3ZYIA

Netring2 in complex with ngl2
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
398
structure length
395
Chain Sequence
QNCPSVCSCSNQFSKVVCTRRGLSEVPQGIPSNTRYLNLMENNIQMIQADTFRHLHHLEVLQLGRNSIRQIEVGAFNGLASLNTLELFDNWLTVIPSGAFEYLSKLRELWLRNNPIESIPSYAFNRVPSLMRLDLGELKKLEYISEGAFEGLFNLKYLNLGMCNIKDMPNLTPLVGLEELEMSGNHFPEIRPGSFHGLSSLKKLWVMNSQVSLIERNAFDGLASLVELNLAHNNLSSLPHDLFTPLRYLVELHLHHNPWNCDCDILWLAWWLREYISTCCGRCHAPMHMRGRYLVEVDQASFQCSAPFIMDAPRDLNISEGRMAELKCRTPPMSSVKWLLPNGTVLSHASRHPRISVLNDGTLNFSHVLLSDTGVYTCMVTNVAGNSNASAYLNV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion
molecule keywords LEUCINE-RICH REPEAT-CONTAINING PROTEIN 4
publication title Structural Basis for Cell Surface Patterning Through Netring-Ngl Interactions
pubmed doi rcsb
source organism Homo sapiens
total genus 109
structure length 395
sequence length 398
ec nomenclature
pdb deposition date 2011-08-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07679 I-set Immunoglobulin I-set domain
A PF13855 LRR_8 Leucine rich repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3zyiA02
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 3zyiA01
4XXCC 3IJHB 4WO4B 3MO1B 1P2CA 2WSKA 3VWJA 4UINL 3T4YB 4XHQA 4OSUH 1DDHA 2OL3H 2Q7YB 1EPFA 2FLBT 3V5DB 3HB3D 2FEDD 1UJTA 1TPXB 2FHBA 2IEPA 4Z0XA 1BECA 4UUJB 5EWIH 4F3FA 3ET9F 3THML 4BJLA 4ZOAA 1R3HB 4FFVD 3DBXB 3P9WB 4LCUB 1IGFL 1S7TB 4MQTB 4PV8A 3SDYL 3X12A 5CIPB 4MWFB 4PLKC 1VADA 4P48A 4ODHL 4YDIH 3HCVB 4OLWH 4Q0XH 4P4KB 2Z4QB 1XCTA 4Z7VA 1RHFA 4UILH 3BE1H 1YPZB 4D9RE 2R0KH 2COQA 2Z8RA 5HGBB 4FQ1L 3P9LA 4K71B 5MI0B 2A2QT 5BQ7A 1J05B 5GSRA 1Y18B 5HYJA 1CT8A 1DEEB 4PTTB 1EH9A 2GAZB 4E5XA 3GSRB 1MCOL 3MV7B 3MLRL 1KB5B 3SHSA 3MROB 3KLSA 4NN5C 3V95A 5EORH 5EU6D 2JIXB 4IDLA 5CJ5A 2QR0A 4CW1A 3QNZB 4HF5L 4IDJL 1YY8B 1BQSA 2JE0A 3SKUD 1JZ2A 5F7DB 4QGTA 1NBYA 3NPZB 4Y19B 3RDTD 1DQMH 3AU1A 1BQHB 2Z31B 3EO1B 5IW6B 3OR6A 5EOCL 1BVLA 4KI5F 4Z7NE 1U92B 4W81A 4HHAA 1A6WL 2HFEB 2CDEB 4Q9RL 3LQZA 4F15B 3C87A 4NOFA 2FHFA 3WFEL 3AVEA 3IAGC 1A1OB 4KFZC 4WFEE 2NX5B 4V1DB 5AUMB 2B20A 3TIEB 5GGQL 3D1MC 4RIRA 4D9LL 4FNLH 3V4UH 4O9HL 1SM3L 4Y5YA 5DQDH 4K94H 2P47B 1X6LA 3SQOL 5JHDD 2DQHL 1K5DC 3GUTA 3ARFB 3ARYA 3GSVB 2VLME 2QEJA 4JKPH 1FL3B 1ZTXH 5ACLA 2BNHA 2X4SA 4KJPC 2J88H 2WZPD 1ZHBB 3QEGH 4U6YA 4WU7A 4R6FA 2JTDA 3QUMB 5CJXA 1JGDA 4A2LA 2LV4A 3TESA 2RAMA 3QDGD 1FL6A 1A6VL 1ZANH 1A21A 4HZLA 4OZHE 1BQHG 1UA6H 4MNGB 3TJHD 2RR6A 3E6JA 1QFUL 3K4AA 3MFFA 2WFHA 4JZOB 2CUHA 4JFFB 1FQ9C 1PKQE 1RUQH 4TULH 5I1DA 5DHVA 5KVGH 5DLML 1G9NL 5FKPB 1D6VL 2ENYA 1FZOA 1M7IA 1AD9B 3DUSA 1VEMA 1OW0C 2YKLL 4HD9A 2JIXD 5E8DL 2CO7B 1M7DB 4MHHG 3S97C 2DYPD 2XI9A 5IMMB 4M93B 2G9HB 5I8CA 1KIPB 3FB5A 4F80A 1F13A 2MHAA 1OL0A 3LRHA 2GCYA 3WNLA 2OL3A 1KTKE 5EFIB 4JM2A 1EAPB 3I6GB 3U7YL 2GEEA 3HI1A 5E6YA 4JG1L 1B0RB 1WISA 4QTHB 1F2XK 4HWZB 3WLWC 5GS0H 2RCSH 3PXJA 1W72B 3BGAA 1VA9A 3MCG1 5EU7C 3RIFF 1S78C 1CF8H 1U58B 5FHAH 4R8WL 4V1DD 4LSPH 3WPEA 3ZKXC 1SHMA 5ID1A 3FT3B 1VGEH 2AI0H 1A6AA 3KPPA 3ULUF 5ISZE 5DD1H 2ZUQC 3N1QC 4WV1A 3QJFB 2R1WB 4CC4A 1EBPA 3NTCH 4KKAD 3RA7H 3MRJA 2V9RA 2ZUYA 4PP2B 4RGNC 3RVWD 4BKLA 3OJVC 4PJ7A 5LXGH 4Z8GA 2W60B 4EJ1C 1I85C 4PQ8A 3DVGB 5E8OB 4NC2B 3HE6C 4F33B 3TA3B 5HYSA 1NUNB 3MJ8A 2X5PA 3QDJE 3OKMB 1V7MH 4KZDL 1TXKA 1G84A 1OF2A 1GGCH 2YD7A 3RKDC 5ICYA 1UG9A 3VE0B 4UQ2A 3C5ZA 5SWZD 3SGKA 2VOTA 3DI3B 3TFKC 3IJSB 1DVFB 2YC1A 4JFFD 3C6LD 4XCFL 4JRYD 4M3JA 3O2DH 2YXFA 4GKSA 2ITCB 3FB8B 4HKJA 3WS6A 4KVNL 2D31B 2G60L 4ZS6C 1X5FA 3HS0A 4FZEL 2VQ1B 2E7LC 5F1SA 3P4LA 5T3XH 5KS9F 3TO4D 5GGTL 1EK3A 1OOKG 3UJTH 4XPHH 3G6JF 1MHCB 3IDIB 2ITDA 3VXSE 5FGCB 4KVCL 3RWGA 1DN0A 3U4BH 3QXUA 1JHTA 4JPWH 2P7TB 1C12B 3SE9L 2XZAH 5I2IB 5FAAA 5MENA 1UXSA 3PGDB 3Q5YA 5CLTA 1XCQB 1A7OL 1T20A 4ODWA 3S3PA 2B0SH 4NQEB 4DUWA 4N8VB 3O8XC 5I6XC 4Q97A 1V5JA 4W4OC 2WQUA 1F6AB 4NHCL 4F8QA 4UNUA 2VZTA 4RFOL 4MA1B 4PRNB 5I75B 2X70A 3KJ4B 1T1ZB 4Y4FC 4M62H 4LMQE 4GRMB 2IPUK 3MRNA 5IB2A 2BVUA 2EDXA 1CF8L 5CD3A 4G6JL 5IMKB 4MDJB 4HDIA 1NBVL 4YHKH 4WW2B 4YPJA 2AK1H 4MNHB 5DA4A 1IAII 3B9KC 4G7VH 4RRPG 4P57A 4TTGA 1ZLVK 3ROLA 1FVCA 1WQVT 4KKBC 3VG0L 3HNTH 3G04B 1DE4B 4HGKC 4OAWB 3FCTA 5DQ9B 5GGVY 3PL6A 4P5TC 2A9MH 3I6LD 2R1YA 4NO0B 3S36L 3O0RH 1OAZH 2AXGB 3GIZH 3ZKNC 3MUHL 4PJBA 1KPVA 1RJLB 4IOFC 4N8VG 5E0QA 3O11A 1FZJA 1G9UA 1DQLH 1NMBL 3JWDC 5D1QC 1K3ZA 2G75A 1EVTC 4ZUSB 5BCAA 5JPMB 3RWJA 3O6FB 1XR9B 4Z7VF 2OXHA 5C0JB 3C8DA 2GT9A 3BN3B 2DQIL 2VN7A 3MPCA 3T2QA 1K8IB 2Z65A 2Z35A 4L3FA 4J6RL 5GS0A 5M7QA 1UEMA 2AEWA 2HJFB 3F6IA 5BVJB 4O2FA 4GXUM 1PX3A 2FB4H 3U0PA 1RK1B 4DKEL 5IW3A 4WYKA 5C0DA 3SGJC 5CCKH 1I1FA 2V9TB 3A79B 2H8PA 2R69H 1WC7B 5HPOA 1U8NB 5K93A 1NQBA 4KQ4H 1B6DA 3ZHLA 4NN6C 5DRNB 3MMEA 3OGKB 3FFCA 5EBWA 2XRAL 3LKSB 3OAYK 3A6OA 4M48L 5D2NE 1CGTA 5IB4B 3P73A 3OAUH 5DJZB 2JE8A 4UV7H 2XKUA 3OKEB 3V7AG 3CIYA 1OGAA 4JB9H 1CK0L 4DW2L 4PJ8D 3VFSA 1V05A 4PJIA 3H9ZA 1MFBH 2CRMA 2VL5A 4ZTPH 1B9ZA 4A6YH 1KCRH 3L3KA 4WTZG 2DQCH 3C5SA 3ULSA 2BVQB 4TNVK 1ZA6B 1P4LA 4H26A 1MOEA 1FG9C 3O2DA 1T66C 1U2CA 4QXGL 5L8LB 3U46B 2E6JA 1RMFH 3ARDA 2ICEA 2AJXH 5I73B 3BIKB 5C0GB 4NO0D 4K2UH 4EN3C 1L9MA 4NZRH 4TSBL 2WQWA 4P9HC 4Z77B 1IFHH 2Y4SA 5B3JF 5SX5H 2LU7A 4R58A 2P43B 4HIHB 1OTNA 3BZ4B 1MAMH 4ZQKA 2F58H 5C8JB 1A6ZB 4NUGL 4HSQA 2R2BB 1PYWA 3MRIA 3BX7C 2ZPKL 5C3LD 4FN0A 3SGDH 2YPVH 3KS0J 1EGJH 3PJSB 2QSVA 1A2YB 3TJEL 5CP7B 1CXKA 1KIQA 1ZOXA 3V4VH 2ZKHH 2Y07L 2VZOA 1PLGH 2B1AH 2IH3B 3LEVH 3PP4L 1II4E 1FJ1A 4RAUB 1MI5D 3PWUA 4NNPL 1RUKL 3MGOB 4BSUA 4PGJA 4O2CB 4M8VA 1Y0LB 4U7KA 4L8CA 3OGLB 2AJSL 5CGYC 1EIBA 1T83C 3GMQB 1DQJB 4BK5A 1MY7A 3HMXL 4U6VL 3WJJA 1OTUC 4YHML 3MQIA 4JM2F 1BMGA 4ZUUA 3SO3C 1AGEB 2OCFD 4OV5B 1QOKA 1XR8A 3P3YA 4NKQB 3NOIA 3UTPD 3SPVA 5I1EL 1T89C 1FNGA 4WUKH 1S7XB 5TE6L 3G6DH 3F5WB 2HRLA 2IGFH 3KPQB 4OZHB 3MSPA 1MJJA 1P7QA 3REVA 3HR5B 3BMVA 4YXKH 4U6TA 5A16B 2D3VA 3EDKA 4UTAH 4RNRA 5C0IA 1I8LC 1S3KH 4KK6C 4LPWA 1PKQB 2VKWA 2AEQH 1ZGLM 3WFZA 3JV0A 2ARJA 2OP4L 4LFHG 3OKKB 1BZ7B 4PJ7F 1S5IL 2HFGL 3RNKB 3MRMA 5D7KE 4P59L 2YRPA 3MLWH 4PJ5A 4C83B 4L1HA 3LPFA 1F4YH 5EIQA 3BP6B 2O6SA 5EN2B 1IAOB 4IRSB 4WUUE 2ICWI 2DKMA 2EEAA 4HAGA 3VJ6A 4IOIB 5FDWA 3NCEB 5F7FA 3QCTH 4FHOA 3KJ6L 5F7KC 1IGYA 3UX9B 5E6IA 3KGRA 5DJ0B 4XPTH 3SJVA 1H3WM 1F3JB 3N85H 2WIMA 1UC6A 4NNYA 3VH8B 4IMKA 5E9DA 4TYUA 4BQBA 1WWLA 1JHLH 2NTFA 3KPOB 4CVZB 3MUY1 3AM8C 4FQHB 1GH7A 4WWKA 5D1ZC 3A6BH 4PEQB 1HHGB 4OD2A 4QCIB 3CAFA 3OJMB 1RZKC 1TTFA 4LRIA 1PEWA 5D72L 1NDMB 4ZUTB 2VLJA 5ISZB 4OGXL 5FYKD 5EZJB 2F8OA 3VFMA 2YD1A 4YXHL 3SDDC 2VLMD 3OKDB 5HHOD 4A6YA 3O2VH 2H1PH 5H8DA 3EOYG 1B88A 1BJ8A 1QQDB 3IFPA 5C0BB 1FS2A 1PGRB 1WF5A 1PZUB 3RL2B 4O4YH 1JWMA 3PDOA 4KTYA 4LLQA 3L9RA 4Y2DD 2KBGA 4JM4H 3BPNB 3O3BB 5ERWB 1SEQH 3QDJB 2OTWB 3QFDA 4LHUA 2WM0A 4TNWK 2VLKE 2Q8AL 3T2PA 3W3NA 5KZCD 1CFSB 4XPFL 3CK0H 1FVEB 5BW7A 1JCKA 4PJFA 5D6DC 1CU4H 3KWWB 4XC1H 4X6CF 4FMKA 3UN9A 4BK4A 3RY5A 3RGVD 3IT8D 5F89B 4Z8FH 4HBQA 3HZMA 5HSFA 2HJKA 4NHUA 4LI1A 3JWOL 1EJ6A 1KGCE 1N2RA 3MLZL 2X89A 2A73A 5JIHA 1ZT1A 3FHAA 3X11A 4M7JH 1F8TL 3RWFB 4G8AA 4QC0A 3MV8E 3LS4L 1FORH 1EGJA 5ILTH 3G5XB 1NANH 1QR1B 4YUEL 4M7LL 4Y88A 5ICZA 4P23C 2P24A 4EUPH 4DGVL 3LV3A 5AYUH 9CGTA 5KVFL 3S37L 1SQ0B 4HJJL 2LVEA 1C1EL 2ORBH 3BPOB 4K3EL 3E6HA 3PWLA 2W0KA 3VXSB 2WP3O 2VLLA 3QUXD 2PETA 4LSRL 1NGWB 3CZFB 4X4XA 2L0DA 3DHMA 4ODXA 5E70A 5C0AA 5D7LA 1HK6A 2BXZA 2MCG1 3QNYA 4WVRA 2IG2H 4L9DA 3L3OA 4JREB 3OG4B 3ROOB 1KENH 5T33L 4P99A 4Y4HD 2VQTA 1U95A 3TPKA 3RY6C 1B2WL 1IBGL 4LCWA 3W9DB 3S35X 4FQCH 1HWGB 4N0FA 4P2CG 1YEDA 3E3QE 1MIEH 2EDWA 2DMCA 2X1OA 3RWIA 1A4JB 1NC4B 3ILPB 4P0DA 4X9IA 4POYA 5ISZD 2HWZH 1R3KA 3N85L 3RU8H 5DMIL 3NABL 5EZLB 4NKDB 1KUMA 4OM0H 2V9QA 5DVMA 3BEVB 15C8H 2CLZA 2Y7QB 3BGMA 1DUZB 4YBQD 1V3JA 2DBJA 2YK1H 3OSKA 4LSAA 3CFJA 3VCLA 4TQEL 3K8MA 5IBLD 5E8EA 4GJTB 3EOTH 3OF6A 2FECI 3T0ED 3WIHH 4NO5A 4GAGL 4HW6A 3WFHB 5JXAL 2MQCA 5F6IC 2NY3C 4MJIA 1UYWH 3G06A 1IAKA 2BNQE 4JY6B 2CRYA 2IALA 5IVXA 3CSGA 4LNRA 1ORQB 2HRPH 4PJIF 2XWBB 4ZOCA 1U8LB 4GQ9H 2B1HH 3HC0B 4XBEL 3CK0L 4GFTB 1EDQA 3CLEL 1IO0A 2OSLA 3A6CH 2NY1C 2OQJA 4GKZB 1PW3A 1EO8H 5JZ7D 5K9JL 5J11B 1R5IB 4UI2A 2YD5A 4QRQA 3O6LH 3MA9L 1BVKB 1JPSL 4QRPE 2YD6A 5HTSA 3UL8A 2JJVA 4NDMB 5JPNB 1ROWA 3EOBB 4XHJC 2VE6B 4GMSL 1S7WA 1NGPH 1OP3K 1AQKH 1CTNA 4R2GC 4BQ8A 1B0GB 3MNZA 2J8UA 2GJ6E 2YRZA 3S98A 1MJ8L 1OCWL 5F88A 1AJ7L 4MXQD 1C8PA 1Z6JT 2FJFA 3LN5B 4OB5H 4MZ3A 4U6HA 5HI4C 4CJ1A 5I1LA 3W3GA 2BSRA 3N1GC 5A2LH 5D2NB 1MCJA 1CFVL 1IEBA 4LSUL 4GLRH 1WBYB 5F8QC 4WHYH 1Z5LA 3EOAB 3M17B 2VWEC 3QIUB 3QBTB 3LRSB 1G7LB 2FBOJ 2YPLA 3CSPA 3PHQB 5MEPA 1AD0A 1IGTB 4S1RH 4GRLC 1OHQA 3BO8B 5IW1B 5IQ9B 4P2OD 1U3YA 32C2A 2NNAB 5GRJH 4CP6A 2DQEL 1QLRA 4HKBB 4UT6H 5JNYA 1JNJA 4KJQC 2FSEB 3D85B 4ZSOE 1HINH 1FFOB 3REWB 5ACZB 2Z7XB 4M61B 4OCWH 5ANMA 1QFHA 2YWZA 1GAFL 3MRGB 5IHZA 1DBKH 2FH8A 4R0LB 3ZKSD 1XF3A 1TIUA 5ADPH 4EUPA 2P8LA 1OTOA 4HUKB 2C4FU 1M6OA 3MXWH 1JNNL 4XB8A 3SDXA 1CFQB 5D1XB 2R4SL 4Q3GA 3P9MB 4DJMA 5A2KH 1UB6A 1QA9B 2BFVL 5J4MA 1U8HB 3WBDA 1NLDH 3RIAF 2YWYA 3QUYC 4XAKE 5KSAA 1D9KC 1SYSA 1C7SA 5H37H 1HXYA 3HHRB 4JANB 2EXWD 4JPVH 4M7EC 2Q86B 1VACA 4X98B 1T03L 4J4PC 1LHZA 2VTFA 3O4OC 3RWEB 5H35B 1NCDL 3WNOA 3GSUB 1XGQB 2OMWA 4G8EB 4KJYA 1KNOA 5EU5B 4I3GA 3QQ3B 3V5KA 5JOFA 4JHZA 4J3TA 3LKQA 1MIML 2WK2A 1X5GA 4JDVB 4WI3A 3BP5B 3NFSL 4YDLC 2E8YA 4IMLB 3UL9A 5DVLA 2HKHH 5E7BA 4NYLA 5C0CE 2B5IC 4WDIB 3WIHA 3MV11 5EO9B 1TNMA 1VGKA 1G7JB 2G5RA 2EDEA 3O4LE 1ZA3A 1ED3B 5DMKB 3S35H 1KBGL 3T77B 3TT1H 4JFPA 4LBEB 1AO7E 1MLCB 3N50A 5LCVL 3CFKA 4L4VA 5L2KE 2DQFB 4TPRL 1A3QA 3G6JB 2X9WA 3CFDA 2E7MA 2A77L 3DO3A 1KJVB 1MNUL 3WUWG 3TH3T 3EYFA 4PJDA 2GJZB 3O6KL 4QRRD 5IB3B 1YDPB 1BHGA 3IKCA 1UXWB 2WBJA 3PWPE 2PXYB 1GGTA 2BNUA 3MCKA 3W2DH 5DF0A 5BV7L 4B0MM 4G8FB 2NW3A 1IEHA 3WFDH 3SDAC 3VD3A 4JG0H 1ZVSA 2OMXA 4WUUB 1FBIL 1CD0A 4PLKD 4XC3L 1SY6H 2VYRE 1TJIH 3MODL 4PJFF 4GAYB 5HDHA 4XWOD 2HFFB 4KHTH 4AH2B 3SOBL 3O2WH 2VXTH 3GSNB 1KN2L 1FCGA 3RVUC 4DKFH 3BW9B 4HJGB 3TEUA 4KHXH 3F7PC 3CDGA 1I3UA 4L8SB 1TTGA 3QIBB 4YHLH 4JAMB 4JZNB 4LLWB 1HCFX 4FTVD 1NCCH 4K55A 1XKUA 5F1KC 3H7BB 3PABB 3STLB 4EI5C 3LMJH 4JPVL 1RHHB 3GHEH 4BH7A 5JR1L 5LGHH 3H2WA 1KPRA 1ZT7A 4YR6A 3BP7B 3SY0A 5D70H 4Q6YA 5DJ6B 3NFNB 3I75B 5FECB 3D18B 3T0AA 4OZ4A 2X4TB 5DJ8B 1C5BH 2CK0H 3B6SB 1NLBH 4U1NA 2LU3A 3TYFA 1IGIH 4L29B 3TBVB 3P0YL 2UZYA 4OM1L 4KI5C 4ZUWB 2EC8A 3MNVA 4KI1A 2VLKB 1AY1L 3DRQB 1NSNL 4ZPTB 1HHHB 3L5WB 5MEOB 5HGAB 3CX2A 3S96B 3SGEH 5A1AA 1I1AA 3VFVB 2EH7H 4PP1C 2DD8H 8FABB 4TRPL 3IU3B 5E6ZA 4HQQL 1F00I 4G6MH 3V5HA 2A83A 1J1PL 1YMMD 4S1QH 1BIIA 5EH1A 1A3LL 3MV8B 4OLZH 5T1KB 4OIIL 2VMFA 4UIMA 5D7KD 5TE4L 3BVNA 4ZTOH 2J5LB 5D71H 2YSSA 1Q0YH 4FQPA 4IHOA 2XTJB 1F4XL 1IM9D 4YH6A 3WFCL 2VDQH 3WN5A 5IOPA 5KVMC 3OXRB 4WUUD 1RU9H 4KJPD 3WSQL 4BSVA 4YHOH 1D5XA 1N7MH 5HI5D 4R6JA 4LRNL 4PRID 3ZL4L 4XP1L 2APTA 4ODBD 4MAYA 3QI9C 1A6TB 4PY8J 4JN2A 4OZIE 1T7WA 3MLTA 1LEGA 4HXBL 3MR9B 2BSTA 1FE8H 1XGTA 1QFWM 1TJIL 4IRJC 5DD5L 1O6VA 3MGTA 3UZVB 1JPFA 4MCYB 4S11A 4OI9A 2XA8H 3BKJL 1Z0MA 4XZUB 1CWVA 3BFOA 3MCLH 2PO6C 3ULAA 3FQTA 5E2VH 1FH5L 4P2QA 5DT1L 1FGNH 1S7UA 4XX1G 1YNLH 1FL5B 3IDNA 1DANT 4NT6B 4U7SA 3KPRE 3IU4L 3QO1A 5D2LE 3QIWA 5JTWA 3QHFH 4GBXA 3CLFL 1LO0H 5DEGB 3U6RB 3VWKD 5GMFA 3UTSA 2VLKD 2L7JA 3CVHH 3BISA 4U7LA 1L6ZA 1RD6A 2BNQB 2IAMC 1H0DB 4URTB 3WLWD 3K2MC 1WWBX 1XT5A 4KRPC 3I3DA 1NKRA 4OUOA 1EUUA 1S78D 4QRTA 3O8XB 4OT1H 5I6XB 1DZBA 2ZUWA 3RTQC 4G9FA 4NM4H 4CVXA 1BX2B 2ADJA 2VLRA 2PYEA 4OLYH 5EOCJ 5E99L 1HSBB 3ULUC 1T1XA 4RWHA 3OAZH 4U1IA 4Y4FB 5D7JC 1X9QA 3SQBA 1SY6A 1JGUL 4PJGA 4HUUB 1I3VA 1U8OA 3SEPA 3PP3K 2WIIA 3P30L 4N8CH 2SEBA 4I9WD 2GTWB 4RGND 5BMFL 5L0QC 5DRXB 2Z82A 1S7QA 4QRPB 3PHSA 2JJSA 5E4IA 4RISH 3HE6D 4K23H 1A7PH 5FYKL 1ZEAL 3GSQA 1KCUL 4PD4J 5DD3L 1J18A 4MCZA 4I3SL 4K7PY 3RKDD 5DJYA 3CCHB 3V2AR 4H25B 1NGQH 2GJ6B 4K9EL 3MRLB 4WW1B 4E42A 3TFKD 1V7NH 1TDQA 2R8SH 1N7ML 5KAQF 4P5TB 4NQVB 3SDXF 4P2RA 2VZSA 1CG9A 1NGZA 1QSFD 2X40A 3DMMA 1LILA 4P5MB 4FXKA 4XPBH 3HZYB 4ZS6D 3NMEA 4I0PC 1D0BA 2O61B 4Y5VC 4UT9L 4XNUH 2FZ3A 5I1GL 4H8WH 1LO2L 4IIQC 2YA1A 1DBJH 4RDQF 4HCRL 4KZEL 1F90L 3E6FA 4WEBL 1NCWH 4PPTA 3QEHA 5E2VL 2DBLL 1IARB 3OKLA 3UTOA 5GS2B 5FF6A 4U3CA 4ZSOB 4GT6A 2NY0C 1TJHL 3QEUA 3V8CA 1IGMH 1X7QB 3VXMA 1IC4H 2GK0A 4D9QD 2CDFA 3LKPA 1U36A 4XVUC 1S7RA 4PR5B 3T0VA 3BEWA 3VFRB 4Z0BH 4NN6B 1N6UA 4ORGA 1BVZA 4M6AA 2P5WA 4KMTH 1N64H 1WBZB 4N0YH 4Y4FD 2Y9RT 4AIZA 2DWDA 1YN6A 2A6JA 3GBNH 3VG9B 5KJRH 3V6FA 2A6KA 2VWEE 4GW1A 1M0ZA 4ZO7A 2FGWH 1I7ZA 1MJUL 3VWJC 5L6YL 1JFQL 4PJ9A 3TN0A 3DSNA 3CFBA 1CN4A 4X8XA 2C3GA 2QHRL 4XH2B 3DO7B 4G5ZH 3ZE0E 4XMLH 5DJ2A 3B9KD 1QRND 4PJDF 2EDDA 4CADA 1HQ4A 4KKBD 5SWSA 4ZXBA 2I5YL 5SV4A 1INQA 1QHPA 4RISL 5KSVB 2HA1A 3DXAD 3NCCB 5HHVH 1G7PA 1AHWB 4OD1H 5KW9L 1Q72H 3L5HA 1OPGL 4N1HB 4IOFD 3HKFA 2NY2D 1LP9A 3GMRB 1WAAA 2MPAH 1IGCH 1YJDL 4Y1AD 3GM8A 4QXTA 4Z5RA 1MCFA 5D1QD 2NY6B 3VD4A 3IDMB 3V6OC 2F8XC 4YJZL 1GOFA 5C0CB 1RK0B 3CXDL 5HGDA 4BSJA 1CQKA 3MJGX 3PQYE 1XF2A 1QFPA 3QCUL 4ZD3L 1TLKA 5GGRA 4N0UA 4OCLC 3CVHA 5GGSB 5BS0D 5INDB 2AAVA 3VGAC 5TF1H 2P8MB 4XMKL 1A9EA 1AO7B 4JFDE 4FD0A 1EJOL 5GJSH 3WO3B 4ZOBA 4HKZA 3CUPA 5L2KB 1JGLH 5C07E 3F65A 5GPRA 1VPOH 5I8EB 3QWRD 2EDKA 3KYAA 4H8WL 1X4XA 3DX8A 4EI6A 3ULVD 3ZDYF 4YHZL 4NQUA 1RZ7H 3RNQB 1ACYL 1U6AL 3V4PH 2NQCA 3SE8H 2F53E 4PGDA 4PLOB 3VGBA 5JW4M 2O5YH 4YEEA 2NXYC 4L4TA 3PWPB 4TVPH 4JO1H 5CILH 1K2DA 1IM3A 3DVNA 5D9SB 3DUUB 5CBEA 2OJEA 3BAEL 3OR7B 1KTRL 2I26N 4WFFD 4YZFF 3MRPA 1KJ2L 2F74B 3U2SA 1Q9KA 4ZAKD 4YGVB 3SDCC 5EU3B 5HHQA 3WPGA 4O02H 4OLVH 2PCPA 5FM4A 2H2SC 4ELMA 4KTDH 4NGHH 4YPGB 3T4AB 1A9BA 4HIIB 2DKUA 4LPUA 5IEKB 3QUKA 2OMVA 4PB9H 3E2HB 2QV2A 5HDQH 5J8OA 5F9JA 5F7EH 4RFEA 1T66D 4Y5YC 1VERA 1RZJH 4WCYH 3BZDA 3BT2L 1J8HD 5DJXB 5F9OH 5F8RC 4HWBH 3RL1B 4DZBB 4RGMB 2Y06L 3MRDB 3VFWB 1P69B 4CN6A 4EN3D 5F3BA 5CMNA 4DZ8A 5LWYH 1AXSB 2WWMC 2FEEL 1KCSL 2IANA 4KRLB 1RIUH 5ITFB 4X7EC 5CJXC 3I9GH 3WCYA 5J1AB 5FGSA 3BH9A 5HHVL 2FRGP 1YMHA 2EDNA 4HLZG 1R0AL 4Q58C 3UTZA 2Y72A 3VI4F 2FX9L 3HE7A 1VKXA 4JRXE 1U3HA 2FGZA 1CDGA 2Z62A 2ID5A 3O4LD 3D0VB 1IGCL 3LKNA 1MVUB 1FQVA 3AREA 3H7LA 2NY5H 2V5SA 2NTSP 3S5LA 4MN8B 2Z93A 5L2KD 3UYPA 5J6HB 1YEJH 1M05A 1BD2E 3G6AA 5C09A 3QSKB 4ZUVB 2D4DA 3BDYL 2BP3A 3FL7A 4U1SB 3BUYB 1OLZA 1UWXK 2NY4C 4RZCB 5IF0B 4PTUA 3C2SA 4OLUL 2CMRH 4ODTH 4R0AA 4LP5A 5IESH 2YEZA 3WDHA 5D96C 1S8DB 1VPOL 5CGYD 1WIOA 1YEEL 3L7EB 4JPKL 4EIGB 4QKXB 1QEWA 2D7TL 3TVMA 4QBZA 1OTUD 2AJYL 5EOQH 2FYYB 1W8OA 4MA8H 4U1GC 4UAOB 3KYKH 5JORA 3H9SA 5CBAB 4YHIA 2PNDA 2ADIA 1WIUA 3GEWB 5CILL 3D2UA 3MLVH 2CKBL 3RZCB 4F9LA 1GGIL 4FFYL 4MD0A 2I07B 4OZIB 1BBDH 2Y36L 3QFJA 4G43A 4C2AB 4XRCA 4YAQB 1A9NA 1J10A 3WS3B 4WV1C 4C56E 1OD7A 1SEBB 2NYYC 4KK6D 4FQIH 3QRGL 2EYRB 2CR6A 1KYOK 1G7IB 2WINB 4AEHL 4AY0A 4HUNB 5HDQL 5KSBA 1IRAY 5FO9A 3VMOA 3QPXH 3B9EA 1DFBL 4JR9H 2ZOKB 1N5AB 2XN9D 3P11H 2YN5A 5F9OL 4HS3A 1BGXL 1EEZA 2VH5H 1N4XH 3QDMD 1NCBL 4P23B 3K2UH 3SGKC 1T6WA 5DS8B 2NCMA 2R0ZH 1NAMH 5FYLE 5FM5O 5D2LB 5ID0A 4FMFA 2Y5EA 1EZVX 5IB5B 3I9GL 3HA0A 1WITA 3LSOA 3WS6C 4LSXA 4Z7UA 3REZA 4LVOB 3TNNB 3ZSSA 4FQXA 4PKIG 4AM0A 3QULA 4H5SB 2XZQL 1I8KA 1CLOL 4BZYA 2AS5M 5D1ZD 4UB0L 4M3KB 4WI7A 1JNLL 1M71B 2PR4H 2QJDA 5HYQA 5IFJB 3LHPL 1GXEA 4X5WA 5F9AC 1YYLH 1CFTA 1QUNA 5KVEH 1DQTA 3SDDD 1NC2A 4XMPL 4N9OB 5DUPH 3LN4A 1MCEA 3IRZA 3MA7B 1MAKA 3VXQA 1R3IL 1XIWB 4LLUA 1LEIB 2XA3A 4XBGA 1BBJB 4K94C 3VFOB 4BH8A 5LGKA 3U36A 4HWBA 1EO7A 4I8DA 5CEYB 1CL7L 1WFUA 3L3GA 4HK3J 2XNAA 3WE6B 5L8JB 5T5FL 5F6IB 2CPCA 4WENB 2NY3B 2JE1A 3IJYB 4HT1L 2VAAB 4XCEB 4R97C 4JQIL 2VC2L 3B9VA 1LK3L 2EH8H 2IBZX 5I74C 3BQUD 3PV7A 3QXTA 5BO1H 1J12A 5C08A 2EYSA 2I9TA 3U0TB 3CXHJ 2ADFL 1I8IB 2ZUUA 3VGGA 2PW2B 4P5KB 4E41E 3TCLA 3WFBH 4LCCA 1X4ZA 1AXTH 3B5GA 4GW4A 2VDPL 1OOAA 4BFGA 2NY1B 4MA7H 4OQ1A 5IV2B 4NQDE 2IQ9L 5B21A 3OKNA 5IEHA 5L2JB 4NJAH 4P23D 2J2ZA 1FFNA 3UJJH 2P5EB 1XZ0A 3NH7H 3KPRD 3PL6C 1PBYA 5DQJB 1J87A 3CPLA 4X4ZA 3TIDA 1YECL 5EUOA 4OI7A 1OB1B 2R0LL 4LSCA 3BWAA 1U9KA 2HG5A 5H2BA 2HVJB 5C0RH 2IFFL 4KQ3H 4S2SB 2VH5L 5CSZA 4UDTB 5F6HJ 4MQWX 2X44D 3SGDI 4R2GB 4ALAL 4M4RA 4JFXB 4HUVA 4S10A 1NDGA 3VXNA 5JHLH 1JWSA 3BP4B 3QXDA 5IKCB 1RJYB 1N0LA 2Y23A 4LI2A 1GIGL 3QNXB 5AWBA 1VFBA 4K3JH 25C8H 5ESVA 3IDXL 1R5WA 3NZ8B 1PD6A 4WFHD 4X7TB 3IS0X 4LSSL 4WI8A 1QBMH 5ADOL 2HT3C 4XVTH 43C9B 1QNZL 4M4PA 3CH1B 2R2EA 1AQDA 4IJ3B 5DJCB 3ZDXF 1UH4A 4P4RA 5L8KB 2GI7A 3K4DA 3ZTNL 4IS6B 2JCCF 2VITB 1DQDH 5FA4A 4R90L 5D5ME 1KTDB 1AIFA 1X5KA 3X13A 4U1MB 4YXLH 4HGMA 1MAJA 3ISWA 3F7RA 2VB5A 2CLVB 3MTRA 2UVEA 4APQC 1NL0L 4N1CA 4HIJB 4I13B 2E9BA 4QXWA 4OLEA 1GZPB 1OAKH 3FQRA 5FYJE 3ZHDA 5CIPH 3AGVA 2H6PA 5GGUB 1TJGL 5EZOL 3GMOA 5IMOA 4NQXB 2QSCL 3BPCA 1NAMA 2YZ1A 2UV3A 4NN7B 1NCNA 4Y4KA 5J12C 4ELMF 5JW5A 4G9DB 4S1SL 4PGZA 3DARA 2VJXA 2XQYG 4S1DC 4KGJA 3PQYB 3NZHL 1YEIL 4MNQD 4H0IA 3KXFD 5F7YC 2A0ZA 5I8KH 3LQAH 2BOBA 3ARDC 2C3XA 1W0WB 4G3YH 4F57L 4ZFGL 1PKOA 1GOHA 5MEQA 1EFXB 4JFDB 4XHJD 4HEPG 1CLCA 5DFWH 2W0FB 1NFKA 4KAQL 5C07B 1CBVH 1EHXA 2IF7A 5HJ3B 2DQDH 4W4NA 1QACA 3T04D 1ZVHA 1KB5H 5DJAA 3U4EA 4QHKI 4RFNC 3UJJL 1U8MB 1I8MB 2C1OB 2VL4A 3S8WA 3NN8B 4OI8A 3GSXB 1VFOA 1JI1A 2FATH 2F53B 1FO0B 4P46C 3VFNA 3ZKMC 3WPCA 2RQ8A 1NGYA 5HI4D 5M95B 4GG8B 3S3JA 4G8IA 2ZZUT 4OCXH 4KUCF 1QSEA 4MMZC 3OJDA 4O2EA 2EDFA 2IH1A 4KT1A 4NZUL 3D69A 4LASH 3V6OE 2G5BB 5T3ZD 4XNYL 5KG9B 1HNFA 1S5HB 1AGFA 4GRLD 25C8L 1P5VA 4YDJB 3GFUA 2WWKO 3SCMA 2AERT 1MEXH 3OTTA 1UWEH 1A7NL 4EXPX 1UM4L 4CL7A 1QBLL 4JPIB 1I1YB 3NCJH 4P3DA 4XVJH 2AJUL 1K4DA 2DQJH 3OG6B 4KJQD 5TFSH 5SV3A 1J0HA 4OCYL 4LAQL 3HRZB 2LTQC 5DR5L 1J0ZA 4L3ED 3SB4A 1JGVL 4U1JA 1JPGA 4JDTH 3KYMB 5E5MB 1IQDA 3HG1A 3HI5H 3STZB 5BRZE 2ADGB 5CEZH 2J3SA 1T5XA 1YC8A 2J8OA 1ZHNA 3BGFC 1LE9B 4R26H 3CU1A 1A6UL 3B4NA 4GRWE 3TBWB 2RFXB 2X4PB 2ELLA 2UUDK 1J0JA 1KB9K 5ESQB 3TH4T 1ZGLA 4K7FB 2V17L 3CMGA 4PV9A 3SDAB 1D6EB 4HPYH 2AVGA 1XMWA 2ESVE 3DHJA 5E7FA 4JRXB 3U7WL 1YEGL 1ZLUH 3Q6GL 1EHLH 3PV6B 1RUMH 3I6KB 5FM5M 2CGRL 1MHHA 3QUYD 1NANI 4Z7WE 4Z76A 1D9KD 3UC0H 1F6LL 4NCDA 2XKNA 1KEML 4DTGH 1BF2A 4J4PD 3FO1B 1TNNA 2WUCH 5KSBF 1BD2B 4U31A 1N3NA 4U1KB 2W65B 3JTTB 1JNHA 4J23A 5DDHA 4WJ5A 2WAHA 4JQXA 3ZYIA 3PGFL 1UM6H 4NKIH 2HAZA 4U0RC 4HIXL 4WTWA 1FG2B 1GHFH 2AJVH 2F53D 1KT2B 3EYVA 3QR2A 4HUWA 5TQ0H 4H09A 1C16B 3IJHA 4WO4A 3MO1A 3ZDZF 2DQDL 1XFPA 2ZNXA 2BHZA 3T4YA 1CR9L 4OZGF 3DECA 2Q7YA 2BDNL 1N6QH 4DEPB 2O93L 4G8GD 4OGZA 3LIZL 4M5YL 4XCCL 5E6IC 5DJDB 3KPMB 4FQJH 5C0EB 4UUJA 1W72H 3AXLB 4IMKC 3QDAA 1YQ2A 1B0WA 4DGIH 5D6CB 3BZFB 3ELAT 1R3HA 4WWKC 1FN4B 3DBXA 3FQWB 5E24E 4LCUA 1S7TA 2VXVH 1MCIA 5CIPA 4MWFA 5DFTA 5HI3C 1M7XA 4LRIC 2DQGL 4F7PB 4XXDB 5F7NC 3QQNA 1QTYT 3S4SB 4C56B 1T21B 3HCVA 5EOTB 3KR3H 4I0KA 1D5ZB 1UWEL 4P4KA 2Z4QA 2QTEA 1YPZA 3QCVL 4MZ2A 5HGBA 1W0VB 1WZKA 2V2TB 4OKVB 5E1AB 5I1IH 4QTIL 3ULVL 5DUBB 2OI9C 1P8TA 1J05A 4QOKE 2C4FT 1ZSDB 1Y18A 3SDAD 5CJQL 4LKXB 1DEEA 1CXHA 5ALBL 4PTTA 5I71C 5INCB 2FEDC 5E4EC 5KAQG 5BW7C 2GAZA 4PGCB 5D4QA 1B4RA 3GSRA 1K4CB 3MV7A 4Y16B 1A7QH 4HBCL 2VNCA 1KB5A 3UTTD 3GK8L 3BKCH 3MROA 3I50H 4R7DB 2ASTB 3FKUS 4ODSL 2JIXA 3RVUD 1FNEB 2GQHA 3HLAB 3QNZA 1IQWH 2WW8A 1YY8A 4HFWB 3VGDA 1Q8MA 5C86A 3BI9X 5F7DA 4ZPVB 4Y19A 1KV3A 4U33A 1BQHA 2Z31A 2DRUA 4KJWC 5IW6A 3C60C 1A1MB 3GBMH 3S4SG 3UC0L 5JW4Q 4G6FB 4EI5D 3RIZA 3JXAA 2MKLC 1MQKH 1U92A 3FN0H 3GI9H 2HFEA 2PO6B 2CDEA 4OF0A 4X4ME 5EUOF 3UJIH 1A1OA 5GS1B 4PRHE 2NX5A 4V1DA 5AUMA 4PJAA 2AJVL 3TIEA 4KV5F 4XB7A 4DUVA 3WPBA 2R1XB 4DAGL 1GSMA 4BELD 4GLRI 1CGSH 2RGSA 3ARFA 4KI5D 4RMVA 5HHME 1G9MH 3GSVA 1GOGA 1FL3A 2XZCL 1KLGA 2UYLB 3CGTA 1WEJH 4PP1D 5FGBC 1SVCP 4NZTL 1BLNB 1OAQH 5I66B 5I0ZA 4ODVL 3LS5H 4YHPB 2ZCKH 4E41B 4MNGA 3HTLX 4XI5D 5T5NF 3PMHG 3BKYH 4JZOA 2M2DA 5D7JB 1Z9OA 4NQDB 3KR3L 1T7XA 1W8AA 1D5BB 1J5OH 2CH8A 4XP4L 1G6RB 3KYNB 2C7UB 5I1CL 3GMMB 1JL5A 5DC4B 1AD9A 1DN2A 4TZHA 1KC5H 1MWAB 1FYTD 2WQRA 2OZ4H 4M1DH 3BXNB 1LO4L 4JJHA 3IDJA 2VXSL 3I84A 1ZLSH 1MLBB 3DZEA 3QI9D 1M7DA 4NUJB 1TFHA 4RX4D 1X5AA 3RX8A 4PFEA 5IMMA 2YZ8A 2G9HA 1KIPA 3C8HA 3NIFF 4V2BA 4IRJD 3OAYH 2PYFB 3I50L 1ZT4B 5HPMB 4GS7B 4CMMB 5EFIA 5A2FA 1EAPA 2VR5A 3I6GA 4JCMA 4OQTL 5GGVL 1I3GH 3FRUB 1B0RA 4D0BB 4JN1L 4QTHA 4LXRA 3MACH 5IROA 1TETL 1FIGL 2PO6D 4HWZA 1W72A 4ZFOB 5DTFB 4WI9A 5GRZA 3ZHKA 5EO1B 3S34L 5MP6H 4Y5VB 1U58A 4XP6L 4R07A 4TTDC 1WGOA 2O6RA 3EYSL 4OV6F 5JIKA 4BSRA 2A6DB 3FT3A 4AT6B 3ZE2F 3ZTJG 4NZJA 2F5BH 1M4KA 1OQXA 5GRVL 3QWOB 1V3MA 2L7UA 4LPVA 1H3PL 2VABB 2ZSWB 5D5MB 3QJFA 2R1WA 1TZGL 2P44B 5JXEA 4JJ5B 2BJMH 2F54E 2V5RA 4CNIA 3UJIL 1Q9OB 1CE6B 4PP2A 3VDBA 5CZKA 4PJBE 3F7VB 5BOPA 2KPNA 1L7IL 3OB8A 1GPOL 1MCNA 2W60A 3DVGA 5E8OA 4ZODA 2IAMD 2BOCB 4F33A 1Q0XH 4N90E 3TA3A 3SKOB 3WXWH 1V3LA 5HVHC 1Z9SA 3FT4B 3QRFM 4KRPD 3O6MH 3OKMA 5FHBL 3CNKA 3RTQD 4K3HA 3VE0A 1JGEB 4JFEE 3QUZB 3ULUD 3LEXB 1KLFA 3IJSA 1DVFA 5D7JD 4S0TD 4XNQB 2CIKB 4FABH 3KYOB 2ATKB 3MOBH 1H3VA 3HC3L 2ITCA 1A14L 3FB8A 1R24A 1DQQB 1T2QL 2D31A 5F72S 4O5LH 1F2QA 3BKYL 4GSDL 3C2AL 2K1MA 2VQ1A 4OZGE 5IQ7H 5LVEA 5DC9B 2OR9L 1A3RH 1QD0A 5GIRB 1N8ZB 4LARH 4BZ2L 5F7UA 5CSBA 1MHCA 4CNMA 1ODAA 3IDIA 3HUJE 1F02I 3D6GA 1OSZA 4KXZH 1BFOA 1IAIL 2VDRL 2P7TA 1C12A 2OM5A 1T22B 4XNZC 2ZSVB 4HH8A 3MV9B 3PGDA 3TYGH 4YWGH 4U6XB 3U1SH 1XCQA 5KSAC 3P4MB 2DJ4A 5I1KH 4I0PD 4NQEA 2E3VA 4N8VA 3ARGC 3CDFA 2X1QA 3Q0HA 3B8YA 3H3PL 3I2CH 1F6AA 1JYXA 4PRNA 3KJ4A 1T1ZA 1J1OL 1XF4B 4GRMA 1U8IB 3MBXL 3P40A 1WWWX 5CUSL 5LGJB 1WTLA 1HHJB 5IMKA 1DEDA 1NCAH 4JQVA 4MDJA 1HXMB 1UM5L 2GKIA 4BUHA 2NY0D 1LNUB 1FDLL 2E9JA 1CICB 3KPSD 5C70A 4WW2A 2X1WL 4KC3B 4BV4R 4MNHA 1HN1A 1SJXA 3LZFH 1A7RL 5BRZB 2XWTB 5FO7A 4XP9L 4UV4H 3UCRA 4L8BB 3DSFL 1CLYH 4N9GA 3G04A 4GRWB 4M5ZH 4JFZL 3VW3L 2MCPL 1DE4A 4B5EA 1NBYB 4JDZB 1DBBL 4OAWA 5DQ9A 3SGEI 1J1XH 4W6WB 1XGYH 3KLAA 3N06B 1JZ4A 3W3MA 5HD8C 2AXGA 2J4WH 2OZ4A 4HV8B 4N0CC 2ESVB 1RZFL 2E9IA 1RJLA 2JJTA 3VWJD 1TITA 1XF5B 1MHEB 5CHNA 3SDCB 4HZAA 3MYZA 3P0VH 4UDUB 5EIVA 4Z7WB 1FPTL 3IRPX 4ZUSA 4LVEA 1OAYL 1J7VR 3UAJC 5BJTA 5JPMA 4OF7A 3O6FA 1XR9A 4O58H 3IDYC 5C0JA 1N5YL 1YPZF 4OCSL 4YE4H 1T1YB 2WBJC 3H0TB 3F7YB 1U0ND 4Y5YB 3GO1H 4WTZA 3SKMB 1FZKB 3VA6A 1K8IA 3QZWB 1T1WB 5CEXB 4DVRH 1JHKH 3EO9L 2HJFA 1OVZA 5BVJA 4H0HB 1RK1A 1ONQB 3ECBB 2E6QA 3TZVB 1NKOA 4FZ8H 4Z6AT 2V9TA 2DQTL 4LPXA 1FLRL 1WC7A 3DX7B 1U8NA 1Y6KR 3HPJB 1YEKH 5DRNA 3LN9A 3QXAB 1EXUB 4R9HA 2AK4E 3LKSA 4AEIH 5IB4A 1AGBB 1HEZB 1LK2B 5A40E 5DJZA 1G1YA 3GJFB 4Q6IB 2UY7A 1HKLH 3OKEA 3SBWA 3FO0H 5K9KB 3QPQC 3L7FB 3QHZL 5MHSE 5I76B 3QXWA 1CDJA 4JO3H 4LU5H 4NRXA 5DRZA 3VXRE 1QYGH 2EIZB 2BVQA 2QQNH 1ZA6A 3QZWG 1IKNA 2NY4B 1OY3B 4LPYA 2NXYD 3PNWB 2HP4A 2KZ1B 4S0SD 1LDSA 3U46A 5DZOA 5I8CB 2WUBL 2J6EH 3QHTC 2FO4B 4QOKB 3BIKA 4QXUH 5C0GA 5IFAH 4NRYB 4Z77A 2KUTA 5ITBL 3V6ZB 1S9KC 2BRRH 2BVTA 3HI1B 4PJXE 5GRXG 3OPZH 4HIHA 1FV1B 3BZ4A 3GJFK 3SDCD 4RGOH 1I1AC 3D39E 4PB0H 5C8JA 3MXVH 4BFBD 1A6ZA 2H2SD 4AMKL 2R2BA 1AC0A 2A9NL 1MF2L 2OJZL 1VFUA 2I60L 5EC1B 1A4KB 2EDOA 3EFDH 2D9CA 3MBEB 5T3ZL 1OSPH 2E27H 3LD8C 3PJSA 4FP8L 2CJUH 1A2YA 3T8XB 3LVEA 1HSAB 1RULL 5BXFB 3WN5C 5CP7A 5DO2C 2JCCB 1MPAL 4R4BB 3V0WL 3RGXA 3AAZB 1JL8A 4Q9QL 2A6IB 4P8SA 1BFVH 5JQ6L 2WWMD 3BJ91 1T7YA 4Y8DC 5K59E 2IH3A 1UFUA 1G0YR 1OGTB 4RAUA 3LOWA 3VXPB 4ERSH 3FMGH 3GO1L 5E2UL 3MGOA 1QBAA 5DEFB 5CAYB 4PRHB 3D25A 3LH2L 1N0XL 4MAYC 4O2CA 4P3CL 2X4UB 3C6SB 1Y0LA 4YDVA 4BQ6A 1E4XH 1BQUA 4X6EB 4NPYB 4YC2B 1YQVL 3GMQA 4U7MA 1DQJA 5TQ2H 1E4KA 3T0XA 3OL2A 5HHMB 4QF1B 3FB7B 1RAMA 1AP2B 4GKSB 4D8PB 4OV5A 1AGEA 2ARWA 2Q6WB 2P4AB 4F37K 3QJHB 3UTQB 2C3WA 4NZDA 4MQSB 2VAJA 1U8JB 1KTLB 2V2WB 1S7XA 5IHBA 3FN9A 3F5WA 2D0GA 3KPQA 4OZHA 3VXUB 2HJLB 5A16A 3QIWC 1KCLA 4J1UB 4GBXC 2ITDB 3B2VH 4ZFZB 5GGRY 4L5FH 1PQZB 3MLSH 4JM2D 2K9UA 4C4KT 3OKKA 1BZ7A 3RVTC 1OP3H 3IDGB 1O5DT 1RUPH 3BKML 4C83A 1LO3H 4YHYB 3BP6A 1F4WL 1DLFH 3T2NH 3WHE0 5EU6E 1F42A 4BFEA 1IZKA 5EN2A 1IAOA 4IRSA 2BRRL 5E08H 4HQ1A 1CGUA 1LMKA 4R97B 2NYYD 3TT3H 4OCRH 4IOIA 5I74B 3LEYL 3DURB 4CKVX 1YYML 4Y8AA 1FT8A 2JJSC 5DJ0A 4RAVB 1F3JA 1T4KB 1CZ8H 4G7YH 3KPOA 4CVZA 2UZIL 1ADQH 4FQHA 4P57B 2DI8A 2DLHA 1P4IL 1HHGA 3FQXB 4X6DF 4QCIA 4XCYB 2MQ3A 3C5ZD 1KJ3H 4ZUTA 1NDMA 4LPTA 5EZJA 1L0YA 2F54B 5HHMD 1ERNA 5JHDE 2N7BA 3DMMC 2N1KA 3OKDA 4PJBB 1XGPB 1QQDA 5DGRA 5EIIB 5C0BA 4DCQB 3RL2A 3DROB 2NY7H 4P3WA 2VXQH 5AAWA 2J6EA 3O3BA 1MFEH 3QDJA 5ERWA 2OTWA 3EDDA 3QDGE 4U3XA 4GLPA 2BCKB 4JFEB 1FC1A 1FVEA 1WWAX 3TWCH 4Q74A 3KWWA 2MFNA 3NA9L 3HFMH 3VDCA 1AFVH 5GZNC 5F89A 1JZ8A 1BAFL 3Q3GB 4D0CB 2IADB 3MYJB 1I9RL 1EVUA 4C54A 5MEND 4M7ZC 4X0KB 4AG4L 2J8UE 5D7SL 3G5XA 4OZGB 1QR1A 4P49A 4RA0C 4P91A 4JO4L 4D0DB 4GAFB 4KK9C 4APQB 3HUJB 1NCUA 1E27B 3QA3A 4Z64C 3G9VA 5KSUB 4XAWH 2VDKL 3VXSA 1Q1JH 5T1LB 1NGWA 3CZFA 4ZNCD 2YPLE 2EDRA 4KY1H 5IHLB 3GKWH 4PJ9C 4ETQB 3IDUA 2FECL 3FZUC 1NMAH 4PG9A 2CDGB 1TVDA 3CX5J 1QHOA 3BYYA 2HH0L 5J12B 3W9DA 3HAEB 3TM6A 3ALWA 2I9LB 5C7XH 4EQ2A 4MXVF 1QLEH 1A4JA 1NC4A 3ILPA 3PL6D 7FABH 1A0QH 4DQOH 4NSKB 3TLRA 2D03L 5AWDA 5EZLA 1DR9A 4NKDA 5I16A 1ADQL 3BEVA 2X05A 4P2YA 2P42B 2Y7QA 1DUZA 1FAKT 4PJHF 4QHMB 3E1F1 4RFNB 4N8PA 1TVHB 4Y2OA 1DBAH 4TNVF 5DI8A 5EUKB 5JUEL 1INDH 1QPPA 3U9PL 4P46B 4TSAH 3WFHA 2W9DH 1FSKB 1MRCH 2RJMA 5DMGC 1X5IA 2CKNA 4LQFL 3KLHC 2ZNWA 1I9IL 1HZHH 4NNXB 1KOOA 5SWZE 4JY6A 5GS0D 2ERJC 1KELH 2Y5QA 3UDWA 2HT3D 1ORQA 4DGYH 1IC1A 2N7AA 1F3RB 4XT1C 5CINH 4IOSD 2XWBA 4AQOA 1U8LA 5AYQA 3HC0A 2ZCHL 5BZDB 3HAEG 2XQBL 1OWWA 4BQCA 3U30C 4GKZA 3DNKA 4XNXL 1AE6L 3DETC 3I3BA 1EEUA 1R5IA 4AIXA 1BVKA 4JY5H 4UT7L 2AABH 3EW3B 3FFCD 1HH9A 2YUVA 2B2XL 5D93C 4LIQH 4YBQC 4HUMB 2QQLH 5IFHH 1IT9L 2WV3A 5JPNA 3GI8H 3EOBA 4CU6A 2VE6A 1OGAD 1ADQA 4R3SB 3CJJA 4YK4B 1B0GA 1AKJB 5A3IC 4HPOL 2QL1A 1KIUA 3GSNH 4PGEB 3A67L 2HVKB 4XBPB 3RGHA 4RWYH 3TPUB 6FABL 1O0VA 3FQUA 4ZDHA 4S1DD 3LN5A 1JI2A 1P7QB 3ARBB 3GKWL 2AK4B 5D2NA 1RFDH 4FRWA 3ARDD 3ULUL 5FTTB 1K5NB 1NMAL 1WBYA 3M17A 3EOAA 3QIUA 3LRSA 1OAXL 3PHQA 1QRKA 3HNVL 2RB8A 2ZG1A 1IGTA 2P48B 1MCKA 5T3XD 4O00A 4TUKH 3BO8A 5IW1A 5IQ9A 4H8WC 1D5IL 1RURL 2NNAA 1CLZL 3VXRB 4IEFB 4HKBA 1N6VA 2V7NB 3R0MA 4R96B 4U0RB 2VKXA 2BNRA 2MOVA 3FRPG 5L7XH 3HE7C 3ZKMD 5ALCH 1IKFH 1U3HC 2FSEA 4XXCA 3D85A 1FAIL 3WD5H 1JZ3A 3U0WL 1FFOA 4LHQB 4NWTL 3REWA 4PS4L 5ACZA 2Z7XA 4M61A 3AREC 1IJ9A 1PG7X 3NACL 1C5DB 1DBAL 1K8DB 3Q1SL 5AZEL 3MRGA 3I6LE 4PJXB 1DBMH 4R0LA 4KK5C 4PBWD 4J12A 3D39B 3OZ9L 1BM3L 5F96L 1BEYL 1MRCL 4QWWC 2NTFB 4LLYB 1RUAH 4WWKB 1CFQA 5T5NG 5I18H 1KELL 5D1XA 4OZHF 5EB9A 3P9MA 2DM2A 1N59B 4X6DE 1QA9A 4YIQB 3CFCH 1EEYB 4F58H 1U8HA 4I6JB 1PX4A 3CVIH 3TVMC 4KMQA 3ZO0A 1JF1B 5AWCA 4CNCA 4JANA 4HWUA 1WUNT 2Q86A 5E5UB 1QKZH 4X98A 3WUWA 1Z7XW 3IFPB 3RWEA 1Z9LA 1AKJD 2VDOL 1KFAH 2JJWA 3UPRB 5H35A 5FCUL 1JWMB 4LIQL 1KLUB 4R4NC 4LLQB 4NFBA 1XGQA 1TTUA 3ABZA 3CU7A 4G8EA 2FD6H 3IFLL 4LCIH 2R0WH 5EU5A 1HKFA 1P7QD 3QQ3A 4TSCH 4NRZA 1Z0NA 3CXHK 1NAKH 1JUFB 4G80B 4JDVA 5CJOH 5KTEH 1CE1L 2GJJA 3BP5A 2EE6A 2Z8SA 1F3DJ 2X6MA 1MFDL 3M45A 3MLXL 5K33A 1N2RB 3VD7A 3G9AB 5FUZL 5MHSD 2F5AL 35C8L 4GKOA 4WDIA 5I19L 1C7TA 1AGCB 2BRQA 1GCFA 1FNSL 5EO9A 3FONB 4EEEA 4GUPB 1G7JA 5GJTL 4TNWF 1ED3A 2KL6A 1RVFL 2YMXH 5DMKA 5FFLA 2EC9U 4LBEA 3C60B 1MLCA 2DTMH 2FJHB 1SYVB 3PP3H 1TZIB 4BM7A 2DQFA 3O3AB 2DB8A 1KEGH 3DTXB 3CMOH 3G6JA 4PYGA 1KJVA 1QR4A 3IXAB 3L5XH 5LAXB 2GJZA 3SKJL 3OGOE 1YDPA 4JKMA 5E6ID 1JRHH 1UXWA 2EICA 4PRAA 3SJVD 4FQXC 5AWNH 5E9DD 2PXYA 3D9AH 1YEHH 5TGBB 4WWKD 3JTSB 5J7CC 4G8FA 2GHWB 5DGQA 5EU6B 1IC7H 4JFOB 5D8JL 5HI3D 1DBML 2VLJD 1MREH 4M6ML 4X99B 4GAYA 4TOYH 4R4FH 2HFFA 4AH2A 4KNGA 4MXVE 3A0OA 2M1KA 3QG6B 3GSNA 4WU5B 3RDTB 4P2QE 3BW9A 2YA0A 4HJGA 2CLZB 3NVQA 3UZEA 4L3AA 4L8SA 3QIBA 2X4NB 5C2BL 4JAMA 3R8BB 1RZJC 4PJHE 5F9DC 4JZNA 4LLWA 1L7TH 1MI5E 2DLGA 5IBTL 3HPLB 3GSWB 3H7BA 4LHUD 4FXGB 3TGXA 2FIKB 3STLA 3UTSE 3P72A 3GGWB 3D5OF 1EX0A 1RHHA 2FLRT 3E8UH 1X5JA 1MFAL 3O41B 3UYRL 2E7CA 2IPKB 2VQUA 5GZOC 2QQKL 4N0RA 3BP7A 3ETBF 2XG4A 3ILQC 3M1BA 5DJ6A 3NFNA 5JHDB 1LQSR 1B90A 3I75A 5FECA 3D18A 3GSOB 2X89D 3VRIB 1B3JA 1JV5A 2X4TA 5DJ8A 4LCCC 1E28B 1GGBH 2OX5A 2QADC 3B6SA 5DVKA 3JWDH 5IJKA 5DUML 4L29A 3TBVA 4ZS7H 3GB7B 3UTPE 4XWOC 5BVPH 5CJOL 4KJWD 4ZUWA 4K7PL 4LVHC 4LSQL 3C60D 4QRQB 4NC0B 3T65B 4Q3IA 2NY5C 3QDGB 3DRQA 3GNML 4ZPTA 1HHHA 4J3VA 5MEOA 5HGAA 1DUYB 5BOZG 3VFVA 3RAJH 4JZJB 8FABA 4JO2L 2D2OA 5E95B 2R56L 3IU3A 1KCKA 5GS2H 3D48R 2DMKA 5C0AD 5D7LD 4WEUD 4DFHA 4B8CD 3MV8A 4X9BA 5DD0H 5T1KA 4Z7OE 2J8UB 2AGJL 4G42B 5HDBE 4MMXC 2ZJSH 4LCWD 2O5XH 5FKAB 5HHPA 1EO5A 2YUZA 5EBMB 3OXRA 4XPAH 1DANU 5IT2H 2XV6B 2BSRB 4EDWH 1PG7H 3GHBH 3L1OH 2DYPB 2RA8A 4XOSA 2ENSA 5AWNL 4YO0A 1UACL 5JOPD 1C5CH 4RSVA 4ECNA 3CC5B 4PUBL 1RPQA 5ACMA 2XY2A 2JB6B 4ZNEE 3ZYNA 2VERN 1A6TA 3AS1A 4BYHA 4JHWL 4FQLH 2GSIB 4OLXL 3MR9A 4MHHI 3TV3H 3LY6A 4U1LA 4LSTL 2EE3A 3OF6D 1MQ8A 4MCYA 1T80A 1BQLL 4XZUA 3WNMA 4MJID 2Z9TA 3N1MC 3R1GH 1RY7B 4ONFH 3W9EB 3NAAL 4P9HH 5HDLA 3S88H 5FYKE 4OSUL 1FZMB 5C6TH 2OL3L 5B0NA 1FL5A 4H0GA 5HHOE 1HILB 1OTSC 1BZQK 1X4YA 4NT6A 1RIVH 2K7PA 2NMSA 3X3FH 1U42A 1E0OB 2J12B 5HI5C 5EWIL 4OBSA 3F12B 5DEGA 2XICA 3B3IB 3WLBB 1UH3A 2X4RB 2NXZD 5K9OB 2BNQA 5SWZB 1H0DA 3EDEA 3E0GA 3WPIA 4ZS7L 4YDIL 5BVPL 3C6LB 4OLWL 3O8XA 4Q0XL 3BZ5A 3ARGB 4JRYB 4TTDD 1BX2A 2R29H 4UILL 3BE1L 5SWSE 1Q94A 1HSBA 2WNGA 2R0KL 1FIEA 2VDMH 1HI6B 3MLUH 4HUUA 4K8RH 1KNOB 5DK0B 1Y6NR 3HI6H 3GMLB 2GTWA 4I1NB 2E9WA 2FJGB 5DRXA 3TO4B 12E8H 1EZVY 4HLZH 4QRPA 1AGDB 1WAAE 2X2YA 5DD0L 1QFOA 4LOUD 4H20H 1P1ZB 2PTTB 2XPGB 3FOLB 2YPLD 1J8KA 3AB0B 1R6VA 4M9OA 3VWKC 5EORL 2V6HA 4ODUB 2BVYA 3CCHA 5EZIH 4H25A 2GJ6A 4WW1A 3MRLA 1I9JH 4P5TA 4AK1A 1YNTB 4NQVA 2DJSA 5IHUH 1DQML 1JPTH 1OAUH 4P5MA 2Q7NA 1T0NB 1F4AA 4HS6B 2W0LA 3CFDB 5E2TH 1ZVYA 3HZYA 2O6QA 4OFYA 4OF3A 4OZFB 3LAFA 2O61A 2E5EA 2Z8WC 2Y5TB 5ABDE 4X7SH 1UWXH 1CDYA 1H5BB 5J13B 4GAJH 4XVSH 4TN9A 4Q7DA 4FNLL 3V4UL 8CGTA 4WNQB 3SN6N 5C9JB 3S7GA 5DQDL 4K94L 3VQ1A 4HXAH 2RIKA 3PIQB 3VFGH 4UTBH 4PJCF 5I1HH 4ZSOA 2IBZY 3T0EE 5F1NB 4JKPL 1JK8B 1ZTXL 1EMTH 1X7QA 2J88L 3QEGL 4JHAH 5KSAD 3V0AC 3ARGD 4PR5A 3RI5K 3VFRA 2LVCA 1JBJA 4J8RB 3J7HA 1ZANL 5GS3A 1WBZA 1FRGH 3WNKA 1UA6L 5T1MB 4JQXC 2R2HB 1U41A 1KJMB 4L3CB 4CILA 4XWGH 1MH5B 3S3SA 2XACC 5DA0B 3I02B 4X6DB 1RUQL 1RZKH 1BZ9B 3Q5TA 4TULL 4LSVH 4OZFG 4WI4A 4WO4C 5CMAB 4J2XA 5KVGL 4LLDB 4XH2A 3DO7A 2R4RH 4UOJA 1U8KB 5LJYH 5TPWH 3ZT6A 2DJUA 3QQ4B 2YD9A 3P0GB 1TPXC 3MLUL 4WEMB 4HEME 4K8RL 3ZYOA 4KPHH 5I15H 4M6NH 5H94A 3PG2A 5KSVA 4JFQB 1ZE3C 1AHWA 5BV7B 5I8OH 43CAB 5HD8D 5B38B 4L4VD 3F62A 4N0CD 1B4JH 3BD5A 1GWBA 3GMRA 2XFXB 3OX8B 2EYTA 3F6LA 3BJLA 5DHXB 1H6TA 2OMZA 5DC0A 4X6CA 4HJ0C 3IDMA 5GS0L 3UAJD 2RCSL 5C0CA 1RK0A 2E8ZA 1RZGB 1JYWA 4K71C 4NFCA 5FHAL 1MCLA 2WBJD 4XP5H 5MI0C 4LSPL 3CFIC 4PJ8B 5GGSA 3LRGA 3EGSB 3LQAC 3WEXB 5INDA 1I1CA 1VGEL 2AI0L 2P8MA 4YEBB 2IPUG 1UKQA 1AO7A 5DD1L 1KYOJ 3V52H 1S7VB 5CSGA 3NTCL 5F97E 5I8EA 3RA7L 5JLZA 1JZ6A 3H9SE 2NW2B 4M9PA 5LXGL 2EO9A 3H9HB 1NUGA 4HK0B 3D3VA 3RNQA 3MJ6A 4KWUA 4WFGD 5I1AB 5E2WH 1Z9MA 5FA3A 5SX4H 1V7ML 3PWPA 2NY2C 2AQ1A 1GGCL 5B38G 2Z31C 1EMTL 4MXWH 3QG7H 5D9SA 3DUUA 3BIAX 3OR7A 2JLLA 1SBBA 1GL4B 3QPQD 1BOYA 3BH8B 4M7KH 2F74A 1CDHA 3O2DL 1INEH 1S9WB 5F3HB 4AL8H 5JMOC 5EU3A 2FO1A 2VXUH 4CDGC 4YPGA 3T4AA 3U79A 4HIIA 3RWCB 4JGJA 3RX5A 5IEKA 4NP4H 4OUUB 3KDMB 4UIKH 5AZ5A 5GRWA 4F7TB 4FFWC 5T3XL 4G6KH 3F7QA 4PJHB 2GFBB 5DJXA 2YN3A 5FUOH 4XPHL 3UJTL 4DN4H 1I8LA 1MI5B 3CFEB 3MRDA 3ARFC 4DZBA 3ULVC 4ZO6A 4NWUH 2ASSB 3UTSB 5FIEA 4B53A 1NJ9B 5JW4N 1AXSA 5FB8B 1LTXA 1WSST 3U4BL 1GGYA 3MJ7B 3QEQA 5JDSB 3G3AA 4JPWL 1I1AD 4PGBB 2DIAA 2XZAL 5ITFA 3BHBB 4M6NL 3KS0H 5J1AA 4M00A 3CIQA 1UH2A 3U82B 1YNKH 2Q4GW 4ELKB 4UNVA 2B0SL 4O51A 5EO0B 4MYWB 4ZAKC 2D7PA 2HLFC 2MNUA 1WV7T 2X09A 3D0VA 1MVUA 4NKHA 1FP5A 3F8UB 5DO2D 2BK8A 2GW5A 3JVGA 4M62L 1GC1H 4CVUA 2SEBB 1MHPH 1S7QB 1CD9B 3L3DB 1VESA 3C8KB 1MRFH 2UVFA 4YHKL 3N9GH 3WV0A 4KXZI 4ZUVA 2IC2A 5EBLB 3AM8A 4L9LB 3GSQB 4GOSA 4U1SA 3K8LA 4MAYD 2AK1L 5ETUB 3BUYA 2P1OB 1FLTX 4RZCA 5IF0A 1VFAB 3MRKB 4G7VL 4QRRE 4KK8C 4RMTA 1S8DA 3H42H 3HNTL 3L7EA 3PDDA 4RQQB 2XXCB 2IPTH 2F19H 2FYYA 2A9ML 2Z91A 3M8OH 4LF3B 4QLRA 2Q8BH 3O0RL 1OAZL 4HLJA 3O3UN 3GIZL 1QFWI 5CBAA 3EHBC 4LNVA 3VD9A 3MUGA 2XKSA 4OFKA 4Z95H 3MJ9H 3MFGB 1DQLL 5EC2B 5CS7A 4P2QD 3W82A 1P6FA 1CXFA 4TUOB 3RZCA 2BX5A 1IC5H 4KKCC 2I07A 4OZIA 1I9EA 1ORSB 2Y6SC 1UEYA 3L6FB 2W9EH 3LKOB 5IVOA 1S9YB 4YAQA 1INEL 1TENA 4OJFH 3WS3A 1KIRB 3HMWH 3QIWD 3WDJA 3VU2A 4GBXD 4QHNB 1SEBA 5JXEC 2W59A 4NBZB 5D3IA 3UTSD 5GISH 5JO5B 4FTVE 2EYRA 3ALPA 1G0XA 1G7IA 2WINA 5B8CB 1OARH 3RVTD 5TF0A 4PJCE 5JMRA 5C0ND 3C09B 2FB4L 3TA3C 2ZOKA 1N5AA 4BZ1H 5FEBA 4WY7H 4OFVA 1ZK9A 5CCKL 1QSZA 5A2JH 2X4QB 4G9FD 3QQ9C 1CS6A 4D2NA 2R69L 5HHOB 4P23A 2VLRD 2PYED 2F15A 5DS8A 3PUCA 4OGYH 1DVFC 4GMTH 4KQ4L 2MKWA 3BPLC 3Q6FB 4LGSB 2X1PA 5D2LA 2C9AA 1YN6B 1R3LB 2OTUB 5ECJE 4JEGB 5IB5A 4Y2DB 3OAUL 5JA9A 3TBYB 4UV7L 5CLWA 3TNNA 1EV2E 4ONHB 4JB9L 5KZCB 3CFBB 1U8QB 4ZG1A 1MFBL 3FTGB 4H5SA 2YHGA 4PLJC 4RMRA 4ZTPL 3RGVB 1UB5B 4A6YL 1KCRL 1RSFA 2QKIB 5SWSB 1M71A 1OTTC 2DQCL 1QO3B 1YMME 5IFJA 6CGTA 4X7FC 4EZGA 3WKMH 5HVFB 5GRUH 3RFSA 4P9MH 1FO0H 3QISA 4WWID 1RMFL 4P2RD 2AJXL 1UCBH 3DMMD 3RPIB 2Z66A 4K2UL 4NZRL 3VD5A 1IFHL 3RKPA 3MA7A 2FBJH 5IMLB 1XIWA 1MAML 1LEIA 1BBJA 3VFOA 1IVLA 2F58L 1EBAA 3QUXB 2H32B 5CEYA 1LO5B 4X7CC 5HGDB 4PRIE 3SE4A 1G9MC 1U3ZA 3WE6A 5I75C 1GZQB 2YPVL 3IJYA 2VAAA 1EGJL 3FT2B 4I3RH 1PZ5B 4Y4HB 2BVPB 3L3HB 5GZND 2ICWJ 3U0TA 5GMHA 1H15B 1I8IA 2PW2A 1IC5L 4P5KA 3V4VL 2IQAB 2ZKHL 4WW2C 2W9EL 4KUZH 1PLGL 3VXMD 4ARRA 4U4BA 3NGBB 1RIHH 4ECOA 2B1AL 3LEVL 3WO4C 5HZLB 1ZS8B 5IV2A 5L2JA 2XT1B 3VFPB 2Q76B 2P5EA 2P5WD 4FG6C 3AY4A 4KK9D 5DQJA 4OGAC 1OB1A 2APWA 1DCEA 2HVJA 1MRDH 4I18B 4S2SA 4Y5XB 1I7UB 2FWOB 2JJTC 4UDTA 4RBPK 3T0EB 4PJ9D 3TN0D 4JFXA 1X3DA 3FZUD 2W92A 3MRBB 2OK0H 3BP4A 4H88H 3O6FC 5IKCA 4WUKL 1KB9J 1WCBB 1RJYA 3BQUC 3WXVH 1FNLA 5EU7E 3QNXA 2R9UA 2Q1EA 3G6DL 3VH8G 2IGFL 4ZXBD 5SWSD 2KQMA 5KOMC 1G7QB 5DFVC 3R4DA 2AV7B 4X7TA 4GG6F 4YXKL 1OGQA 4UTAL 4KH2A 1S3KL 43C9A 3MJ9A 5L9DH 4N1EA 2EKSB 3CH1A 3U7AA 1DL7H 2AEQL 4EDXB 2M8XA 1E4XI 3GRWH 4I9WE 4TUJB 5DURD 4MDIB 5DJCA 4RGNE 1OP9A 3ARRA 5IG7B 4EZMA 2X9YA 4IS6A 1FYHB 4H1LB 4XGZA 2VITA 1K3IA 1P4BH 1KTDA 2PKDA 4Y89A 5IB1A 4U1MA 3MLWL 3INUH 1XH3B 2ZOLB 4X80H 1MJ7H 1F4YL 4LMQI 2CLVA 5DMGD 4HIJA 1OTMA 3W39B 3KLHD 1GZPA 5E00B 1IGJB 3MOAH 3SBWC 3S5LB 3HC4H 3IKKA 5GGUA 3UBXB 4I2XE 4NKOB 1KJ2B 5HY9A 3QCTL 1QSFE 4NQXA 3OHXB 2OMBA 2Q87A 4XPTL 4G9DA 4F7CB 3DETD 5CKAA 3MRRB 1JHLL 1IKNC 1T04B 4DWHA 3PQYA 1FGVH 4HC1H 3MLYH 4L4TD 1LD9B 3FOMB 3A6BL 1YEFH 2C4XA 3T3ME 4PBXA 5I73C 1AR2A 3C9NB 4P2OB 4FCGA 1A02N 5HHXH 1KPUB 1EFXA 3L95B 4JFDA 5KBNC 1N26A 2W0FA 5CP3H 3V8OA 2OS7A 5C07A 5FYLH 1A5FH 5I30H 4H1LG 2EDYA 4MAUH 4W6YB 4KTEH 3O2VL 5A3ID 1NFIB 4JFYB 4GO6B 2H1PL 1U8MA 1YY9C 2ADIB 5J6GB 1I8MA 3NN8A 4YQXH 3D2UB 2CSPA 3GSXA 4O4YL 2Z64A 1FO0A 4D9QE 4JM4L 1SEQL 3VXTB 4XRCB 2NLJB 1FC2D 1AI1H 4GG8A 4LDEB 3UBXG 4LLVB 4MQXC 2OK0L 3NIDF 1CU4L 4XC1L 4H88L 1BJMA 5IBUB 1L6XA 1BPVA 3G39A 5KG9A 1S5HA 4Z8FL 2IAND 5KVDH 3IXTA 4HS3B 4M7JL 1FHGA 5SWQB 1FORL 4JPIA 1I1YA 1E6JH 5IK3B 1ZHLB 2AEIT 5AZ2H 5ILTL 2IBBA 2HTKC 3H3BC 3HE7D 4U3HA 1QRNE 1U3HD 2VZUA 2Y1VA 3O9WC 4KUCD 5AYUL 4UFRA 3ARED 2ORBL 3KYMA 2R23B 1JIBA 4MQ7B 5E5MA 5GHWH 3STZA 2P8PB 3DXAE 5E2JA 2ADGA 2Z63A 4KK5D 1U2HA 1LE9A 4X80L 5B39B 5C09D 3TBWA 4DN3H 1X5LA 5AWAA 2X4PA 4QO1A 4QWWD 2IG2L 4N5EC 1TCRB 1KENL 2CKBB 3NCMA 1PG7W 4Y1AE 5DZNA 5ESQA 4K7FA 1D6EA 2AXFB 1BJ1J 4R5DA 4OZIF 4JRXA 3JZ7A 1X5ZA 4WGWB 4XPGH 5IBUG 3UP1A 2D7QA 4FQCL 3PV6A 3I6KA 3ZTJH 5EA0H 3UO1H 4HS8H 1MIEL 4NM8H 5BS0E 3RGZA 3TVMD 3KPLB 1WZ1H 2HWZL 1F11B 3RU8L 2NX5E 1G6RH 1MCPH 4WRLA 4D3CH 4PJAE 4OM0L 2DDQH 3FO1A 3H9SD 4QYOA 1BD2A 15C8L 1MWAH 1VEOA 3DYPA 2GUOB 1CCZA 4U1KA 1CDIA 2W65A 3JTTA 4XBGB 3D2UD 3MRHB 4R4ND 2YK1L 1CDUA 3ULVE 3IVKB 1SQ2N 3OV6A 3MRFB 1FG2A 1RZIB 4MJ6B 1UZ8B 1KT2A 3T3PE 2AJZB 3STBA 1J88A 3QFJD 4QRRB 5LBSH 1C16A 3EOTL 1A5FL 3BSZH 5HXMA 3WIHL 3RFZC 4WI2A 2O5ZH 3GRWA 3GMNB 5TE7H 4RMQA 5D2LF 4J3OC 2LFGA 5GRYA 1UYWL 1PSKH 3CX5K 5B39G 2B4CH 4YQXL 1JZ7A 3UEZA 1MFCH 1UWGH 1P84K 2VIRB 5DJDA 4YDKH 3VA2C 5C0EA 4X6BB 2HRPL 4WFFE 1UADC 3AXLA 1J11A 2VSDA 3BZFA 4QHLB 5F21B 4GQ9L 1FN4A 1E4WH 2B1HL 4MLSA 2P1MB 2GITB 3FQWA 1MCSA 2PF6A 3A6CL 2H41A 1EO8L 3LPWA 1WZMA 3ZT5A 4F7PA 3O6LL 4XXDA 1IL1A 3CPLB 2ZCLH 4GT7A 1UKTA 3S4SA 3TIDB 3FFDB 4C56A 2JB5H 1T21A 5EOTA 1J8HE 1D5ZA 4FTVB 4GKNB 1E6JL 4FQ2H 2YOCA 4PJCB 1W0VA 1NGPL 5FYJH 2V2TA 1AQKL 4ENED 4HC1A 4OKVA 5E1AA 4FQXD 1C08B 3K80A 4QXEA 2ED8A 1JWSB 3QXDB 3W11C 4TVPD 2AEPH 1JJUA 5DUBA 3BPNC 4NN5B 1ZSDA 4LKXA 3RWDA 4R6UA 5INCA 3GIVB 4U2YA 2CXGA 5DWUH 5CP3A 4PGCA 1K4CA 4Y16A 4OB5L 2WLYA 2FHCA 1FFQA 4R7DA 3OGCB 4YHNB 4GG6E 1FNEA 1NCTA 3HLAA 4HFWA 2IMMA 4U0QB 4S1RL 2DL2A 4ZPVA 1EUTA 2BEXA 2HT2C 3DVIA 2J8HA 5GRJL 3JV6B 1A1MA 1WZ1L 4W68A 4LLMB 3QB7C 4UT6L 3P4OB 1G6RL 1MCBA 2VDLH 1YMMB 3EYQC 2GSGB 3G5ZB 5GZOD 1R3JB 3NFPB 5F9WC 3ILQD 1HINL 3BZEB 3HZVB 3L3IB 5C08D 4OCWL 5GS1A 1IM9B 1CD1B 3QO0B 2UY6A 4JREC 3BRGC 4LXSA 5A2IH 2QADD 4OD3H 4Z18A 2R1XA 1DBKL 3P4NB 5ADPL 2I25N 3U4AA 4PRIB 3MXWL 1A4YA 3QP3A 5HBBA 5CZVH 3UPCA 1F58H 1ZHKB 2EC9T 2AQ2A 1KULA 3WPFA 1QVOB 4L4JA 3ARZA 4CRPA 2UYLA 1HH6B 2VN4A 1BLNA 1NLDL 1E4WL 3DYMA 5I66A 4HMEA 2XWJB 4YHPA 1JN6B 4E41A 3K8KA 3C5JA 3O3EB 2UWEE 1UZ6E 4NO2B 3ZE0F 4NQDA 2XN9E 4E0RA 4GRWH 1D5BA 2BERA 2WBKA 3QDME 5I17B 3THMH 1G6RA 3KYNA 3IF1B 2C7UA 1T2JA 5FO8B 1MWAA 1NFDE 4NKMB 3SDYH 3UDWC 3BXNA 3BUTA 3NIDE 4BQ9A 1T5WB 4Z7QE 5FDYA 3VWKB 1MLBA 4ODHH 2DLIA 4ISVB 4NUJA 2RHEA 2HKHL 3ZZ1A 5DMYA 3OB0H 4R6AA 2R9HD 1JVKA 2PYFA 1XGUB 1ZT4A 1ZLWK 4RCWA 5HPMA 4FQ1H 4QRUB 4CMMA 3DUHA 3S35L 3TT1L 3FRUA 4D0BA 2BC4B 1ACZA 3MRQB 1SJEB 4XI5C 3ZKXB 1URLA 3DVFA 4ZFOA 5DTFA 2X7LB 5EO1A 3TBSB 2LQRA 3Q2CA 2ZUQB 3X14B 4Y5VA 5F7HA 2BY2A 3KNBB 3O45A 1MCOH 3MLRH 3O6NA 2A6DA 4RGNB 4AT6A 1OTSD 3QWOA 5DSCB 2VABA 2ZSWA 5D5MA 3HE6B 4HF5H 4IDJH 5TDPB 4OKDA 3W2DL 1Q9OA 1CE6A 3F7VA 3WFDL 4JG0L 5D2NC 5JQHC 5CFHA 5F1IB 3GJFH 2BOCA 2H3NB 3GMPB 5IIEB 3SKOA 3QIUC 1MELA 4HIEB 1SY6L 3FT4A 5EOCH 3RHWK 4PERA 4X8JB 3IGAB 4KHTL 2DS4A 3O2WL 2VXTL 4F7MB 5AG9A 4I2XB 4NOBA 4DKFL 1A6WH 1QSFB 1A7BA 1JGEA 4KHXL 4Q9RH 3BIBX 1NEUA 3QUZA 5CWSB 3ZT7A 3LEXA 3C6PB 5DDHB 3WFEH 4XNQA 2CIKA 4YHLL 1M10B 3EFFB 3KYOA 2ATKA 4PJEF 3VFTB 3EYVB 3WPDA 4C57C 5GGQH 1NCCL 3TBTB 3ZKQD 3DV4B 4D9LH 1JRHI 3JV4B 3SKNB 4O9HH 1DQQA 1SM3H 3LMJL 3SQOH 3WYRA 2DQHH 3GHEL 1QSED 5LGHL 1QLFB 3S36X 5JDJA 5F1OB 4PREB 3IYLW 5D70L 2YD3A 4R0LC 3MNWB 5GIRA 2DQUH 1N8ZA 3B8SA 3GOZA 3SCMD 1C5BL 2CK0L 1NLBL 3AFLA 4OCMC 1A6VH 1IGIL 2C3VB 2CLRB 2X10A 5D1XC 5JA8B 1QFUH 1T22A 3NCYP 2ZSVA 1G7MB 1RZ8B 3MV9A 4EOWH 4LSDA 4U6XA 3P4MA 5DK3A 3HG1D 4WFHE 4OIBA 5DLMH 1BOGB 2EH7L 3V6OA 1AH1A 2DD8L 1G9NH 1D6VH 1J86A 4G6ML 4S1QL 2AJ3B 2YKLH 1XF4A 3CSYA 4OLZL 5E8DH 1U8IA 3VFUB 4ZTOL 5D71L 4AEEA 3GJEB 1Q0YL 4LP4A 5LGJA 3G3BA 3B9KB 1HHJA 1QRNB 2VDQL 1HXMA 1T0MB 2DN7A 4CMHC 1LNUA 1ZIWA 1CICA 1RU9L 2YUWA 4FS0A 5GQRK 1DCLA 4XTRC 3OMZA 4YHOL 5BRZA 3DXAB 3U7YH 2XWTA 4JG1H 3GKZA 4L8BA 4ZFFB 4U08A 1P7HL 3VI3E 2BY1A 5DYOB 2DI7A 1WCQA 2NY2B 1OQOA 4JDZA 7CGTA 3KHOA 4Y1AB 4F7EB 4QNPE 1FE8L 2O26U 4R8WH 5D1QB 5DEZA 4HV8A 2ESVA 1HHKB 4WO4D 3DIFB 1XF5A 2XA8L 1MHEA 5C6PB 3SDCA 3MC0A 4MNQE 3KXFE 1WBXB 4NCC1 4R7NB 4UDUA 3JB9j 5BS0B 4Z7WA 3MCLL 2EEDA 2CIIB 4MD5B 1WICA 4PJAB 2G2RB 1QP1A 1T1YA 1FGNL 1P9MA 2EKJA 3H0TA 3F7YA 2PXYC 4AEFA 1YNLL 3OBAA 3Q5OA 4KROC 3X17A 3SKMA 3NIGE 1FZKA 3QZWA 5DRWB 1T1WA 5CEXA 4KZDH 4AENB 3QHFL 4KDWA 1LO0L 4K3GA 1KLGB 4QRSA 2DQUL 1ONQA 3ECBA 3WL9B 1ZXQA 3TZVA 4Z78B 3CVHL 1IEAB 4XCFH 2YD4A 3K4ZA 4HJ0D 4P4KD 4HX1B 2BMKB 1DS9A 2IBGA 4M02A 3DX7A 3F58H 4KVNH 3HPJA 2ZUXA 4LCYB 2G60H 4L8SC 5E94B 3QIBC 5F44A 3WIFB 3RW6A 3QXAA 4OT1L 1EXUA 5T3ZE 4ZAKB 4NM4L 1ETZB 4FZEH 1AGBA 1HEZA 1LK2A 4OLYL 5CZXC 4EOWL 4ZYKB 3GJFA 1VCAA 4Q6IA 5K9KA 5GGTH 4EVNB 3L7FA 4UQ3B 4YGAB 3MV7D 4N8CL 5I76A 2H9GB 4KVCH 1HIMH 1J8HB 4YNYB 4L3EE 3DGGB 1MUJB 3AMLA 3SE9H 2EIZA 2GIYA 2EDJA 1A7PL 3IDJB 4K23L 4NFDA 4EN3B 1E6OH 4MA3B 2GK2A 5IJKC 3PNWA 1LE5B 3WKNA 2IWGA 1A7OH 4Y19D 5ENWB 2Z31D 2FO4A 4ETYA 4QOKA 1NGQL 1V7NL 2E7BA 3O3DA 4NRYA 2R8SL 2FR4B 5HHNB 3V6ZA 4NHCH 4UU9A 1ZLUK 3EZ8A 4RFOH 4LKCB 3NCFB 1FV1A 1OP5K 3FJTA 4PY7B 2MTPA 4HKXB 4XPBL 5IJBA 3X3GH 5IR1A 4GG6B 4J3WA 3O4LB 4G6JH 2NX5D 5EC1A 1A4KA 1NBVH 3LKRB 3MBEA 2ZUTA 5ICXB 4FFWD 2J5LC 4XNUL 4PRPA 3T8XA 2M26A 1H3TA 1HSAA 2XTJC 5BXFA 1DBJL 3ARFD 2JCCA 3V6BR 4R4BA 4OFIA 4CNIB 5HYFA 3AAZA 3VG0H 2A6IA 1D7FA 2ILLA 3RUGF 1NCWL 3MREB 5CEZD 5CJ8A 2HTLC 1ND0B 5C0BE 1OGTA 3VXPA 4DK3A 2CUMA 4X4MA 4KDTA 3S36H 4XCNB 5D7IE 1IGML 5DEFA 4PRHA 1IC4L 2X4UA 3C6SA 1HOCB 4G8GE 3VMNA 4X6EA 1NMBH 3SO3B 4NPYA 4ZOEA 2HLFD 4Z0BL 3BPLB 4I5BB 1ULVA 4KMTL 3EIFA 1N64L 1HYRC 3HAEH 3LB6C 5E8PB 4N0YL 4QF1A 2IMNA 5EDXA 4EXKA 2DQIH 1F97A 3FB7A 1AP2A 4PJEE 3GBNL 3RRQA 4D8PA 3E3QC 3F58L 5KJRL 1R24B 5IM7B 2Q6WA 2FGWL 3QJHA 3UTQA 4BSWB 2EECA 1H8SA 1PEZA 1U8JA 5AAMA 4J6RH 1KTLA 2V2WA 4X5XB 3FHQA 4QHUB 4G5ZL 4XMLL 3T0BA 4DKEH 4M8QB 2BXYA 1SJHB 2UWEB 4KK8D 3IETB 3VXUA 2HJLA 3DX9B 1OSZB 1I1RA 4J1UA 1P5UA 2XN9B 1BFOB 3FO2B 1HIML 4ZFZA 5C92A 5D5MF 5GGSY 1PQZA 3TP4A 3K74B 4LLAA</