2WFHA

The human slit 2 dimerization domain d4
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
181
structure length
181
Chain Sequence
CPTECTCLDTVVRCSNKGLKVLPKGIPRDVTELYLDGNQFTLVPKELSNYKHLTLIDLSNNRISTLSNQSFSNMTQLLTLILSYNRLRCIPPRTFDGLKSLRLLSLHGNDISVVPEGAFNDLSALSHLAIGANPLYCDCNMQWLSDWVKSEYKEPGIARCAGPGEMADKLLLTTPSKKFTC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure and functional relevance of the Slit2 homodimerization domain.
pubmed doi rcsb
molecule keywords SLIT HOMOLOG 2 PROTEIN C-PRODUCT
source organism Homo sapiens
molecule tags Splicing
total genus 57
structure length 181
sequence length 181
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01462 LRRNT Leucine rich repeat N-terminal domain
A PF13855 LRR_8 Leucine rich repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 2wfhA00
2V9TB 4YEBB 3C6OB 5CMPA 3GOZA 4M7EC 3WN4A 4LXRA 4BV4R 4KNGA 2P1QB 4H09A 3P72A 4L3AA 5LFNA 3DZEA 5B4PA 1WWLA 4ARNA 5HZLB 4KT1A 2JE0A 4R6GA 2UZYA 4MQWX 5CMNA 2WQVA 1H6TA 1W8AA 4G8AA 4WYKA 3RW7A 3VQ2A 1YRGA 4GLPA 1KOOA 4C2AB 2OMWA 4RCAB 3ZYNA 3ZYJA 3W3KA 4LSXA 4AW4A 2O6QA 3C6NB 1FQVA 3G06A 2UZXA 3WPEA 5B0NA 3G39A 2Z62A 1OZNA 5GMFA 4P91A 2P1OB 1GWBA 3PMHG 4B8CD 3CIGA 2OMTA 2IFGA 4L3FA 4CNMA 4BSUA 3O53A 3G04C 4XOSA 3O6NA 4AY9X 1H6UA 2OMZA 2ASSB 3E4GA 1IO0A 4UFRA 2WQUA 4Z8GA 3ULVA 4NKGA 4J0MA 3UL8A 5IJCA 2FT3A 2OMVA 3E6JA 3W3NA 3WPGA 4R09A 4LXSA 4P8SA 2Z7XA 3RIZA 2Z82A 4KXFB 2WQWA 1O6VA 1DCEA 4CILA 1XEUA 3REZA 3E2JA 3W3JA 4RCWA 3RW6A 1XECA 3ZYIA 2RA8A 3WPHA 1FO1A 4R08A 1P8TA 5A5CA 2P1NB 2Z7XB 3A79B 5GMHA 2A0ZA 2Y5QA 4R5CA 4LSCA 4Z61C 4LI2A 4R6JA 4IM6A 3FXIA 4R6AA 4V2CA 4ARRA 4PKIG 4Z64C 1XKUA 5GS2B 4U09A 3WPIA 2WQXA 2R9UA 5IYXC 3WPFA 4QBZA 3G3AA 1OTNA 4CNCA 2OMXA 1Z7XW 4QXEA 1JL5A 5AZ5A 3RGXA 1O6TA 2O6SA 3E3ZA 1M10B 4FDWA 3WPDA 1A9NA 1P9AG 4HQ1A 4Z94G 5HDHA 2Z66A 3UL9A 4U06A 4RWTC 4BSRA 3ULUA 1LTXA 4K17A 3WPCA 5IJDA 4CC4C 2V70A 2OMUA 4FMZA 3WPBA 2BNHA 2OMYA 2ASTB 5AWDA 3OJAA 3M18A 3JB9j 2P1MB 4FS7A 4R58A 1OOKG 1OGQA 4BSSA 5AWCA 3RJ0A 4LI1A 3ZYOA 5GQRK 3W3LA 4Q3GA 3M19A 2Q4GW 1KOHA 4WP6A 2XWTC 2CA6A 2V9SA 4R0AA 5AWAA 3OJAB 1ZIWA 2Z64A 3W3GA 4ECOA 4U7LA 4GT6A 1QYYA 5FTTB 1O6SA 3ULAA 4M7EA 3RFEA 3G3BA 3OGKB 4U08A 1K5DC 4R07A 4EZGA 1A4YA 5D3IA 2XOTA 4XSQA 4LSXC 2BEXA 3W3MA 3BZ5A 1OTMA 4PQ8A 4Q3IA 3RGZA 3KJ4A 2ID5A 4PSJA 4Y61B 4FD0A 4NKHA 1SQ0B 4FCGA 3OGLB 1DS9A 4OQTA 1PGVA 3VQ1A 1M0ZA 3C6PB 4R6FA 5GMGA 2O6RA 4XGOA 1XWDC 2RR6A 2Z63A 5IJBA 4V2EA 2ELLA 1XCDA 1FS2A 4FHOA 5B0TA 3UN9A 2WFHA 1K5GC 4TZHA 3SB4A 4J4LA 3TSRE 3RFSA 2Z81A 1M9SA 4PEQB 3CIYA 2JE1A 4I6JB 4QC0A 4ECNA 5GS0A 3CVRA 3UL7A 3RFJA 1U0ND 1OTOA 4MN8B 5AWBA 4C2BB 1FT8A 4PERA 2JQDA 4CC4A 1P8VA 1G9UA 2P1PB 4V2DA 1M9LA 1DFJI 4R5DA 4CP6A 4LSAA 4Q62A 1D0BA 3OGMB 2Z65A 4Z79A
chains in the Genus database with same CATH superfamily
2V9TB 4YEBB 3C6OB 5CMPA 3GOZA 4M7EC 3WN4A 4LXRA 4BV4R 4KNGA 2P1QB 4H09A 3P72A 4L3AA 5LFNA 3DZEA 5B4PA 1WWLA 4ARNA 5HZLB 4KT1A 2JE0A 4R6GA 2UZYA 4MQWX 5CMNA 2WQVA 1H6TA 1W8AA 4G8AA 4WYKA 3RW7A 3VQ2A 1YRGA 4GLPA 1KOOA 4C2AB 2OMWA 4RCAB 3ZYNA 3ZYJA 3W3KA 4LSXA 4AW4A 2O6QA 3C6NB 1FQVA 3G06A 2UZXA 3WPEA 5B0NA 3G39A 2Z62A 1OZNA 5GMFA 4P91A 2P1OB 1GWBA 3PMHG 4B8CD 3CIGA 2OMTA 2IFGA 4L3FA 4CNMA 4BSUA 3O53A 4NZTM 3G04C 4XOSA 3O6NA 4AY9X 1H6UA 2OMZA 2ASSB 3E4GA 1IO0A 4UFRA 2WQUA 4Z8GA 3ULVA 4NKGA 4J0MA 3UL8A 5IJCA 2FT3A 2OMVA 3E6JA 3W3NA 3WPGA 4R09A 4LXSA 4P8SA 2Z7XA 3RIZA 2Z82A 4KXFB 2WQWA 1O6VA 1DCEA 4CILA 1XEUA 3REZA 3E2JA 3W3JA 4RCWA 3RW6A 1XECA 3ZYIA 2RA8A 3WPHA 1FO1A 4R08A 1P8TA 5A5CA 2P1NB 2Z7XB 3A79B 5GMHA 2A0ZA 2Y5QA 4R5CA 4LSCA 4Z61C 4LI2A 4R6JA 4IM6A 3FXIA 4R6AA 4V2CA 4ARRA 4PKIG 4Z64C 1XKUA 5GS2B 4U09A 3WPIA 2WQXA 2R9UA 5IYXC 3WPFA 4QBZA 3G3AA 1OTNA 4CNCA 2OMXA 1Z7XW 4QXEA 1JL5A 5AZ5A 3RGXA 1O6TA 2O6SA 3E3ZA 1M10B 4FDWA 3WPDA 4NZRM 1A9NA 1P9AG 4HQ1A 4Z94G 5HDHA 2Z66A 3UL9A 4U06A 4RWTC 4BSRA 3ULUA 1LTXA 4K17A 3WPCA 5IJDA 4CC4C 2V70A 2OMUA 4FMZA 3WPBA 2BNHA 2OMYA 2ASTB 5AWDA 3OJAA 3M18A 3JB9j 2P1MB 4FS7A 4R58A 1OOKG 1OGQA 4BSSA 5AWCA 3RJ0A 4LI1A 3ZYOA 5GQRK 3W3LA 4Q3GA 3M19A 2Q4GW 1KOHA 4WP6A 2XWTC 2CA6A 2V9SA 4R0AA 5AWAA 3OJAB 1ZIWA 2Z64A 3W3GA 4ECOA 4U7LA 4GT6A 1QYYA 5FTTB 1O6SA 3ULAA 4M7EA 3RFEA 3G3BA 3OGKB 4U08A 1K5DC 4R07A 4EZGA 1A4YA 5D3IA 2XOTA 4XSQA 4LSXC 2BEXA 3W3MA 3BZ5A 1OTMA 4PQ8A 4Q3IA 3RGZA 3KJ4A 2ID5A 4PSJA 4Y61B 4FD0A 4NKHA 1SQ0B 4FCGA 3OGLB 1DS9A 4OQTA 1PGVA 3VQ1A 1M0ZA 3C6PB 4R6FA 5GMGA 2O6RA 4XGOA 1XWDC 2RR6A 2Z63A 5IJBA 4V2EA 2ELLA 1XCDA 1FS2A 4FHOA 5B0TA 3UN9A 2WFHA 1K5GC 4TZHA 3SB4A 4J4LA 3TSRE 3RFSA 2Z81A 1M9SA 4PEQB 3CIYA 2JE1A 4I6JB 4QC0A 4ECNA 5GS0A 3CVRA 3UL7A 3RFJA 1U0ND 1OTOA 4MN8B 5AWBA 4C2BB 1FT8A 4PERA 2JQDA 4CC4A 1P8VA 1G9UA 2P1PB 4V2DA 1M9LA 1DFJI 4R5DA 4CP6A 4LSAA 4Q62A 1D0BA 3OGMB 2Z65A 4Z79A
chains in the Genus database with same CATH topology
2V9TB 4YEBB 3C6OB 5CMPA 3GOZA 4M7EC 3WN4A 4LXRA 4BV4R 4KNGA 2P1QB 4H09A 3P72A 4L3AA 5LFNA 3DZEA 5B4PA 1WWLA 4ARNA 5HZLB 4KT1A 2JE0A 4R6GA 2UZYA 4MQWX 5CMNA 2WQVA 1H6TA 1W8AA 4G8AA 4WYKA 3RW7A 3VQ2A 1YRGA 4GLPA 1KOOA 4C2AB 2OMWA 4RCAB 3ZYNA 3ZYJA 3W3KA 4LSXA 4AW4A 2O6QA 3C6NB 1FQVA 3G06A 2UZXA 3WPEA 5B0NA 3G39A 2Z62A 1OZNA 5GMFA 4P91A 2P1OB 1GWBA 3PMHG 4B8CD 3CIGA 2OMTA 2IFGA 4L3FA 4CNMA 4BSUA 3O53A 3G04C 4XOSA 3O6NA 4AY9X 1H6UA 2OMZA 2ASSB 3E4GA 1IO0A 4UFRA 2WQUA 4Z8GA 3ULVA 4NKGA 4J0MA 3UL8A 5IJCA 2FT3A 2OMVA 3E6JA 3W3NA 3WPGA 4R09A 4LXSA 4P8SA 2Z7XA 3RIZA 2Z82A 4KXFB 2WQWA 1O6VA 1DCEA 4CILA 1XEUA 3REZA 3E2JA 3W3JA 4RCWA 3RW6A 1XECA 3ZYIA 2RA8A 3WPHA 1FO1A 4R08A 1P8TA 5A5CA 2P1NB 2Z7XB 3A79B 5GMHA 2A0ZA 2Y5QA 4R5CA 4LSCA 4Z61C 4LI2A 4R6JA 4IM6A 3FXIA 4R6AA 4V2CA 4ARRA 4PKIG 4Z64C 1XKUA 5GS2B 4U09A 3WPIA 2WQXA 2R9UA 5IYXC 3WPFA 4QBZA 3G3AA 1OTNA 4CNCA 2OMXA 1Z7XW 4QXEA 1JL5A 5AZ5A 3RGXA 1O6TA 2O6SA 3E3ZA 1M10B 4FDWA 3WPDA 1A9NA 1P9AG 4HQ1A 4Z94G 5HDHA 2Z66A 3UL9A 4U06A 4RWTC 4BSRA 3ULUA 1LTXA 4K17A 3WPCA 5IJDA 4CC4C 2V70A 2OMUA 4FMZA 3WPBA 2BNHA 2OMYA 2ASTB 5AWDA 3OJAA 3M18A 3JB9j 2P1MB 4FS7A 4R58A 1OOKG 1OGQA 4BSSA 5AWCA 3RJ0A 4LI1A 3ZYOA 5GQRK 3W3LA 4Q3GA 3M19A 2Q4GW 1KOHA 4WP6A 2XWTC 2CA6A 2V9SA 4R0AA 5AWAA 3OJAB 1ZIWA 2Z64A 3W3GA 4ECOA 4U7LA 4GT6A 1QYYA 5FTTB 1O6SA 3ULAA 4M7EA 3RFEA 3G3BA 3OGKB 4U08A 1K5DC 4R07A 4EZGA 1A4YA 5D3IA 2XOTA 4XSQA 4LSXC 2BEXA 3W3MA 3BZ5A 1OTMA 4PQ8A 4Q3IA 3RGZA 3KJ4A 2ID5A 4PSJA 4Y61B 4FD0A 4NKHA 1SQ0B 4FCGA 3OGLB 1DS9A 4OQTA 1PGVA 3VQ1A 1M0ZA 3C6PB 4R6FA 5GMGA 2O6RA 4XGOA 1XWDC 2RR6A 2Z63A 5IJBA 4V2EA 2ELLA 1XCDA 1FS2A 4FHOA 5B0TA 3UN9A 2WFHA 1K5GC 4TZHA 3SB4A 4J4LA 3TSRE 3RFSA 2Z81A 1M9SA 4PEQB 3CIYA 2JE1A 4I6JB 4QC0A 4ECNA 5GS0A 3CVRA 3UL7A 3RFJA 1U0ND 1OTOA 4MN8B 5AWBA 4C2BB 1FT8A 4PERA 2JQDA 4CC4A 1P8VA 1G9UA 2P1PB 4V2DA 1M9LA 1DFJI 4R5DA 4CP6A 4LSAA 4Q62A 1D0BA 3OGMB 2Z65A 4Z79A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2V9T B;  4YEB B;  3C6O B;  5CMP A;  3GOZ A;  4M7E C;  3WN4 A;  4LXR A;  4BV4 R;  4KNG A;  2P1Q B;  4H09 A;  3P72 A;  4L3A A;  5LFN A;  3DZE A;  5B4P A;  1WWL A;  4ARN A;  5HZL B;  4KT1 A;  2JE0 A;  4R6G A;  2UZY A;  4MQW X;  5CMN A;  2WQV A;  1H6T A;  1W8A A;  4G8A A;  4WYK A;  3RW7 A;  3VQ2 A;  1YRG A;  4GLP A;  1KOO A;  4C2A B;  2OMW A;  4RCA B;  3ZYN A;  3ZYJ A;  3W3K A;  4LSX A;  4AW4 A;  2O6Q A;  3C6N B;  1FQV A;  3G06 A;  2UZX A;  3WPE A;  5B0N A;  3G39 A;  2Z62 A;  1OZN A;  5GMF A;  4P91 A;  2P1O B;  1GWB A;  3PMH G;  4B8C D;  3CIG A;  2OMT A;  2IFG A;  4L3F A;  4CNM A;  4BSU A;  3O53 A;  3G04 C;  4XOS A;  3O6N A;  4AY9 X;  1H6U A;  2OMZ A;  2ASS B;  3E4G A;  1IO0 A;  4UFR A;  2WQU A;  4Z8G A;  3ULV A;  4NKG A;  4J0M A;  3UL8 A;  5IJC A;  2FT3 A;  2OMV A;  3E6J A;  3W3N A;  3WPG A;  4R09 A;  4LXS A;  4P8S A;  2Z7X A;  3RIZ A;  2Z82 A;  4KXF B;  2WQW A;  1O6V A;  1DCE A;  4CIL A;  1XEU A;  3REZ A;  3E2J A;  3W3J A;  4RCW A;  3RW6 A;  1XEC A;  3ZYI A;  2RA8 A;  3WPH A;  1FO1 A;  4R08 A;  1P8T A;  5A5C A;  2P1N B;  2Z7X B;  3A79 B;  5GMH A;  2A0Z A;  2Y5Q A;  4R5C A;  4LSC A;  4Z61 C;  4LI2 A;  4R6J A;  4IM6 A;  3FXI A;  4R6A A;  4V2C A;  4ARR A;  4PKI G;  4Z64 C;  1XKU A;  5GS2 B;  4U09 A;  3WPI A;  2WQX A;  2R9U A;  5IYX C;  3WPF A;  4QBZ A;  3G3A A;  1OTN A;  4CNC A;  2OMX A;  1Z7X W;  4QXE A;  1JL5 A;  5AZ5 A;  3RGX A;  1O6T A;  2O6S A;  3E3Z A;  1M10 B;  4FDW A;  3WPD A;  1A9N A;  1P9A G;  4HQ1 A;  4Z94 G;  5HDH A;  2Z66 A;  3UL9 A;  4U06 A;  4RWT C;  4BSR A;  3ULU A;  1LTX A;  4K17 A;  3WPC A;  5IJD A;  4CC4 C;  2V70 A;  2OMU A;  4FMZ A;  3WPB A;  2BNH A;  2OMY A;  2AST B;  5AWD A;  3OJA A;  3M18 A;  3JB9 j;  2P1M B;  4FS7 A;  4R58 A;  1OOK G;  1OGQ A;  4BSS A;  5AWC A;  3RJ0 A;  4LI1 A;  3ZYO A;  5GQR K;  3W3L A;  4Q3G A;  3M19 A;  2Q4G W;  1KOH A;  4WP6 A;  2XWT C;  2CA6 A;  2V9S A;  4R0A A;  5AWA A;  3OJA B;  1ZIW A;  2Z64 A;  3W3G A;  4ECO A;  4U7L A;  4GT6 A;  1QYY A;  5FTT B;  1O6S A;  3ULA A;  4M7E A;  3RFE A;  3G3B A;  3OGK B;  4U08 A;  1K5D C;  4R07 A;  4EZG A;  1A4Y A;  5D3I A;  2XOT A;  4XSQ A;  4LSX C;  2BEX A;  3W3M A;  3BZ5 A;  1OTM A;  4PQ8 A;  4Q3I A;  3RGZ A;  3KJ4 A;  2ID5 A;  4PSJ A;  4Y61 B;  4FD0 A;  4NKH A;  1SQ0 B;  4FCG A;  3OGL B;  1DS9 A;  4OQT A;  1PGV A;  3VQ1 A;  1M0Z A;  3C6P B;  4R6F A;  5GMG A;  2O6R A;  4XGO A;  1XWD C;  2RR6 A;  2Z63 A;  5IJB A;  4V2E A;  2ELL A;  1XCD A;  1FS2 A;  4FHO A;  5B0T A;  3UN9 A;  2WFH A;  1K5G C;  4TZH A;  3SB4 A;  4J4L A;  3TSR E;  3RFS A;  2Z81 A;  1M9S A;  4PEQ B;  3CIY A;  2JE1 A;  4I6J B;  4QC0 A;  4ECN A;  5GS0 A;  3CVR A;  3UL7 A;  3RFJ A;  1U0N D;  1OTO A;  4MN8 B;  5AWB A;  4C2B B;  1FT8 A;  4PER A;  2JQD A;  4CC4 A;  1P8V A;  1G9U A;  2P1P B;  4V2D A;  1M9L A;  1DFJ I;  4R5D A;  4CP6 A;  4LSA A;  4Q62 A;  1D0B A;  3OGM B;  2Z65 A;  4Z79 A; 
#chains in the Genus database with same CATH topology
 2V9T B;  4YEB B;  3C6O B;  5CMP A;  3GOZ A;  4M7E C;  3WN4 A;  4LXR A;  4BV4 R;  4KNG A;  2P1Q B;  4H09 A;  3P72 A;  4L3A A;  5LFN A;  3DZE A;  5B4P A;  1WWL A;  4ARN A;  5HZL B;  4KT1 A;  2JE0 A;  4R6G A;  2UZY A;  4MQW X;  5CMN A;  2WQV A;  1H6T A;  1W8A A;  4G8A A;  4WYK A;  3RW7 A;  3VQ2 A;  1YRG A;  4GLP A;  1KOO A;  4C2A B;  2OMW A;  4RCA B;  3ZYN A;  3ZYJ A;  3W3K A;  4LSX A;  4AW4 A;  2O6Q A;  3C6N B;  1FQV A;  3G06 A;  2UZX A;  3WPE A;  5B0N A;  3G39 A;  2Z62 A;  1OZN A;  5GMF A;  4P91 A;  2P1O B;  1GWB A;  3PMH G;  4B8C D;  3CIG A;  2OMT A;  2IFG A;  4L3F A;  4CNM A;  4BSU A;  3O53 A;  4NZT M;  3G04 C;  4XOS A;  3O6N A;  4AY9 X;  1H6U A;  2OMZ A;  2ASS B;  3E4G A;  1IO0 A;  4UFR A;  2WQU A;  4Z8G A;  3ULV A;  4NKG A;  4J0M A;  3UL8 A;  5IJC A;  2FT3 A;  2OMV A;  3E6J A;  3W3N A;  3WPG A;  4R09 A;  4LXS A;  4P8S A;  2Z7X A;  3RIZ A;  2Z82 A;  4KXF B;  2WQW A;  1O6V A;  1DCE A;  4CIL A;  1XEU A;  3REZ A;  3E2J A;  3W3J A;  4RCW A;  3RW6 A;  1XEC A;  3ZYI A;  2RA8 A;  3WPH A;  1FO1 A;  4R08 A;  1P8T A;  5A5C A;  2P1N B;  2Z7X B;  3A79 B;  5GMH A;  2A0Z A;  2Y5Q A;  4R5C A;  4LSC A;  4Z61 C;  4LI2 A;  4R6J A;  4IM6 A;  3FXI A;  4R6A A;  4V2C A;  4ARR A;  4PKI G;  4Z64 C;  1XKU A;  5GS2 B;  4U09 A;  3WPI A;  2WQX A;  2R9U A;  5IYX C;  3WPF A;  4QBZ A;  3G3A A;  1OTN A;  4CNC A;  2OMX A;  1Z7X W;  4QXE A;  1JL5 A;  5AZ5 A;  3RGX A;  1O6T A;  2O6S A;  3E3Z A;  1M10 B;  4FDW A;  3WPD A;  4NZR M;  1A9N A;  1P9A G;  4HQ1 A;  4Z94 G;  5HDH A;  2Z66 A;  3UL9 A;  4U06 A;  4RWT C;  4BSR A;  3ULU A;  1LTX A;  4K17 A;  3WPC A;  5IJD A;  4CC4 C;  2V70 A;  2OMU A;  4FMZ A;  3WPB A;  2BNH A;  2OMY A;  2AST B;  5AWD A;  3OJA A;  3M18 A;  3JB9 j;  2P1M B;  4FS7 A;  4R58 A;  1OOK G;  1OGQ A;  4BSS A;  5AWC A;  3RJ0 A;  4LI1 A;  3ZYO A;  5GQR K;  3W3L A;  4Q3G A;  3M19 A;  2Q4G W;  1KOH A;  4WP6 A;  2XWT C;  2CA6 A;  2V9S A;  4R0A A;  5AWA A;  3OJA B;  1ZIW A;  2Z64 A;  3W3G A;  4ECO A;  4U7L A;  4GT6 A;  1QYY A;  5FTT B;  1O6S A;  3ULA A;  4M7E A;  3RFE A;  3G3B A;  3OGK B;  4U08 A;  1K5D C;  4R07 A;  4EZG A;  1A4Y A;  5D3I A;  2XOT A;  4XSQ A;  4LSX C;  2BEX A;  3W3M A;  3BZ5 A;  1OTM A;  4PQ8 A;  4Q3I A;  3RGZ A;  3KJ4 A;  2ID5 A;  4PSJ A;  4Y61 B;  4FD0 A;  4NKH A;  1SQ0 B;  4FCG A;  3OGL B;  1DS9 A;  4OQT A;  1PGV A;  3VQ1 A;  1M0Z A;  3C6P B;  4R6F A;  5GMG A;  2O6R A;  4XGO A;  1XWD C;  2RR6 A;  2Z63 A;  5IJB A;  4V2E A;  2ELL A;  1XCD A;  1FS2 A;  4FHO A;  5B0T A;  3UN9 A;  2WFH A;  1K5G C;  4TZH A;  3SB4 A;  4J4L A;  3TSR E;  3RFS A;  2Z81 A;  1M9S A;  4PEQ B;  3CIY A;  2JE1 A;  4I6J B;  4QC0 A;  4ECN A;  5GS0 A;  3CVR A;  3UL7 A;  3RFJ A;  1U0N D;  1OTO A;  4MN8 B;  5AWB A;  4C2B B;  1FT8 A;  4PER A;  2JQD A;  4CC4 A;  1P8V A;  1G9U A;  2P1P B;  4V2D A;  1M9L A;  1DFJ I;  4R5D A;  4CP6 A;  4LSA A;  4Q62 A;  1D0B A;  3OGM B;  2Z65 A;  4Z79 A; 
#chains in the Genus database with same CATH homology
 2V9T B;  4YEB B;  3C6O B;  5CMP A;  3GOZ A;  4M7E C;  3WN4 A;  4LXR A;  4BV4 R;  4KNG A;  2P1Q B;  4H09 A;  3P72 A;  4L3A A;  5LFN A;  3DZE A;  5B4P A;  1WWL A;  4ARN A;  5HZL B;  4KT1 A;  2JE0 A;  4R6G A;  2UZY A;  4MQW X;  5CMN A;  2WQV A;  1H6T A;  1W8A A;  4G8A A;  4WYK A;  3RW7 A;  3VQ2 A;  1YRG A;  4GLP A;  1KOO A;  4C2A B;  2OMW A;  4RCA B;  3ZYN A;  3ZYJ A;  3W3K A;  4LSX A;  4AW4 A;  2O6Q A;  3C6N B;  1FQV A;  3G06 A;  2UZX A;  3WPE A;  5B0N A;  3G39 A;  2Z62 A;  1OZN A;  5GMF A;  4P91 A;  2P1O B;  1GWB A;  3PMH G;  4B8C D;  3CIG A;  2OMT A;  2IFG A;  4L3F A;  4CNM A;  4BSU A;  3O53 A;  3G04 C;  4XOS A;  3O6N A;  4AY9 X;  1H6U A;  2OMZ A;  2ASS B;  3E4G A;  1IO0 A;  4UFR A;  2WQU A;  4Z8G A;  3ULV A;  4NKG A;  4J0M A;  3UL8 A;  5IJC A;  2FT3 A;  2OMV A;  3E6J A;  3W3N A;  3WPG A;  4R09 A;  4LXS A;  4P8S A;  2Z7X A;  3RIZ A;  2Z82 A;  4KXF B;  2WQW A;  1O6V A;  1DCE A;  4CIL A;  1XEU A;  3REZ A;  3E2J A;  3W3J A;  4RCW A;  3RW6 A;  1XEC A;  3ZYI A;  2RA8 A;  3WPH A;  1FO1 A;  4R08 A;  1P8T A;  5A5C A;  2P1N B;  2Z7X B;  3A79 B;  5GMH A;  2A0Z A;  2Y5Q A;  4R5C A;  4LSC A;  4Z61 C;  4LI2 A;  4R6J A;  4IM6 A;  3FXI A;  4R6A A;  4V2C A;  4ARR A;  4PKI G;  4Z64 C;  1XKU A;  5GS2 B;  4U09 A;  3WPI A;  2WQX A;  2R9U A;  5IYX C;  3WPF A;  4QBZ A;  3G3A A;  1OTN A;  4CNC A;  2OMX A;  1Z7X W;  4QXE A;  1JL5 A;  5AZ5 A;  3RGX A;  1O6T A;  2O6S A;  3E3Z A;  1M10 B;  4FDW A;  3WPD A;  1A9N A;  1P9A G;  4HQ1 A;  4Z94 G;  5HDH A;  2Z66 A;  3UL9 A;  4U06 A;  4RWT C;  4BSR A;  3ULU A;  1LTX A;  4K17 A;  3WPC A;  5IJD A;  4CC4 C;  2V70 A;  2OMU A;  4FMZ A;  3WPB A;  2BNH A;  2OMY A;  2AST B;  5AWD A;  3OJA A;  3M18 A;  3JB9 j;  2P1M B;  4FS7 A;  4R58 A;  1OOK G;  1OGQ A;  4BSS A;  5AWC A;  3RJ0 A;  4LI1 A;  3ZYO A;  5GQR K;  3W3L A;  4Q3G A;  3M19 A;  2Q4G W;  1KOH A;  4WP6 A;  2XWT C;  2CA6 A;  2V9S A;  4R0A A;  5AWA A;  3OJA B;  1ZIW A;  2Z64 A;  3W3G A;  4ECO A;  4U7L A;  4GT6 A;  1QYY A;  5FTT B;  1O6S A;  3ULA A;  4M7E A;  3RFE A;  3G3B A;  3OGK B;  4U08 A;  1K5D C;  4R07 A;  4EZG A;  1A4Y A;  5D3I A;  2XOT A;  4XSQ A;  4LSX C;  2BEX A;  3W3M A;  3BZ5 A;  1OTM A;  4PQ8 A;  4Q3I A;  3RGZ A;  3KJ4 A;  2ID5 A;  4PSJ A;  4Y61 B;  4FD0 A;  4NKH A;  1SQ0 B;  4FCG A;  3OGL B;  1DS9 A;  4OQT A;  1PGV A;  3VQ1 A;  1M0Z A;  3C6P B;  4R6F A;  5GMG A;  2O6R A;  4XGO A;  1XWD C;  2RR6 A;  2Z63 A;  5IJB A;  4V2E A;  2ELL A;  1XCD A;  1FS2 A;  4FHO A;  5B0T A;  3UN9 A;  2WFH A;  1K5G C;  4TZH A;  3SB4 A;  4J4L A;  3TSR E;  3RFS A;  2Z81 A;  1M9S A;  4PEQ B;  3CIY A;  2JE1 A;  4I6J B;  4QC0 A;  4ECN A;  5GS0 A;  3CVR A;  3UL7 A;  3RFJ A;  1U0N D;  1OTO A;  4MN8 B;  5AWB A;  4C2B B;  1FT8 A;  4PER A;  2JQD A;  4CC4 A;  1P8V A;  1G9U A;  2P1P B;  4V2D A;  1M9L A;  1DFJ I;  4R5D A;  4CP6 A;  4LSA A;  4Q62 A;  1D0B A;  3OGM B;  2Z65 A;  4Z79 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...