N90E 1A4YA 3QYCA 3NMEA 3SE4C 1U3HC 2VERN 3WNNA 2OK0H 4U1JA 1HH9A 2R2EA 4P4RB 4PP1C 2VZ1A 3DO7A 3BMWA 2YEZB 3DHMA 4MA8L 3U0TA 2VTFA 3GSVB 3RL2A 2DQJL 3LIZL 3E3ZA 5MHSD 3RTQD 3ZYJA 3VH8A 3CVHH 1FV1B 4ALAL 4K7PL 4X9IA 5T33L 4PJIB 1GC1L 4XCCL 1EFXD 3H7LA 3RZCD 3C2AH 4X6FB 1NGPH 1A1MA 2X4SB 4N0FA 3HZMB 1FNAA 1EAPA 3QUZD 4Y4FC 1UB6A 4FQLH 3QXTA 2CDEA 2MNUA 4U3HA 3LDBB 2D0HA 4OZFA 4LCWB 1GGBL 5HGHA 2KH2B 5DR5H 3IU3B 4M43H 4K94L 4XXDB 4V1DD 2H9GA 3OGKB 3MRRA 3HZKB 4OT1L 1YEDB 3IJYB 5T3XH 4TNWK 3Q48A 3QHTC 1LP9F 1F6AA 4MXVF 5D7JD 5E1AA 4YHPB 1U3HA 5L7XL 1H5BC 4GMTH 1NCBH 3OGOE 4XCFL 5ICXB 3LAFA 5JNYB 4I3GA 4QHMA 1SYSA 2IGFL 3OGMB 4X6CB 4Z8FH 4BQCA 1TQCC 1YEIL 3D3VE 4JN1L 1EHAA 2Z9TA 4PGEA 1FG2B 4GRWF 5CKGA 4KKCC 1UEYA 2HRLA 2YHGA 5F96H 1KTRL 2GY5A 3SGKA 4XH2A 2J8UA 2BFVL 3WPCA 5GZOD 1EGJH 3VQ1A 3DSFL 5GSVA 3MV8A 1P69B 4Y4FA 3VGGA 2F53B 5EA0H 1GZQB 4ODUA 4X7EC 2N7AA 1DUYA 2CDGA 4MAYC 5DO2C 3ME0A 1WFUA 5IHLB 1OTSD 1MHCA 4MJ6A 1FLRH 2Z35A 4JO3H 2EIZA 1I7ZB 2JCCB 4YDIH 2OS7A 3DX6B 2BRRH 4JHWL 4J6RL 5EC1B 4AEFA 1H5BA 2LABA 1CE1H 4PJAB 4K7PY 4YDJB 3NTCH 3DRTA 1I1AD 4X8XA 1H3PH 1A7QL 3LRSB 4JANA 5D7IB 4NKDA 3BQUD 2Q8AH 3IDGB 2HKHH 1BIHA 2HLAA 2ADGA 15C8H 1BWMA 1BQHG 3WUWG 5TH2A 2IANE 4EI5D 4WTZA 4Y4KB 5D1ZD 4PRNB 5E2UH 5IJVA 3PDDA 2X1QA 1CR9L 5D96B 5JTWA 5H37G 3DX9A 4MD5B 1VFBB 3OKNB 4IOSD 1V7NL 1IE5A 4JM2D 1F4XH 3RWHB 4NZRH 1LE5A 4HGWA 2JLLA 3KNBB 4M6ML 5JW4N 4E42B 3FONA 4MAYA 1MJ7L 5FA3A 3SGDI 4BSWB 2ESVB 3BO8B 1NCTA 1BFSA 3B9AA 3DIFA 3OHXB 4EEEA 5CGYD 4X7TB 4ZO9A 5JPNB 1CDUA 3G5XA 4BQ9A 1KFAL 4K2UL 3TNNB 2FCBA 2E7LC 4YC2C 3U9PL 3C6LC 3UTSD 3KJ6H 3D69B 5DEZA 4FFWD 4G8FA 4CMHB 4PJDF 3SKUD 1A0QH 3U30B 1P53A 3R8BB 4ELMB 4PJEB 4JREB 3VXRB 4XC3H 4HMDA 1AH1A 1L7TL 4PRPA 1KLUA 1I3GH 1WQVT 4JLRA 3STLB 5K9JL 4FQXB 5DVNA 5TF1L 4Z76B 4S1RL 3RQ3A 2Z62A 4JFFE 4XNZC 3V0VB 3IB4A 1HH9B 1PGVA 1AGCA 1X4YA 3BE1L 1OTUC 4HUVA 2PXYB 4Y16C 1MFCL 3CVRA 4TSCH 1XGRA 1BVKB 4XVTL 1ZSDA 3UCRA 2NY5L 1A6TA 1DQLL 3EFDL 4Y1AD 3Q6FA 2JIXB 4X9FA 3UPAA 2QSCH 1W72B 4YHKH 1A1MB 5E5UB 4N0FB 2XRAH 2QADD 4OFPA 5C2UB 3MLPA 1YA5A 3A6CH 4K3GA 2E7LA 2F5BH 1S9KC 3C6LA 4OZFB 1JGEB 3VFRA 1IAII 1MFEL 3BX7C 3MJ9H 3O6KH 4NJAH 5HHQB 1BECA 2H9GB 4PGCA 3G3AA 4LVNB 2BNHA 4NRYA 3MV9D 3OAYH 3P73A 4HF5H 1FRGH 1F6AB 1DQDH 2R2BA 3QFJE 4U7LA 5E1AB 5F9DC 3RWDB 1WWAX 2HWZH 2NX5D 1Q9OB 2E27H 4Y16A 3TIDB 1QSVA 4GRWH 4G5ZL 3X13A 5KVEL 1SYSB 4XCEB 1UWXK 3NIGE 1OT1A 1PAMA 3TLRA 2QL1A 1XECA 2EH8L 1BD2E 2I9TA 1NAMA 4PGEB 4C56B 1YEGH 4LOUC 3MXVL 2BVPA 1F6LL 4M48L 4XH2B 5DD1H 2J8UB 3S6CA 4L8SC 5FYKL 1I3RA 2P5EB 3QUXC 5A2LH 1KIPB 3OXSB 5FA4A 3FZUD 4JFZL 4Y4FB 1CICD 3HUJE 1FH5H 1U8QA 5BJTA 1DEDA 1QSED 4ODUB 2HFFA 3BZFB 3C6PB 4UB0L 1BQUA 3SBWA 3QJFA 3WD5H 2ZP0T 1DUYB 2NQCA 3VG0H 3CFEB 4JCLA 4ZXBC 3QIUB 1MHCB 1XCDA 4XC1L 4TTDC 3MLYH 4HPOL 2JQDA 4XTRD 3ALWA 4EN3D 2Z82A 4J23A 4GW1A 1S78C 4HWZB 3NCBB 2VOTA 3HR5A 2J8HA 1WWWX 5EOTB 4P5MB 5LKNA 1MCDA 1IC1A 1YPZA 4JANB 5D71H 1DBKL 2I60H 5FM5M 1SVZA 5EZIL 4OCWH 1P7QD 4OQTA 5JOFB 1X5IA 5F6IC 4HX1B 5E6YA 5DQJB 3EJJX 1QPXA 1BMGA 1CXKA 1HSBA 3QXWA 4L8SA 3UL8A 2HFGH 3QUXA 3WBDA 5L88H 2HT4C 3QO1A 4QRPE 4DAGL 1OB1B 1AGEA 3RY5A 1QBLH 3WSQH 2VLJA 5HHOE 3FHAA 3L5XL 4Q9CA 3FTGA 4PLKD 1QPPA 3QQNA 4L3ED 4NKOB 5EPMA 4Y1AE 5I19L 5L8LB 4GXUN 3VWJD 3FONB 2VJXA 1DUZA 1HXYB 3NN8A 3EZ8A 5DVOA 4P9HL 3WMSA 4R4BA 2OYPA 3O2VH 1FFRA 4HWBL 3DARA 3PJSA 1VDGA 3GRWA 2VWEE 3IDNA 2ATKA 3G5XB 2BK8A 2RAMA 3GMNA 5GGVL 4WHTA 1TXKA 5JW5A 3QNXA 5F9JA 1IGYA 1CXFA 2ERJB 5C08D 4CC4C 3QPQD 4OCSH 1YY8B 3KPQB 2EO9A 1MI5D 4LKXA 3CMOL 3O6FC 4APQD 5LAXA 4PRPB 3MLSH 2FYYA 1I7TA 1TETL 4AQ1B 1NJ9A 1MHHA 1TVHA 4ZFOL 3A67H 4KT1A 1HSAA 4MA1C 5AWNL 1EO5A 4M1CD 1QQDB 2PTUA 3MRIA 4Z5RA 3K2MC 3HC3H 2DYPA 1BQHB 4HUUB 5DHVH 1XGRB 1MNUH 5FKPB 1I4FA 1J1PH 8CGTA 4LI1A 1XGPA 3QHFH 4X4ZA 4CNMA 2Y7QA 2NY3D 3H9SA 5C0RL 2YXMA 5SWSD 3NAAL 2X7LB 5JIIA 4NZTL 4NUGH 2DTMH 2LFGA 1JPSL 1FBIH 1HHGA 5B39G 1I3UA 1J7VR 1J0YA 4Z0BL 3C6LB 2WBJC 3VFRB 4GKZA 3QWRA 4C59B 1T66D 2IPUK 1U0ND 4PKIG 5I1EH 4CC4A 1R3HA 3FQNA 1BF8A 5IW1A 5F7DA 3UZEA 3O6FA 4MZ3A 5F9AC 1WF5A 3QNYA 5C0CD 2R29H 1LO5A 4P2QB 3Q6GL 1UWEH 4HZAA 1BQLL 2ZJSH 2WUCL 3QO0B 4KGLA 4RAHA 3S37L 5IW6A 3MLXL 5AZ2L 4Y16B 1PKQE 3PQYE 3SO3B 1VGKB 2AK1H 5JOPD 5FUOL 2ZZUT 1LD9B 2W59A 4R8WL 2AV7A 5HD8D 4XNMB 4LNVA 5EUOA 2BVPB 3PGDA 4HIXL 3DYOA 4KTDL 5JDSA 2X40A 1UZ6E 4L3EE 2R0KH 2XZQL 4LAQL 4PJXB 5BJTB 1JZ6A 3HHRB 2WBJA 4UV4L 5AWDA 2HFFB 1DS9A 4LSUH 5K9QI 4QRQB 3JTSA 5I71C 5TFSH 4O2FA 5HHMD 4YPJA 4PLOB 2WWMD 4X83A 4F7TA 3MO1A 4JRYB 5GZND 1JGLH 2EZ0C 4LHJB 4WHYG 2XWTB 4ZUSA 4YFEA 2V9TB 4WVRA 5J9PB 1N5YL 4Q9QH 1YPZB 2DLFH 1XCTA 2RJMA 3T3PE 3BZEA 5H2BA 1CBVL 1F3JB 4W4NA 3IYLW 4UV7L 5GS0L 2AS5M 2X4PB 3RW6A 3OX8B 3D39A 5DJ0B 1E27B 5HSFA 5LQBH 1HDMA 1OHQA 4EOWL 1Q9WA 4L8SB 4ZOBA 2Y23A 3G5VB 3EDEA 1HH6A 2J4WL 4CDGC 4OGZA 4U31A 2O5YH 3OF6A 3QO1B 5H94A 4OZIE 2UWEB 4JVPA 4WO4D 2BNQB 1OP9A 3VFNA 1YEFL 2VLJB 5F97E 1S7TA 4U33A 4OIBA 4G8GB 5MEOB 1V3KA 4PRBB 1A64A 1TQBC 5ISZD 5SWSE 3S34H 3D85D 1MAKA 3NIGF 3C5SB 4N5EC 4R4BB 1OF2B 1YJDC 2VUOA 3E2HC 5EZOH 5ITFA 5IR1B 3QCUH 1KUMA 1ZTXL 2BSRB 3M19A 2BZDA 1OGTB 3IDNB 5CEZE 1QO3A 4PGBA 3OJAB 4JPWH 1JI2A 2I07B 1U2HA 5DD6B 3MLZL 4JM2F 1I75A 2ARWA 3PL6A 4Z7UE 5IIEA 3ULSB 4GG8A 5D7SH 3HUJF 3QNXB 5F9JB 4M4PA 4XNQA 1MCWM 3R0NA 4UINL 5CSBA 2C1OA 4ODSL 5F6IB 3VFGH 2PR4L 4XTRC 5J0BA 1KG0A 2FBJL 4RRPA 4M8QA 1VCAA 2FGWH 1VHPA 1JCKA 3HZYA 1HSAB 4KWUA 2Q3AA 4H25A 2DWDB 3UYRH 2VR9A 1G9NH 2C4FU 3LEYH 1NCAH 3PP4L 4HWEH 3WFDL 2GUOB 4KJWC 4GT6A 4XZUA 4OGYL 1DDHA 1JZ7A 5JW3L 1EV2E 4AM0A 5GGSB 1G9ML 2GYSA 3QA3A 1BGXL 3CXHK 3IS0X 5GRJH 3DUUB 2EE6A 2J7LA 1S5HA 2XFXA 5HHME 2H32B 5I73B 3BDXA 5GS2B 2CO7B 3TBVB 5HI4D 1CQKA 4QHKJ 1R3HB 3FQNB 3S96B 1LEGA 3O6FB 4X0KB 4I18B 3MZGB 5FYJL 3KPSA 3UJIH 2GAZA 1LO5B 5F7NC 2OP4H 1DN0A 4PJ7E 2AEQH 1Q1JL 3RVTD 3JUZA 3RGZA 2HT2D 1RUKL 3FO2B 3UBXG 5BOZG 5D70L 2AAVA 2O5XH 5MENA 2YRPA 3HAEA 3MOAL 4G80B 5BXFA 2P1OB 3CSYA 5AUMA 3RU8L 3SDCA 3U7YL 1IEBB 5I18L 3WN4A 3BI9X 3K1DA 4KRPB 1CXIA 5JDSB 3WIIH 4RISL 3P4MB 2VDKL 1NBQA 2NW3B 2DMCA 2JB5L 2X9XA 3U48A 5AWAA 1GOGA 2XTJE 3G5YB 3JTSB 1CU4L 4EQ3A 2VAJA 1XGYH 4U1HB 4LLVA 5BQ7B 3CNKA 2XKNB 5HHVH 2Q3ZA 3RBGA 1QLFA 2F53D 4NQCB 3BDYH 4ZUSB 2CIKB 1A4JA 3MRBA 2ZPKL 1GCFA 1YRGA 4KH2A 4M9PA 2JELL 2AKRA 4L1HA 3T1FA 3QWOA 5ID1A 2WQRA 3DMMB 5FGSA 5GXBB 4QTHA 4Q6IC 5H2BB 1WLHA 1OARL 3BZEB 3ORJA 4ZUWA 1F97A 2XN9E 3D39B 2EXWC 3D2UB 1JZ2A 3KGRA 1Q9WB 2DQDH 4CVXA 5CIPB 1KTKE 2IH3B 5AWBA 4ZUVA 1RUML 4XP6L 3VFNB 5KS9A 1FNFA 4MNGB 2OLDA 3X3GH 4Y4KD 4LVEA 3INUL 3IU4L 1EJOH 1YYML 1MH5B 2IEPA 2QHRL 3BGMA 2JE0A 4MB5A 4Z61C 1DBAH 3TBWA 3N9GH 4MXQC 4JAMB 3O6LH 3B83A 3FO0H 3IF1B 2MKLC 1GPOL 3GJFH 1QO3B 1Z7XW 1Z3GH 4GBXC 4PJIE 3NZHH 5T3ZE 3PL6B 4Q6IA 5C70A 5IIEB 4ECOA 1UZ6F 4GG8B 2L4OA 2Q20A 1KJMB 5FF6B 2HVJB 1U91B 1NCCH 2C1OB 1UB5A 3CDYA 2NY0B 5IFHH 1A7NL 1MCKA 1IGCL 1HOCB 4LPUA 4PRDA 4LCWE 2AGJH 3GMPA 4QNPE 3HCVB 2R56H 3RIFF 2APTA 1CD8A 3BN9D 4KKAD 1BZ9A 4M7KL 1OP5H 1H3GA 2Q86B 1W0VA 3WS6C 3O4LD 4YBQD 3VGBA 4HGKC 1UXWA 5J6HA 2FJFA 3VXRD 1C5CL 3EOAA 3DV4B 4OCRL 4NRXB 2H1PH 4FQXD 1RZJL 4U6VH 3RI5K 3ZE1E 1G7HA 1R5VA 3GBNL 4F2MA 4JY6B 4FHOA 4X6CE 1G7IA 1S7RA 4TNVK 4W70A 1MQKH 1RY7B 2PXYD 1U3YA 4GBXA 4KK8C 1RI8A 1UYWH 4MJIE 4BM7A 1YUHB 2V7NA 4KQ3L 4OZIF 1JNNH 3S88L 1IBGH 2JIXD 4W81A 5F7EL 2WM0A 3H2WA 2F53E 4KC3B 3WV0A 3V8CA 2VAAA 1LEGB 2HP4A 2VDRL 3TJEL 4NO2A 2GAZB 2R23B 7FABH 4P2RA 3WS6A 4JPVL 3UTTB 5K59E 4PJ5B 1K8DA 3CXHJ 2P5WA 4GQ9H 3G04C 1I9RL 3ULUL 3GSNB 3HE7B 4ZO7A 4PJAE 3HAEB 2JF1A 1PSKL 4NPYB 4Z7UF 4FQCH 1V3JA 1TZIB 4D2NA 4CDHA 4NYLA 3CSYB 3SDCB 3EO1B 4M7JL 5F8RC 5D7IE 3QQ9D 4L9LB 1BWWA 3F6LA 4HIIB 4QRTA 4HS8L 3Q3GA 3BD4A 4X80L 3GSUA 3MGOA 1KCUH 2YD4A 2VL5A 3REZA 1IEAB 1GIGL 2E7BA 4WJ5B 4C56D 2XQYG 3OGCB 4M7LH 4XNYL 3MRHA 3BDBA 4LVOC 2A9ML 4NDMA 2P5ED 4TSBL 5A40E 2YD8A 2BY1A 3R1GL 1NUGA 1S9WA 1QLFB 4H88H 1MLBB 5FYJU 2WFHA 4OKVB 1P6AB 1E4KC 1JZ5A 3NCYS 4XNXH 4MAUL 4OLUH 3M1BA 4O58H 3QDHA 2ESVE 3NABL 4FCGA 2B20A 3X12A 3MNVB 2AJXH 3G04A 4R90L 3QIUD 2C3XA 1F90H 1RZ7L 4KNGA 4L3FA 5I1KL 3EFFA 5GJSH 3LS5H 5ILTL 1OSZB 4P9HC 5CZXD 4LIQL 1LQSR 4KMLB 2IH1A 1CDBA 5TPWH 1DR9A 4CVXB 3O8XC 2HJLA 4AL8L 5TDNA 4AJ0A 1QR4A 4N9GB 3Q0HA 3WE6A 1VFMA 1C12B 4KDWA 4P9ML 4ELME 4PJEE 4ZUVB 1A6WL 3I6KA 5KAQF 3L95A 3UBXB 2VDQL 4XHJD 4PJ7F 3B6SA 4Q9RH 4MCYA 5DQDL 2YPLE 3N50A 2R9HC 5IQ9A 1I9IL 3EKCA 2JE8A 3B9EA 4KKBC 4DZBA 2ORBH 5KSAC 4OB5H 5FDWA 1E4KA 1JWSA 4U1GB 2PW2A 4HMCA 1AGDB 3MRJA 2WP3T 1CD1B 2C7UB 3C5JB 1FLTX 2VLLA 1ZT7A 3GB7B 3SCMB 2H8PA 3OPZL 4C57C 1RURL 3ZZ1A 4MGXA 1BQSA 2WZPD 1BEYH 4Q6IB 4X7FC 3SQOL 4J3SA 4GKNB 3G6JB 3WJJC 1MCSA 3VMNA 4JB9H 1REIA 4G43B 5JO5B 2DQEH 1UB5B 4HWBA 2KZ1B 4R7DA 5BV7H 2PO6B 3V4UH 1U58B 1E4WL 3O8XA 5E08L 5LJYH 5HYJD 4JKPH 2Q6WA 5ANMB 1XZ0B 3PG2A 4KRLB 3WFCH 2EYRB 1ZVHA 2R69H 4N0YH 5E8NA 4U1KB 5J6HB 3FQUB 3MR9A 4R7NB 3EOAB 5KSAA 1UM6H 3HI6L 5EWIH 2OMTA 1FO0B 2D7TL 1ITBB 1FE8L 4S2SB 1G7IB 5DFVC 4ZFOA 1HZHH 3CLEL 1ZLWK 4DN3H 4OFDA 3GMLA 4C56E 2F74A 3P4OB 1R5WA 3NACL 3L6FA 4TPRL 3TP4A 2J8UE 4DVBB 3IFPA 5CILL 5CBEA 3V4VH 5EU6A 3ZKMC 4U7KA 3WJJA 3BESR 3V0WL 1N0LA 3U82B 2FX7H 1TCRB 2FWOB 4WWID 3UTOA 2BY2A 1MFBH 3D25B 3E6FA 1FPTL 2B4CL 1AP2A 4GKSA 1U92A 4H1LH 4DUVA 4ZYKB 5CEZH 3FO9B 1DCLA 1W2KT 5CLWA 4MD4A 2DKMA 3MV11 4WW1A 5KOVC 1CF8H 3RAJH 5DRNA 3TO4C 1K8DB 3PGFH 4ONHA 2A77L 4AEEA 1CDCA 4GAJH 4PJIF 1PLGH 1XEUA 3O11A 1L0XA 4ZFFA 3L9RA 3TPUB 3HNSL 4YDVB 5CD5D 4NYLB 4P2QD 3GK8H 1ZHKA 2NXZC 5E6ID 3NGBB 2OR7A 2XPGB 2CKBL 2NY7L 3P4LA 1GOHA 3P2TA 3Q3GB 1KB5B 3SOBL 4JPKH 3MGOB 4QNPF 1VPOH 4OF3A 4YBHA 3MJGX 1DEEB 1KN2H 5L8JB 1IEHA 1QFWL 3QAZB 5GS0C 1NGXB 3GM0A 4UTBH 4H5SB 2ARJQ 1CZ8H 4R2GC 4NDMB 4RWYL 4HJ0C 4LSAA 2X4OB 4I13B 2IPKA 1OPGH 3GUTB 3ARFA 1HNGA 5KTEH 1LDSA 1S9WB 1U93B 5DHYA 4Z7WB 4G9FA 2MTPA 4PR5A 3HE6C 3ZE1F 4ONFL 4R3SB 4R6FA 3TO4A 4X6CF 5ESQA 1K2DA 3ARBC 4DGVL 1HEZA 2O6QA 1KEMH 4JRYD 3T0EA 5EU4A 4PTUB 1T89C 5I16B 1J11A 5IB4A 4OGAD 4C55A 3M17A 3Q1SH 1J87A 4DFHA 5FM4A 2JJTA 3K1KC 4NCC1 1LMKA 3WE6B 3TZVB 1IC4H 4JFYA 1MRFL 5FHAH 3I02B 5JIPA 3FAWA 4Q2ZB 3W0WA 1JPGB 3LSOA 4PRPE 2CUHA 2OL3B 5GS0A 3B6SB 4YNYB 1M6OA 3LKOB 4MCYB 3WFZA 5IBLC 1ROWA 5SV3A 5K59F 3MGTA 4DZBB 4UNVA 3LRHA 2HFEA 4N5UA 1HHKB 5GGTL 5FYLE 3VDAA 1IGIL 3CLFL 4PJAF 2BNQD 3HE6A 4KMTH 5FIEA 5GGQH 3WFEH 1JWSB 3HNVH 3QXVA 4U2YA 3SGEH 4NP4L 1CG9A 5D7IF 3BZ4B 4IMKC 1ZT7B 5C07A 4D8PA 4G8GD 1P1ZB 2H8PB 1XF3A 2Y9RT 3FQXA 3ARBA 1MRCL 3U0WH 3RVXD 5DGRA 1QRKA 3G9AB 5DDHA 3BD3A 4OLEA 3WNMA 4KJQD 2Q8BL 2A6JA 1ETZA 5DUML 5LVEA 4LDLB 1OAQH 3CIGA 1HI6B 2E8YA 4NOFA 3VI4E 5DEGA 4FXGA 4R7DB 1G7MA 3AVEA 2Q7YB 4WEUD 3KYKL 3RW7A 4TVSa 3RKDD 1M7DA 1CXHA 1G9MC 3C08H 2Q6WB 3BHBA 1VEOA 1QG3A 5DK0A 5J4MA 5HZLB 1ED3A 1RUPH 5IQ7L 2ZOKA 5CEYA 2YN3A 4HLZG 3L5WA 2B1HL 2P48B 4NNXB 3MR9B 4PEQB 2VDML 3C8HA 4JM4H 1ONQA 5KSAB 1QSFB 3PF2A 4PUBH 1RHHA 2CMRL 4Y5XA 5CGMA 4XB8A 3QUMH 4Q7DA 4E41D 5I8KH 1TZGH 4IMKA 1WEJL 2HTLC 1RULH 3LKNA 2CD0A 4NHCL 3W9EA 3UYOD 1IKNC 1WBZB 1F45A 3L6FB 3A6BL 4ZQKA 4XCNA 4ELMF 4PJEF 1T04B 5DZNA 3OAUH 4UIKH 1VENA 4CAGA 4XP1L 1FG9C 3D18A 4J2XA 3SY0A 1EHXA 2AXJA 3OKEA 4CVZA 2JJUA 5I1IH 3QNZA 3ZDYF 2RBLA 4UMGA 5F9WC 1Q9KB 5I1AA 5GS2D 4F7PB 5T3ZH 4AENA 3SKOB 1X5ZA 1RIHH 1VSCA 1NFIA 3MMEA 4XPTH 4OF7A 1G1CA 3L9RB 4YHNA 1YPZE 3K3QA 4XBPA 5HHPB 5TQ2L 1ZHKB 2EC8A 5E5MB 5CAYB 1ZA6A 2VZSA 2NZIA 5I66B 1YNKH 2UYLA 1CFVH 2D0FA 1IKNA 3VRJB 4FQPA 5D6CB 1Q72H 1SJEB 2ZUXA 4OCLC 3T0WA 2YOCA 1DBMH 1F2XK 5AD0A 2EDLA 1RIVH 2UWEE 3A6OA 4PLNC 4TVPD 5HYEA 2BNQE 4KRPD 1A6AA 2VLJE 5DD5L 1NMCB 3GHBL 3ARFB 4YHYB 2A6DA 2AP2A 2H2PC 1K4CA 5LWYH 4IIQC 2YC1B 1J86A 2VDOL 4CW1B 1XF2A 3MBEC 3FT3B 4I3RH 5ESQB 1AQDA 4EIGB 2BVOA 4OCXH 5F1KC 4X6EB 4W6YB 2CRYA 4WI5A 4NQCD 3T0EB 2J8UF 4JFEA 4MWFB 3PDOB 3B2VH 1NEZA 3LZFH 3AREB 4K8RD 4LLDA 4UUJA 4MHHI 3DMMD 1EO7A 2VR4A 3CC5A 5KOMC 4DKFL 3Q2CA 2R0WL 1HE7A 1HHJA 3NCFB 3WO3B 3T77B 5EO0A 4XWOD 2R0ZL 3D2UD 5E4EC 1E4XI 1AC0A 5KW9H 1FP5A 3L7FA 4OD3L 4HFWA 4R96B 4OV5B 1YEEL 1BHGA 4YK4B 4ZPVB 3ARTA 2G75A 3AY4C 2CSPA 4NJ9L 1MREH 3O0RH 3SE8L 3WUWA 4IIQA 3O3DA 3VMPA 2VIRA 4Y4HB 3QUKA 4Z77B 4D8PB 5C07B 4WGWB 1I1CA 3IGAB 3MBEA 3MRDA 1EXUB 4G8IB 5B21A 5GRUL 1A7PL 1CL7H 1X44A 3ARDB 1DBBL 2A6JB 1FAKT 2FEDC 2GTZB 4F3FA 1D6VH 3HG1A 4M1DL 5DGQA 1UZ8A 4LHUG 1MPAH 1ZHBA 1B0WA 3B4NA 1M7DB 1T5XB 1PX3A 2GITA 3PL6D 3QHZH 4XPGH 1FIGL 3HRZB 1EUUA 1JPTL 1NANI 4FOMA 1FVCB 4ZSOA 3WIHL 5DK0B 4JFHD 3EJYD 3L3JA 1JF1A 4IRSD 1BX2A 4LLQB 2ZOKB 4XNUL 5CEYB 1T83C 1X5LA 1BJ1H 2NY0D 3L5WB 4OCMC 4BYHA 5F1SA 1YDPB 3TNMB 3V7AG 5IKCB 2VLKA 1RHHB 5DJXB 2CGRH 3AY4A 4Z7OE 4I6JB 3LKRB 4RFOL 4Y5XB 2I9LA 2X44D 2ADFH 2W60B 1WVZA 2VZVA 4RMWA 3BKYL 1ZOXA 3WNKA 4OIIH 4P5TD 2FATL 2XQYK 1OAXH 5EUOE 1P6FA 1F8TH 2OTPA 5J1TC 2ZUQB 4KTEL 4P3CH 3ULUC 4FABL 3PP3H 3QZWG 1PQZA 5KBNC 2VISA 3O3EA 2F58L 2AJYL 4ZOCA 3D18B 4ZTPH 3SY0B 2IWGA 2UZYA 4WUKL 3OKEB 4CVZB 4C58B 1RU9H 4YEFA 5I1CH 1J1XL 5JMRA 1T0NA 4RAUB 4NOBA 5IM7B 1DN2A 2W0LA 1YQVH 5CJQL 2AXFA 4NFDA 3TN0C 4KJYB 4BK4A 4FXLA 4NQCE 2BDNH 1RSFA 1T83A 2EC9T 1NFIB 3UO1H 3PNWA 4FDWA 5ADOH 3KHQA 4ZOAA 4QCIA 2Z8VC 1X5FA 2BSSA 3SE9H 4OZFH 1UWGH 4N1HB 2FT3A 2Z92A 4TRPL 3UTTD 3I6GA 1QVOA 3MOQA 4PJ5D 5DT1L 3VI4F 1JIBA 4HV8A 1FFNA 1UT9A 5I1JL 3D39E 1T4KB 1FN4B 3HE7D 4H8WH 5LCVL 1A14H 3ULUA 3EO0A 2YMXH 5CMAB 3SDCD 3GKWH 3O2DH 3W2DH 1N6QH 2VQ1B 3CCHB 1DQMH 4RBPH 1CFSB 1KPVB 2M1KA 4KY1L 4PGZA 3F7QA 1GAFH 43CAA 1K4CB 5F9WB 1S9XA 2YN5A 2MWCA 2EE3A 5IT2H 2N4IA 3TN0A 4BZYA 1B4RA 5AG9A 2BX5A 3LN4A 4LARL 3D9AH 4RCAA 1R3JA 5C86A 3UPRA 3P0VL 5DMIH 5FOBB 4KXZH 2Y36L 4WHDA 1AGBA 4NWTH 2KDGA 1T7ZA 4OZ4A 2F9BT 1NEZB 5E9DA 4PJXF 5JR1H 2VDLL 4PTTA 5EORL 3EHBC 5E5RB 2W0PA 1HHJB 1ZS8A 4HDIA 3WS3B 3CK0L 1OAYL 3MREA 4IS6A 2XIDA 3N85H 5EO0B 3RL1A 3EYVB 1KENL 1F58L 4Z95L 5DD3L 3KXFB 3VXSA 4YO0A 3L7FB 2HKFL 3EJZD 3V8OA 1LK3H 4LEOB 2OJZL 2O6SA 4NN7C 4Q0XH 1AGFA 1FORH 4IIQB 3MNWB 3O3DB 1YPZF 2VIRB 3BYTA 3SO5A 3QUKB 2DQGL 2AV1B 1TNNA 1MVUA 5C0EB 5KVDL 2FD6H 1LHZA 3GIVB 3TYGL 1JYVA 3HS0A 3MJ8B 1YY9D 2R4SL 1IAIL 4UBDC 3TBSA 3BH8A 5K9KB 5KSBB 1L9NA 1SEBA 4YE4H 4Z8GA 4JFPA 1GGCL 3RWGA 3H9HA 3PWJA 1CLCA 4F3FB 2UWEF 4UT6H 3SCMD 3ZMRA 1VEPA 2QQLL 2YZ8A 2VN4A 4P4KC 1OAUH 35C8L 3HG1B 3CFIC 1K3IA 1UZ8B 4LSSL 4QXUL 1NBYA 1XR8A 2FB4L 1ZHBB 2FX8H 3P77A 2GITB 5ESAA 4C4KO 5E2WL 5L0QC 2R0LL 1CLYH 4NGHL 2M26A 2OR9H 3WLBA 4LU5H 3L3JB 5LBSH 1JF1B 3KPSE 3WO4C 5E4EB 1LWRA 4PRIA 5I30L 2PO6D 4NQDB 3UTTE 1IQDA 4MCZB 4G3YH 4XP9H 2QQNL 4WW2C 2B4CC 5I8EA 5MERA 5FAAA 3UJTH 3O81A 2QV2A 1MIEH 2VQTA 2C4FT 3WFBL 3FT2A 2Z31D 5KANG 4U1LA 4LCYA 1HIMH 1U8HB 3U4BL 2YD7A 3CDFA 5E94B 5FYLH 2UZYB 2A2QT 3JTTA 4HIJB 3EO9L 2V2TA 2E6PA 1MWAL 2FHFA 1KJ2B 2XXCB 1MHPH 1ZGLP 5BMFL 2NPLX 5LGJB 5C0DA 3MACH 4FQIH 4LCIL 4YFDB 5B39A 4P59H 1B6DA 5E8DH 5D2NB 5GISL 2J3SA 1YECH 3C87A 3ZE0E 4RCWA 4URTB 1TITA 4LHUB 4WW2A 3HI5L 1MAJA 4M62H 1VGEH 1I1FA 5DVLA 5TQ0H 5L8KB 1PEZA 2VE6B 5E2VH 4DFIA 1A5FH 1NGYB 4GUPB 1EEYB 4YXHH 1A7OL 4ODHH 3QG6A 4FP8H 4UQ2B 2F19L 1TJIL 1MCRA 5DJAA 5KS9E 1NDMA 1D5MB 4RFNB 5LG1A 2CKBA 43CAB 5HI5C 1XMWA 1S9XB 2E7MA 4J1UA 4Z7OF 2FIRT 3CVHB 3MROB 5JA9A 5CUSH 3QDGD 2IPTL 4O5LL 4H26B 2HLFC 1KC5L 2B1AL 5D72H 1BM3L 1CGUA 3QZWB 3KS0H 1ODAA 2IG2L 5D4QA 1HN1A 4RSVA 4IOFC 1I9JH 1A6UL 3GBML 5I75B 1C1EH 3QCTH 2H6PA 2P42B 5E2TL 1AGBB 1SBSH 5E99L 3BGFC 4ZDHB 5E9DB 5C1MB 3VGDA 1T0MB 5ENWA 3ARSA 3LN5A 1XEDA 4Y2OA 3QPXL 4R4NC 4L8DB 3MREB 3LEVL 4P5KB 1RZFL 4GAYB 5CP7A 2EYTA 2RR6A 1K6QH 3FQWA 4YO0B 4ARNA 4FFVC 4Z0XA 1IGFH 4KZDH 4J8RB 1KACB 2P8MA 3NPSB 4X5LA 2BJMH 3TWCL 5B0TA 4OM0L 5IOPB 3TZVD 3VFVB 1FO1A 2D7MA 4F7EB 2YSSB 1OT2A 4MLIA 3LV3A 1XIWD 5BS0B 1S9VA 4PRHA 4NO0A 4X9HA 4XBGB 3QIWD 2LAGB 2XY1A 1MVUB 1QRNA 1UEMA 3KR3H 3IXTA 1B2WL 3DZEA 2XWJB 3IDMA 1YMMA 2ZUYA 5IJBA 5HTSA 1CK0H 5GGTA 2L0DA 5TDOB 4NNPH 4JFPB 3KPTA 1XWDC 5EG6C 3PWJB 3EYQC 3RRQA 4NQSB 2I5YH 2VLRA 3H3PH 1XR8B 4JY4A 4XMLH 3UL9A 3P77B 1ORSA 3S35H 3F6IA 3WPDA 4ERSH 2FLBT 2PN5A 3FRUB 5FO7A 4YQXL 3X14B 3GRWH 5SWZD 5D93C 3GMOB 4KRNA 4P2RE 4PRIB 1X5JA 1AFVH 1GGIL 3OZ9H 2MQ3A 3CFDA 1BJ8A 1MIML 2P5WE 4L3CB 3BKCL 5MERB 4N8PA 2APWA 3JWDH 1GRWA 2E6QA 3RIAK 4KPHH 3UMTA 2KKQA 4CILA 3O9WB 1IGTB 3FT2B 4U1LB 1QSFD 1YEKH 4L8BA 3ZT6A 3TVMC 2ICWI 5IGXH 4BV4R 2CRIA 5KG9A 2EEDA 4QYOA 3GSQB 1URLA 3DV6A 4DEPC 1IC5H 4RGOL 1CFTB 4AIZB 4M93B 4QEGA 3SGEI 5FK9B 5L0QB 3CMGA 5FYKE 2OXHA 4PG2C 5C0DB 3FB7A 1QACA 3L5HA 2ELLA 5ACZB 3UJJH 1RK0A 2A0LD 4L5FL 3OKDA 3QQ4B 2VH5L 3K4ZA 1JGUH 4OD1L 3V6ZB 5L6YL 1HHIA 4EUPA 1F3DJ 5DRXA 4WW2B 1FAIH 5IV2A 3G08A 5GS2H 3OJ2C 3X3FH 4JY5H 1EJ6A 4C2BB 1I1FB 1L4IA 4TULL 3LEXB 3ILQC 1V3LA 3IFLH 4LNRB 5GHWL 4DKAA 4NNYA 3S5LA 4OFYA 1DQJA 1MJJA 3CFBA 3ROLA 1Z9SA 2DQCL 4IOIB 3TVMA 1NDGA 4G6KL 5EZJA 5ACLA 3MRLA 5J1AA 4I3SL 1MCOH 2DM7A 4D9RE 1MHEA 2NYYD 1IM9D 2JK5B 1BBDH 3RGVA 3GHEL 1T80A 5KSUA 1N5AA 2IALA 3NCJL 3SDYL 4YDKH 1A1NA 5IWLA 4JO1H 2NTFA 4PG2A 5A3IC 2IMMA 4HCRL 3ZL4H 2COQA 5MI0C 5C0JA 3I6LE 3QCVH 1FVDA 1NKRA 4TZHA 2DLHA 1KNOA 3ZDZE 2W38A 3PHOB 3L1OL 3QIBC 4LF3A 3ARUA 3ZKXB 2BEXA 1A3LH 2Z63A 1NSNL 2DWEA 3IETA 4P46B 4NKGA 1JTPA 1SM3L 1YNLL 1R3IH 1MF2H 4K9EL 3I9GH 1X5GA 5CLTA 3V6OC 4CNIA 2Z81A 3IKKA 5DS8B 2F5AH 1S8DB 4A6YL 3WN5B 3RWJB 3MUGA 2GW5A 4YHMH 4Z7VA 3QUYD 4K8RH 1UACH 3ARED 4Z0XB 5AYUL 3NCYP 1RUAL 12E8L 5B38A 2DQUH 4GRWB 4N0UA 1VEMA 3EUUA 2IQ9L 1D5ZB 3O45A 4NO3B 1GSMA 3GMMB 3PWNB 4PJGA 3ZE0F 1FSKC 2XOTA 1S9VB 3HNTH 4PRHB 3L3DB 1QSFE 3PUCA 5IYXC 2VSDA 3MYZA 3K2UH 4U05A 3GGWA 1E6OL 1SYVA 2WINB 3IXTB 1H15B 4YWGL 5CIPH 1ZANH 2ADIB 2OJEB 1EEUA 1YMMB 1A9NA 3UTQA 5JMOC 3PWLA 4K3EH 2DD8L 4WRLA 2GJ6D 1N7MH 3QIBA 2ZCLH 3SDDC 4GG6B 3BAEH 4Y4HD 4L8CB 3P11H 4ODXB 5HHNB 4B8CD 3JBG7 4GXVH 2P1MB 3JV0A 3IRPX 4M3KB 4JY4B 3V6OA 1T3FB 4ZS6C 3VCLB 5I17B 3DI3B 2D9QB 1U2CA 1IT9L 2CLRA 2H26B 1EO8H 3ARDD 4Z79A 5FECA 1DANU 1JTTA 5E8EA 3BUYB 4RIRB 3LQMA 5JLZB 4HUKB 5DEFB 2OTWB 4ZAKC 5IVXA 5C3TA 3UC0L 4GW5B 4CVUA 2DQIH 1MCPH 5E7BA 5FO9B 3OJDB 5I6XB 4LPCA 5DC0A 5T5FL 4N0RA 3GMRA 3WIHA 1WZMA 3G06A 1XFPA 4OLYH 5IB5A 1FQ9C 5D1QC 3B5HA 5E8OB 1NGWA 3LKQA 3G6JF 2OR8A 4NM4H 4OZGA 2X10A 2ICEA 2XZAL 3KPPB 3DBXA 5KJRH 3CDGA 5GSRA 1FZMA 4C83A 2GTWB 3SDDA 5KG9B 4W4OC 2RB8A 4KUCD 4KKLC 3B9KA 4NKIH 1S7SA 1DBJH 4QYOB 3KPMB 3S9DB 1T1XA 3F12B 4RGNC 4JO2H 3VFWA 4JDTL 3TEUA 9CGTA 2GSGA 4MDJA 4BH8A 4FQLL 3ZE2E 5HYSA 4NRZA 3DSNA 4J3UA 2Y25A 4RWHA 3D0VA 2IAMA 3QG7H 3HLAA 1CFNA 1EVUA 3FB7B 4MHHG 3EOTH 4ZAKA 1YMHA 3UXFA 1CL7I 1ZMYA 3EYSL 4NM8L 2OMZA 3BJLA 4WFHD 3FFCA 3HB3D 4MA8H 3DLQR 5T3XL 2DQJH 3LIZH 5F71A 3TO2A 5IV2B 5HGDB 1UKSA 5AAMA 1GZPA 4K7PH 1UCBL 3T0EE 3B5TA 3TESA 2HVKA 5I8CA 2O5ZL 1GC1H 4XCCH 5D1QA 2KBGA 1K85A 1NCBL 4PV9B 4QHKI 1G0XA 3B3IA 1J0HA 4DOHB 1OL0A 3S5LB 2QHLA 3CFBB 5A2KH 1CFQB 3JVGC 1B0GB 4LSQH 4MNQB 2L7UA 5J1AB 4W4OA 3EDDA 1AR1C 4RMUA 3W0WE 3N1FC 2UUDH 1GGBH 3QDMA 4HHAA 2XY2A 4YAQB 1YQ2A 1HHHA 4K94H 3LD8B 2HAZA 3HAEH 5EN2B 1VADA 3RGVB 5HPOA 4OT1H 1TVBB 2AJ3A 5KSUB 5EA0L 2IALB 1SEQL 3OKLB 3RWCA 2CR3A 4L9DA 5JQ6L 4HLJA 5L7XH 1LO0L 2UY6A 2CH8A 4XCFH 4MD0A 1DL7L 5C07E 5T1DH 4DCQB 1H3WM 1I1YA 2IGFH 3MCKA 5F6HJ 5JHDA 1YEIH 4Q6YA 3U2SB 3SKNA 1NCUA 4RFEB 2EXYC 1CE1L 4LL9A 3MUJA 2HMID 3VXNA 1WK0A 3PABB 3DSFH 2Z93B 3DUSB 3KYNB 1JFQL 2BVEA 3JVGA 4S0SD 1C16A 1QEWB 5A5CA 4FG6D 2Y5QA 3E6HA 3FB5B 4Z7VB 4Z7WF 5B4PA 1CGVA 1KIRB 2BOCA 1X7QB 4WWKC 1V05A 3F5WA 4PJGB 1T1YA 5I1DA 5K9OB 4YXLL 1QYGL 1HILA 1A6VH 4JHWH 4MLSA 3KXFD 2VNCA 4J6RH 1A3QA 1AD9A 4YEBB 1P4LA 3GGWB 3O2WL 3PDGA 5DYOA 4AG4L 3WL9A 2KQMA 1A7QH 3EZJB 4HZLA 2IBZY 1L0YA 1OM3L 4BQ8A 1U8NB 3I75A 1CDIA 4WGVB 2IMNA 4Y8AA 3VFPA 3CFKB 4NBXB 3VXTB 3T0VA 3OAYK 2J1KA 2V2XB 2NY2C 3QWQB 1F2QA 5L9DH 1IAOB 2CLRB 4N8VA 1T2XA 3BPNC 3VG9B 1G7QA 5C6WH 5IMMA 3AS0A 5E8EB 2FHCA 5F1IB 4P57A 5T1KB 1OP3K 1N8ZA 1V7NH 4QXTB 4WFHE 3RA7L 2ATPA 4JO4L 3DO3A 4RNRB 2HA1A 4PLJD 3HG1D 3BEVA 2NLJA 4KXZI 4XC3L 1O6SA 4XGZA 3ZDZF 2YKLL 4HJJL 4YJZL 2W9DL 1DFBL 4YZFE 2Z7XB 3ZTJH 5TE7L 1UJ3B 2HJKA 1T20B 3C9NA 1NGWB 3LKQB 5FYJE 4NT6A 2BP3A 5DK3A 1XGQA 2CQVA 4NQDD 4FQQA 4ZNEA 1GVIA 3S98A 4HKBA 4JZJC 3QBTB 1KFAH 2M8XA 5CJ8A 2P1NB 5FHBL 1FL3B 4K2UH 2R1YB 5DJCA 3CDGB 5GSRB 2VXTL 1P5UA 4C83B 1WCBA 3SDDB 1T7VA 3B9KB 3H0TA 3BWAA 1AR2A 4Y5YC 1JI1A 4PJ8C 1T1ZA 3D3VB 5E00B 2NXYC 8FABB 3W82A 3VFWB 1A22B 3CU1A 2VABA 1FO0H 4JG0L 4X99B 4BH8B 1L7TH 1WC7A 4WUUA 5TDPB 5K9JH 5MEQB 3MCLL 2IAMB 1D6EA 5HVFB 5TF1H 1ND0A 3LHPL 4ZD3L 4ZFGL 3CSGA 1GHFL 3MJ9L 4LLMA 3OV6A 4Z6AT 3RWFA 1MFCH 4HXAH 2DJUA 1D9KB 1U8MA 4XVTH 4HF5L 4NCDA 2OCFD 4HH9A 3K0WA 2NY5H 1OSPH 2B5IB 1DQDL 1DQLH 1GZPB 2Y72A 3EFDH 1MWAA 2PTTB 5I8CB 4JFEE 3C8KA 4LSRL 5D1QB 5DMGC 5C0AD 1I85C 3MFFB 4CUCA 5F44A 3FOMB 3B3IB 2E27L 4EVNB 4NKHA 2DJ4A 4JZJA 2R8SL 3IDIA 5EO9A 4R26L 3OR6A 3RDTB 3JUYA 4LHUD 3WPEA 1HXMA 1CD0A 2X4UA 2BSTB 3WLWD 4AT6B 1YEGL 2ZCHL 4Y5YA 2ADJB 4PJ8A 3FRPA 2EYSA 4RGNB 2IANB 3KXFE 4WENB 2A73B 1VADB 3DI2B 4MN8B 5C09A 3AXLB 3SDAC 3RWCB 2GJZA 4OJFH 4ZUUA 3UDWC 4EZGA 3IVKB 4MD0B 4FFYL 4Y19A 4FQHB 3QSKB 3HI1B 4G5ZH 1KJVA 5GGRB 5JHDB 2C3VB 1VA9A 5KSBE 3VGAC 3CPLB 1F4AA 3MXVH 1I85A 3CXDH 4M48H 4HIEB 5FYKH 3HG1E 1QHPA 2I60L 4JFZH 4JDVA 3ZE2F 1C16B 4I5BA 3LRGA 4JKKA 4OCWL 1FL6A 3ULVL 3E6HB 1ACYL 3SDXB 3HPJB 2XXMB 1MRDL 4UB0H 1T2JA 4YFLF 2BOCB 4HWUA 4ZG1A 1EBPA 4U6HA 3F5WB 4XC1H 4G8EB 5I1DB 32C2B 2VLKE 3SKMB 4DW2L 4HPOH 3SDAA 1CE6A 1HILB 1LILA 4AY0A 3KWWA 2DICA 3UDWA 1AD9B 5DYOB 2P24B 3WL9B 4JFFB 1G7PA 1VESA 2X4NA 1QOKA 4LFHG 3TT3H 2AK4A 3QB7C 5BS0D 1DBKH 4F33A 3I75B 4X9GA 3VFTB 3MLTA 3HKFA 3K74B 4P2OC 1D5BB 1LK2B 4GMSL 1S7WB 5C3LD 4YHZL 3MGAA 3JWNC 1EHNA 3KPRB 1KELL 3GI8H 3QH3A 4N8VB 1U8JB 4YLQT 1G7QB 5IMKA 5IMMB 1Q94A 4JJ5B 4XAWL 2WWKO 1KTLB 1N8ZB 5JW4R 4QRRA 2R1XA 3G6DL 5HDQL 1LE9B 3VRIA 3MRGB 5L2JA 4DUXA 5IVZA 4NO5B 3ALXA 4XGZB 2Z8RA 2HJFB 3OGLB 2MCPH 5IFJA 4HWBH 3C9NB 4XCYA 1T22B 1BOGA 4YUEL 5CCKL 1OGAA 3QFJB 4PJCA 2AVGA 3TJHD 4S1QL 2NW2B 5DJ6B 4LMQI 4XMKL 3QHFL 5GGVH 5ICYA 3IDJB 3H0TB 1HCFX 3JV6B 3BWAB 1YN7B 3ULUE 3QT2A 4JFQA 1MJUL 2FX9L 2WUBL 3O9WD 1BD2B 4NUGL 4WFGE 4JE4B 1N26A 4FTVA 1FJ1B 3CMOH 2VC2L 3BPNB 1NLBL 3BPOB 4PJFA 5ESVB 1TETH 4WEBH 1D6EB 5HGBA 4NC1E 4H1LG 3SJVA 5AWNH 2YD3A 4FXKA 2BNRA 1PD6A 2YD2A 2DM2A 3DECA 3WHXB 3V5KA 4KUCF 4QBZA 4OD2B 2BCKA 4HH9B 3FOLB 1DSFL 4QO1A 5DF0A 4HG4K 2ZJSL 5C0RH 3AUVA 1JRHI 3L3OA 1N2RA 3DTXB 2CA6A 3NAAH 1KPRB 4NZTH 3BP5B 4NQEA 5E9DE 4IJ3B 1JPSH 4KK9D 1BZQK 1JL8A 1I7UA 2IADB 2F54B 4JR9L 4Z0BH 1R3LA 5E03A 1Q0YL 4RMRA 4OUUA 1CLZH 1FNGA 5I15L 2HG5A 5C9JB 1IAKA 5HHXH 4K9EC 4R0AA 1CT8B 2R0KL 4LIQE 4JPIA 5IB3B 1JHTA 3H7BA 4XHQA 3MXWH 5A43C 1MELA 4YZFF 4ZUUB 4LSUL 4AW4A 4QRPB 2FEEI 3S37H 2NNAA 1RJLB 5T5NF 2QBWA 2G5BA 4Y19B 5AZ2H 5HHOB 2HTKD 1CVSC 4XOSA 4KK5C 5DJDA 4HUNB 5FUOH 4UU9B 1GWBA 4H09A 1JGLL 2XNAB 3R06A 4G6FB 5E56A 4R8WH 1OTNA 3W39B 3QEQA 3RWEA 3VXPA 3P9LA 4MDIB 4POZD 1S7VA 1ZGLB 4HIXH 1ZAGA 1UXSA 5F7HA 4KTDH 4HCRA 3DVGB 4M6OL 1JGVH 2SEBB 4MA7L 1L6ZA 3DX8A 2FZ3B 4JDVB 5KAQG 2XZQH 4LAQH 5DQ9A 4I5BB 2LTQB 2VB5A 4UV4H 4D9QE 4P46D 1E6JL 1NKOA 3VU2A 4XWGL 3BYYA 5LQBL 1TLKA 3BP6A 4FZEL 5B22A 4CJ1A 1JWUA 4U6YB 4PRIE 2I24N 4EQ2A 4U6HB 1J8HA 1L0QA 5JZ7D 2LU7A 3LQZB 4WI3A 4G6JL 2ZG2A 2CLZB 2ITDA 4RAVB 4U6XB 2AABL 3HA0A 4KROC 2F8XC 3TBYB 3V4PL 1CGXA 1N5YH 1Q8MA 5A16B 2AK4B 4HIHA 1CBVH 2X4RB 5GS0H 4UV7H 4Y2DC 1BPVA 3KPNA 4QRSB 3MA7A 3ROOA 1WTLA 2ZWLT 3HC0B 2CIIA 3LMJL 2OQJA 1WAAA 1EBAA 4RGMC 2GFBB 4EOWH 4R0LC 1XCQB 3PV6B 2J4WH 1YEHH 1LTXA 4LSVL 5JXED 4QRRB 2HN7B 2R1XB 3VFGL 4ACPA 5DUBA 4I0PB 3UTPD 3DXAA 4NHUA 3VRIB 2HFTA 3VWKB 5A2JH 5L2JB 3BP4B 1ZE3C 3MNZA 4S1DC 4BSVA 1NBZA 3DETC 2KPNA 5J3HC 1PG7X 4LK4A 5KSBF 1T2QL 3OKYA 5IW3A 1S7UB 2LU4A 2ASTB 4TUKL 4U1IA 1ZTXH 5DI8A 1WUNT 4PJCB 2C5DC 4F7CA 3MLZH 5GRZA 5HI3D 1NCAL 2B0SL 4ETQA 1OWRM 1JWMA 5SX4H 4LASH 3PQYB 4I0KA 4Y2DA 4U1MB 4B0MM 4FMKA 4UINH 4JFQB 4ODSH 2PR4H 1WTGT 3QQ3A 4JN2A 4Z94G 3IDXL 1X5AA 4J7RA 2FBJH 1CVRA 1J0IA 4X4YA 1KT2A 4K7FB 1QTYT 3B2UC 1T0PB 5BRZA 1Z5LB 4YBLC 4FXKB 3MV01 3E6JA 3U4EA 1QLEL 4M3JA 2PETA 4MQ7A 2Z91B 3RNQB 2GKIA 3BD5A 3PP4H 3WFDH 3WXWL 5I9QB 2OP4L 2BHUA 5KVFL 4LPTA 4NN5B 3L3OB 1N2RB 4HXBH 3VFUB 1ZV5A 5BV7B 2G60L 3OMZA 4OGYH 5DSCB 5JW3H 1E4XL 1Z9LA 1G9MH 4NQEB 5I76A 4LDOB 3IKCB 5GRYA 3SPVB 4Z7NE 1BGXH 1DP0A 1I7UB 2BMKA 5JDJA 3C6SB 5JHLL 2DJSA 2FDBP 4HJGA 1R3KA 1IGML 1FNGB 2HG5B 5IFAL 4D3CL 2IC2A 3CZFB 4BZ2L 1U8KB 3OKKA 4HG4J 5B3NA 5FYJH 2RFXA 3WIFB 4MNQD 1SY6L 3GJFK 3TYFB 4B7LA 2X70A 4QT5B 4NN6C 3U36A 1Q1JH 4I48A 2FJGB 1WZLA 4PRHE 5F89B 2NNAB 1YNTA 4NSKA 1RUKH 1FZJA 2DBLH 1DVFB 3RGVD 5D70H 1MQ8A 4TUJA 1ZHLB 3MOAH 3U7AA 1YMME 5DMKA 5F1NA 3WHE1 5IG7A 3RU8H 2PCPB 3U7YH 5I18H 2LE9A 3ULUF 3K8MA 4V2DA 1KCLA 4JRXD 5CJBA 1OP5K 4RISH 2VDKH 3BT2L 2JB5H 3DRQA 3UTPE 3ARZA 5HGGS 4XPBL 5C0NC 4WNQA 1CU4H 2VLME 5H35A 4J0MA 4MNHB 3QDJB 2VYRE 5FGBC 1IM3B 1FFQA 1DLHA 4HUWB 4X7SL 5IHZB 1HQRA 2XTLA 3FFDA 4GRMA 4XPHL 3TBTB 5EIQA 4A6YB 2ZPKH 3J7HA 3X3GL 5IEHB 1RMFH 2JELH 2YBRA 7CGTA 2YUZA 3BKML 1EJOL 1F00I 3PWUA 4KK6C 5DMJB 5FUZL 5GJTL 4OV6F 3ZT7A 1DBAL 1HWGB 4ZO6A 4ONGH 4TSAL 2ZNWA 3AS2A 2X4TA 5INDB 2MCG1 1FFOA 3ROOB 4AEHH 4BZ1L 2FR4A 4NC2B 2GY7B 4WFED 3QEUA 2C26A 2Z0BA 4N90D 3VW3L 3X11A 3MX0A 2ZNXA 1H3TA 1Y18A 2Q4GW 6CGTA 1EEZA 4NZUL 3L3IB 3MOBL 1RUMH 5ITBL 4XP6H 2P8PB 3VE0B 2JTDA 4HKXA 2JB6B 3WHE0 3AAZB 3INUH 2AGJL 3IU4H 3DXAB 4NHUB 1UKTA 1YYMH 4BSVB 2EDOA 2QHRH 3O6MH 4E0RA 1IO0A 1NBZB 4PFEA 4PV8B 2MJWA 5T1KD 1NC2D 5TGBB 4EI6A 1NGQL 4KI5D 3R8QA 1GPOH 3EYOB 3K7UA 3OAZH 3DROA 1LO4L 4F7CB 2AJVH 4ETQB 1B6UA 4Y88A 5J6GA 4U6VL 1C8PA 4U6TA 5DJ8A 1BBJA 3ARGC 1UM4H 4M7ZB 5BZDA 1M71A 1YYLL 1MQKL 1U3JA 2DDQL 3T65A 4RMSA 1A7NH 2GT9A 1IGCH 5J89A 4ORZC 3O3AB 5EU7C 1INQA 1MY5A 3I2CH 2BVUA 2QKIB 4M7KH 1IBGL 2W07A 5SWQA 3B9KD 2NY6C 4JHAL 5BRZB 3V9FA 3T8XB 3VH8G 3QP3A 3D3VD 2A74A 1WZ1L 4RMTA 3D0LA 4JKLA 2DTSA 2PYEA 3MSPA 4OLXL 2XTJB 3CFJA 3UBXI 1AO7B 4K3DL 4OCRH 5BO1L 1RZJH 4K71B 2IAMD 3GBNH 3UN9A 1XR9A 4OZFG 4CADA 4K07A 3MJ9A 5M94B 3K46A 5I76B 2MHAB 1D9KD 5MEPA 3BRDA 2X6MA 1LP9A 1VFOA 3GMQA 1F42A 4HGMA 1ZHNB 1HINL 3T4AA 4FQCL 4KQ3H 2YPVL 3S88H 4IDLA 2V2WB 4KDTC 2DQTL 4QF1A 1R3KB 5F7EH 3P4NB 1I1RA 4S11A 4Z7VE 3WXVL 4B53A 3T0DA 1QNZL 4G42A 4X5WB 3UYPA 3NZ8A 3BJ91 2QR0B 2VDRH 1CGYA 2ZSVA 1EAJA 3RDTD 1KULA 3TJEH 1NBVL 4N0UE 1CXLA 3QUMB 4EDXA 1F13A 1RZIB 1JPFB 1AIFB 3MLWH 1J12A 2X70B 3HZVA 4F7MA 4PJGE 4P48A 1IGJB 4JPVH 4I48B 1NMAL 4WW2F 1PYWA 4Q62A 2IAND 1FZJB 3KPLA 3KYOB 2CXKA 3A79B 3ARWA 4NFCA 3ULUH 4TUJB 5D1XB 1WBYA 1JV5A 3RIFK 1PSKH 1FC1A 5FB8A 4XNXL 4UAOB 4N0CD 5DLMH 4XSQA 1A6ZA 3N1GC 4HS8H 4MJ5A 4X8JB 3JWOL 4X80H 4JFDA 1F90L 5L2KA 1OAZL 1KCSL 3LS5L 4GW4B 4PJ9C 1FNEA 1GIGH 5J12B 1SJXA 5IHBA 4KDTA 1F3RB 4PYHA 1XF5B 4WNQB 3PWVA 4F8QA 4P23D 4XNYH 3ZKNC 1EX0A 3NBNA 1WBXB 4KI5E 1DLHB 4TSBH 2P4AB 3QRGH 3KLSA 1Q9LB 2D31B 1R0AL 4NQVA 4MAUH 3ULVA 3MV7A 5EUKA 4U09A 3OSKA 3OQ3B 2NY4D 4WTZG 1IRAY 4PY7B 3VFOB 2EDXA 2EKSA 4R90H 3RIZA 4OZGE 1C5DB 4Z7NF 1RZ7H 4OB5L 5I1KH 3SE4A 5ILTH 1DLFL 3MRPA 1FFOB 2FR4B 5GRVL 3EYFA 2FSEB 5LGHL 4HPYL 4LIQH 1QFOA 1XKUA 4PB0L 2R1WB 4WI7A 3VFSB 4JFFD 4AL8H 1AD0B 1OTTD 4P9MH 1A6WH 4O02L 4PJ9A 5HVHC 3BIAX 1X5YA 2YK1L 3DGGA 5IB2B 2VDQH 4MJIB 4JZOA 4CMMA 3H42L 1TJHL 3VXUA 1DE4B 5IK3A 1CDYA 1NC4B 4FQ2L 5EC2A 3DPBA 2UV3A 3KPRD 2E7HA 2WAHA 4I2XA 1FZKB 1A8JH 2PW1B 2VKXA 1DANT 2UZXA 4D0BA 3EGSB 3K4AA 1C08B 5IMOA 1RJYA 3FO1B 4MQXC 4M61B 5CSZB 3TA3B 5DWUL 3C5ZC 2Y5TA 4XI5D 4GG6F 4MA3B 5AZEL 3OPZH 4DQOH 5JORA 3S97C 1RURH 3RHWF 3TCLA 1AKJB 1RK1A 5EWIL 1OOKG 1S9YA 4D0CA 1LEIA 4M7LT 1A9EB 2H3NB 3GKZA 4K3JL 3RVUD 3SQOH 4CRPA 1BVLB 5F7MC 3GO1L 5DJ8B 2DQHL 1BBJB 3SHSA 1A4KA 4DN3L 3QFJD 3RZWA 1E4WH 1RZGA 2OBGA 5F72S 5E08H 5CD3A 3TH2T 1W8OA 4UOJA 3V4VL 4RGNE 2OI9C 5GGUA 3RVVC 4QOKA 1S7XA 5DZLA 1BD2D 3SEPA 3MTRA 3QI9B 3IAGC 1MFBL 3FB8A 3KLAA 1I8IA 4HK0A 3UPCA 4ZOEA 3IS1X 3PV7A 4DZ8A 4AYFA 1KGCE 5CHNA 3RVWD 1P4IL 3PGCB 4ZFZA 2D7TH 1N0XL 3GSRB 4WI2A 5JHDE 5KN5A 3C5ZA 2FGZA 4CADB 3Q5YA 4WDIA 1MCWW 2ASSB 1F4HA 1K8IB 3GMQB 2FHBA 3WKNA 3NACH 4TPRH 3VA6A 5CILH 3MPCA 3V0WH 2FH8A 5EU5A 3L3KB 1SJHB 3SDXE 4B7IA 4POUB 4G42B 1ZA3B 4Z18A 3ZYIA 3NZ8B 2ZSVB 1FPTH 2F54D 3KDMA 4MXWL 1FDLL 4LSXC 2XKUA 2EDDA 2RGSA 3P9MA 3U46B 3BH9A 5HPMB 4GAFB 3V5DA 1JL5A 1F02I 5J11B 5B4MC 1OPGL 1WIOA 1XH3A 2G2RB 5HY9A 2GI7A 1NFDA 2YPLB 3AB0B 2BHYA 2NY1C 4GS7B 3U4AA 2ZG1A 4TUOA 3HNSH 5FB8B 3RFJA 5HDOA 4U1JB 5TE4L 2R2EB 1A6ZB 4QRPD 3DO7B 3TV3L 2CKBH 2NY7H 4IRZL 3U0TB 1JYXA 3RL2B 4Y19D 5HHOD 4F57L 4MJ5B 4HAGA 5EOCH 3VH8B 4U06A 4JCMA 3KPRE 1FNEB 1ZKAA 1QFWH 3UAJD 4GJTB 4ODWA 1EAPB 4UT7H 3C6NB 4RWYH 1UB6B 3E3QC 2CDEB 3MA9L 1IC4L 1NH6A 5HGAA 3B8SA 5HGHB 2V70A 4PREA 3MRKA 4IRJC 2VR5A 4GAGL 4ONFH 4GRLC 4EIZC 3MRQA 4LSXA 3KLHD 3G9VA 3MRRB 5EUKB 1RZKH 2N7BA 4DGVH 2QQKL 1TMCB 3C60C 4ZNEE 1ITCA 1U3HB 5FXCH 2NZ9D 3HNVL 3MODH 3T2QA 1R24A 2FIKA 4HKZA 4B5EA 5A2IH 4QHMB 1MCCA 3U0WL 4Z7VF 3WKMH 5DZOA 3I85A 2FJHA 3TH4T 1MRFH 4HUXA 3DGGB 4PJBA 1Q0XL 5FM5O 4WUUE 1B0RA 4PJGF 3FCTA 4AH2A 2G5RA 5GSVB 5EC2B 3HR6A 3MV8B 3CFCL 3IAQA 4OF0A 1IGIH 3CLFH 5IMOB 2X2YA 3RTQC 4IRJA 3HMXH 4GRLA 4NP4H 4CN6A 1IC7H 2Y5TB 2CDGB 2IBZX 4I0PD 3RZCC 1MRCH 1EPFA 3E4GA 4MJ6B 3VWKD 2Z35B 4YFLI 2EIZB 4JM4L 2OSLA 5C0IA 2ICES 3QUZC 3C60A 4G7YL 3ULAA 1ZXQA 2DLGA 2Q8BH 1ZT1A 1H5BB 5BZWA 3DRTB 1A4KB 2F54E 3S4SA 4J4PD 1RULL 4QRUA 4PJHA 4U7MA 1I8MA 1B88A 4UQ3A 3KYKH 4NKDB 3IFNL 4LVHC 4KI5F 2GSIA 1TQCB 2HLAB 2ADGB 1CDGA 3MRNA 5TH2B 3PQYD 3VXMA 4UIKL 1SHMA 3FAXA 5GGUB 1FYTA 4QOKB 1S7XB 5D7JC 5IJVB 5IQ7H 2WIIA 3W3NA 4ZTOH 5EU3A 3DX9B 5I1IL 4WU7A 1A2YA 2B1HH 3NH7H 4PGJA 3BEWA 1H6TA 2CMRH 4DZ8B 4MQWX 4Y19E 5CHNB 3RTQA 1LE5B 2O61A 4HGWB 3VXQA 4LFHD 5DJZA 2PF6A 1WEJH 1EFXA 4KI1A 4MAYB 4XPTL 4ZXBA 3RZCA 4NHCH 5FA3B 3CDCA 5GZOC 4FS0A 2J2ZA 3TT1L 3QUZA 4JQXC 3DIFB 1N59A 3U0PA 2HT3D 4RX4D 1X5HA 4R4FL 5F93C 3ZDXE 3AC0A 3IJHA 3DURA 1Q72L 2ZUVA 4V1DA 4EUPH 3GSOA 1MUJA 4G8FB 5JIHA 1OTSC 3KDMB 3KYMA 3L3GA 4MJ4A 3VI3E 5DJYA 5D7JA 3BH9B 2WV3A 4YGVA 1KLUB 4LEXL 4JLRB 2ICWJ 3B5GA 1I1AC 1NFDB 6FABL 2EIBA 4TUOB 3GIZL 3BQUC 1K5NA 5TQ2H 3P0GB 1AGCB 2FO1A 2AK4E 2AJUL 4HUVB 4GSDL 1SY6A 4KDVA 4EI5C 1TJGL 4DK6A 1X5XA 1ZSDB 4OCXL 3WCYA 1FGNL 5D1ZC 1DVFD 1A6TB 3OKOA 3Q6FB 1EFQA 4JQXA 4LSTL 2VXUL 4WTXA 4J12A 1MLCA 4JFXA 5JW4Q 5LXGL 3O4OC 1N6UA 4ODWB 4JM2C 4XGOA 3PMHG 5DD5H 1IL1A 4QRRE 3GHBH 4YC2B 5GS1C 5CEZD 1ZLVH 4X6BA 2R4RL 1FFPA 4I8DA 5F7WC 2VITA 2E9BA 4K3HA 4PGCB 4NUJA 1CTNA 4NRYB 3P73B 3QDJD 4X98A 4NQXA 5CGYC 5F7FA 5M7QA 3PP3K 3BKJH 5F7YC 1I1AA 5ECJE 2R2BB 1OGAE 3VDBA 5EIVA 1UQSA 1PY9A 1WV7T 4PJCE 5I74C 2P47B 4XNZB 4XRCA 4QHLA 5EBWA 4FFWC 4YHLH 4Y5VC 2FNBA 1O5DT 4LLYA 3X13B 4KZEH 4XMPL 3SDXF 4R6UA 1V8HA 4MS8D 2I9TB 3RUGA 5IEKA 1J88A 4DKFH 1NAMB 2R0WH 4FTVE 4WU5A 3OBAA 1G9EA 2DI9A 5A1AA 4PJBB 2J8OA 4LQFL 1D5XA 3W11D 2R0ZH 2HRPL 3WYRA 1I3RB 3KJ4C 4JM2A 4PJFE 1JK8A 2Y6SD 1D6VL 5FA4B 3SJVE 1YEEH 3HUJA 1CFBA 2BNRE 1U9KA 3MRMA 4XPGL 3SQBA 1ADQL 1U8QB 4WY7H 1QFUL 3SE8H 4DKEH 3QJFB 3CIYA 2GK0A 5AG8A 1F11A 5GPRA 3NIFE 2QADC 1JNLL 2CGRL 3C60B 4GW1B 5ADPH 1ZT1B 1DBBH 2D7PA 4MYWB 4NQEE 4RRPG 1WITA 3HR5B 3ABZA 4XVSL 1HYSD 3MCG1 4RBPK 4G9DA 4WI6A 5DHXB 1P9AG 3UTSA 1P84K 5GIRA 1OAXL 4PJHB 1OD7A 2PUQT 4M1DH 4HK3J 4DTGH 2GSIB 2FL5A 3CSPA 1FIGH 2I27N 1RJZA 1JPTH 2V17L 3WIHH 1BREA 4M6AA 3QEHA 3L5JA 2JKXA 4XNUH 2WIIB 2C4XA 1HSBB 5EZLA 3QUXB 5HVWA 5FYKU 2MMXA 3EYUH 4P3WA 4LLUA 3ESVF 3BMVA 1AXSA 1AGEB 2NR6D 5AEAA 2OMBA 3FTGB 5T1MA 5E6ZA 5DJZB 5EPMB 3MZTA 4Y1AA 1W72L 5JUEL 3L3HA 3UO1L 1DUZB 4X5XA 4ZXBB 4YX2L 4K55A 3NN8B 2XTJD 1AO7D 1JP5A 1OLLA 2VQUA 1JVKA 4NWUL 4KTEH 3FZUC 3TF7C 1CICC 4FABH 3PJSB 1KSRA 1G0YR 2ATKB 3ET9F 3P0YH 1N4XL 2HH0H 2F58H 2AJYH 3VFMA 4WUKH 1PEWA 3GMNB 3IJHB 3IFOA 3UTZA 4WHTB 5JW5B 4R9HA 5EB9A 1OCWL 1J1XH 1IGYB 5T1LD 3DVIA 1E0OB 1G7JA 3JWOC 3KYMB 3MV9A 3QDJE 4XAKE 3BVNA 5CJQH 1LNUA 2YR3A 3O2DL 4JGJA 4KVNL 5C0GA 1GGTA 4PG9A 3HAEG 4EN3C 5D7JB 2WSKA 4LKXB 2AQ3A 4LKCA 5LAXB 4YGVB 2FYYB 2XN9D 3V6BR 5BVPL 2NX5A 1I7TB 1CIUA 1NJ9B 1MHHB 1TVHB 1WWLA 2R9UA 5IT2L 3I50H 1OTOA 3MRIB 4OFKA 4Z5RB 5CBAA 2DYPB 2DIJA 4AIXA 5DT1H 1J18A 1I4FB 1XGPB 5I1JH 3PWPA 2Y7QB 1WAAE 3OKOB 5D1XD 4N8CL 5LCVH 3WPFA 3H9SB 3D6GA 1CICA 5C6TH 3G3BA 5IBTH 1KLGA 1MLCB 3V79C 4G6AD 3V6FA 1QSEA 1MCBA 2W65A 1XF4A 2W9LA 2VN7A 4PLKC 1HHGB 4KY1H 1IVLA 2YD6A 3WEXA 3VWJC 2WQ8A 5I8OL 1KXTB 2W0FA 4RA3A 4GKZB 5EOQL 1EEQA 4OI8A 3DXAE 4X6BB 3AS3A 2GJJA 3NCCB 3VRLE 5T3ZD 3N85L 5F6HI 4EN3A 5IW1B 4LARH 5F7DB 1AY1H 2QQQA 5DK2A 43C9A 1HKLL 5D3IA 2RCSL 3QNYB 1CXEA 4U1NA 1BJ1J 4HQQL 1H8SA 25C8H 2ZCKL 3P0VH 1UQSB 4LCWD 4RZCA 2Y36H 4NIKB 4MA1B 1MFAL 1XAUA 1EUTA 5EBWB 1M9SA 1KEGL 5IW6B 1P7QA 2PYFA 2A9NL 2H2SD 1PKQA 4LLYB 2FD6L 1RUQL 3QPQC 5EORH 3ZDXF 5IESL 3QISA 3RUGB 5IEKB 4APQC 2AV7B 3ZTNL 2ZKHL 3CK0H 1OAYH 5EUOB 3PGDB 4KJPD 5I2IA 2QTEA 1F58H 4Z95H 1JK8B 4I4WA 4M1CC 1MCQA 2HKFH 5BRZE 4L3EA 5F3HA 2EDYA 3VWJA 5FTTB 2OJZH 2CJUL 2WBJB 1A21A 1TCMA 1CLYL 2ITCA 1UA6L 2WBKA 2DLTA 1AO7E 5LBSL 2NY3C 4KUZL 4MJID 2DQGH 4QHUA 1NC4D 4O2FB 3TYGH 4F7TB 3GOZA 2R4SH 3ZTJG 1IAIH 3MO1B 1R5IA 4IMLA 5ERWA 3SE3C 4PPTA 3V52L 4O51A 3RWIA 2X89D 4I0CC 2ZOLA 3UTSB 4MVBD 3TA3D 5SV4A 3OWEA 1T66C 5GIRB 5K93A 5C08A 4LGPB 1LO2H 1XCTB 35C8H 4LSSH 4QXUH 4L3AA 2FB4H 1MI5A 2H41A 3RPIA 1AKJD 2FL5B 1HIML 4XPAH 4APQA 1INDL 1II4E 3BXNA 5E2WH 4NGHH 3LKSA 3X17A 1HDMB 4HQ1A 5HXMA 4HULB 4MJ2A 1UFUA 3JB9j 3S36H 5I30H 1HH6B 5H94B 1AXSB 1IARB 2VO5A 1WIUA 3BPLC 4OCYL 1KLFA 4KHTL 1P84J 1S7TB 2QQNH 4PJCF 1ZVYA 3OJVC 4MS8C 4X7CC 5I71B 4JGMA 1P5VA 3ARYA 5HD8C 5FCUH 2XICA 1G7LA 4X5XB 1JN6A 5SWSA 4CP6A 3QI9D 2J6EL 3WFBH 5DD0L 2AXGA 2QADB 3ARRA 1S7QA 4XVUD 5ITFB 4DK3A 3ALPA 3SE3A 3MRCA 3U4BH 3Q5OA 4FMZA 3LB6D 1VGEL 4PGBB 5TQ0L 1NCNA 1MEXL 4PJFF 2WK2A 2X1WL 1HWHB 1PY4A 3P9WB 2H45A 2W92A 2ESVD 3EO9H 4YXHL 2E8ZA 4XNQB 2GK2A 5EBGA 1RIUH 1G7JB 3RY4A 2WWMC 1MWAH 5C0CA 5GZNC 5BW7C 2Z64A 3LVEA 2EDQA 5BMFH 1KG0B 4LCIH 1O7SA 4M8QB 3C09C 3NIFF 2ZUSA 3E2JA 3HZYB 2YA1A 1J05A 3V0AC 4H25B 5CBAB 3HI5H 4HS6A 3BN3B 4DGIL 1TQBB 1WT5C 3T3PF 3BOVA 3PWPB 1I9JL 2YPLD 4O2CA 2A6KA 3E2HB 1A7OH 4XP5L 3HFML 4XZUB 4WO4C 1DDHB 4AM0B 5IB1A 3EBAA 2F19H 1TJIH 2Q87A 3QA3B 1O0VA 4OLZL 4GLPA 2CO6B 3ZT5A 3REWA 4BFEA 5HYQA 1S5HB 5EBLA 3ZLQC 1KIQA 2XFXB 4FZ8L 4ENED 3KPOA 2GCYA 5BW7A 3LPWA 4UDTA 2IQAA 3QFDA 2IPTH 4O5LH 1AHWC 1KC5H 2B1AH 2V9QA 1BM3H 1BZ7A 1MY7A 5DJ2A 4Q3IA 5F21B 3KPSB 2BC4A 4AMKL 3TFKD 3IDYC 1A6UH 3HC4L 1DN0B 3GBMH 2PKDA 4PJ7A 1H9VA 1PVHA 4RZCB 4DVRL 5B3JE 4F8TA 1IKFL 4OQ1A 5E2TH 3RY6C 4IDJH 2PYFB 3ULVD 5E99H 1SMAA 4YIQA 3KR3L 5F88A 3ZYZA 2ICWA 1WT5A 4BH7A 5MENB 1Z0NA 4U2ZA 5BXFB 5AUMB 3QPXH 1U3HD 3LEVH 1C5BL 1L9MA 1F4WH 4NNPL 4WO4A 1RZFH 5I2IB 1AE6L 2GHWB 1RFDH 1PZ5A 4PP1D 2ED7A 5DC4B 1U8OA 1JGDA 1JRHL 5F3HB 4OM0H 4WHCA 4ERSL 3J8F7 1PFCA 2ITCB 5ISZA 4P2CG 4YHIA 1KCRL 5B0NA 4BFIA 4LLVB 5INCA 1AHWA 4HS3A 1XT5A 3MV8D 4Y4FD 5KANI 4NFBA 1A4JB 1WAAF 3MRBB 3G5ZA 3P30L 1LP9E 2AKRB 3T1FB 3QWOB 3RY6A 3NFPA 5ID1B 2Y07H 5HI4C 5C08B 5AYQA 4QTHB 4AY9X 4ZS7H 3BRFA 1YEKL 2FEEL 4ZUWB 1CLOL 3IXAA 3LKSB 4HMEA 2DRUA 4Q3GA 3MUHL 5EU7E 3VRLF 3LDBC 4YQXH 3RVTC 4CJ0A 2HT2C 2YPKA 4R08A 2QSQA 1GGIH 3TC9A 3BSZL 1MVFA 1MIMH 5KS9B 3R4DA 3BKCH 4KKCD 4QOKD 1EA9C 1G7LB 1IZJA 3BGMB 3TBWB 1S7QB 3KS0J 2BVQA 3MRCB 1A9BA 2VZUA 2ED9A 1RVFH 2YUXA 5L2KE 3DWTA 4MAYD 5DO2D 3MRFA 3THML 1EHLH 2W0KA 4X6FA 1WFNA 1ZWIA 2X4SA 3S36X 3HZMA 4PBWD 2RHEA 4U3XA 4RGOH 1B4JL 2M2DA 3AROA 3VXOA 1TFHA 1FGVL 3SB4A 1M9LA 4PRDB 2CLVA 4XPFL 1KBGL 3GMPB 4JZNA 4OUOA 5J7CC 2P45B 1S3KL 2EDTA 4ECNA 1BZ9B 3ULVE 1HK6A 4L5FH