2WFHA

The human slit 2 dimerization domain d4
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
181
structure length
181
Chain Sequence
CPTECTCLDTVVRCSNKGLKVLPKGIPRDVTELYLDGNQFTLVPKELSNYKHLTLIDLSNNRISTLSNQSFSNMTQLLTLILSYNRLRCIPPRTFDGLKSLRLLSLHGNDISVVPEGAFNDLSALSHLAIGANPLYCDCNMQWLSDWVKSEYKEPGIARCAGPGEMADKLLLTTPSKKFTC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Splicing
molecule keywords SLIT HOMOLOG 2 PROTEIN C-PRODUCT
publication title Structure and functional relevance of the Slit2 homodimerization domain.
pubmed doi rcsb
source organism Homo sapiens
total genus 57
structure length 181
sequence length 181
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01462 LRRNT Leucine rich repeat N-terminal domain
A PF13855 LRR_8 Leucine rich repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 2wfhA00
4CC4A 4ARNA 3SB4A 3E3ZA 4RCWA 1K5GC 2Z7XB 4I6JB 5GMHA 1LTXA 4PEQB 3UL8A 4TZHA 4BSSA 4J0MA 4U7LA 2ASTB 1U0ND 1OGQA 1A4YA 4V2CA 4M7EA 3RFEA 3ULAA 4EZGA 3ULUA 3BZ5A 3C6OB 4RCAB 4IM6A 4Z8GA 3OGMB 4R6JA 4CC4C 4NKGA 5IYXC 1SQ0B 3JB9j 2OMUA 4QXEA 3ZYOA 2Q4GW 4P91A 3OJAA 4R6GA 1H6UA 1DCEA 3PMHG 2OMWA 3KJ4A 2JE0A 4FS7A 3RW6A 2O6RA 3RW7A 5AZ5A 4WYKA 3ULVA 3RFSA 3RGZA 2P1MB 4R07A 3UL7A 5GS2B 1G9UA 1DFJI 2Z65A 2XWTC 3WPIA 3RFJA 4U06A 5AWAA 5B0TA 2A0ZA 2WQXA 3DZEA 3G39A 4P8SA 3G3BA 4BSRA 4FD0A 3C6PB 5A5CA 1DS9A 2ASSB 2Z81A 3FXIA 1D0BA 4V2DA 3O53A 2WQUA 2OMXA 4L3FA 3WPBA 1JL5A 1FS2A 3ZYJA 2ELLA 5CMNA 1M9SA 4PQ8A 1M9LA 2Z62A 3E6JA 1WWLA 3W3NA 4KXFB 3O6NA 1O6TA 3UL9A 4FCGA 3WPHA 4Q3GA 2IFGA 1M10B 4R5DA 3W3MA 3VQ2A 3WPEA 4CNCA 1O6SA 4H09A 2WQWA 1QYYA 1XCDA 4KT1A 5IJDA 3REZA 4CILA 2OMTA 4GT6A 3WPCA 5IJBA 2V9SA 4ECNA 2P1OB 4R08A 1M0ZA 3TSRE 4R58A 1W8AA 2OMVA 4R0AA 4M7EC 5CMPA 4LI1A 5LFNA 3OGLB 5GMFA 3UN9A 4Q62A 1YRGA 1P8VA 5D3IA 3GOZA 3CIYA 2Z7XA 4WP6A 4R5CA 5GMGA 4U08A 4CNMA 2RA8A 3WN4A 4Z61C 2O6SA 5HDHA 4PERA 2WQVA 3WPFA 5IJCA 2Y5QA 2P1NB 4Z94G 2OMYA 2CA6A 5GS0A 2P1QB 4FHOA 4LSAA 1A9NA 1KOOA 1OTOA 5AWDA 4B8CD 4G8AA 3OJAB 1XEUA 1XKUA 1OZNA 4LSCA 1FO1A 1P8TA 2RR6A 4MQWX 1Z7XW 2UZXA 2JE1A 4U09A 4LSXA 4Z64C 2JQDA 2R9UA 3RIZA 2Z64A 2XOTA 3G06A 2UZYA 4Z79A 4V2EA 4XGOA 3ZYNA 4R09A 3W3GA 5AWCA 2BNHA 4YEBB 3WPGA 1GWBA 4QC0A 2Z82A 4UFRA 1OTNA 4PSJA 4OQTA 2WFHA 4K17A 1K5DC 4LSXC 4LXRA 4J4LA 1KOHA 3G04C 4XSQA 4L3AA 2V9TB 3C6NB 4PKIG 2V70A 3RJ0A 3M19A 4LXSA 1FQVA 2ID5A 2Z63A 3W3LA 3RGXA 2O6QA 5HZLB 1OTMA 3M18A 4FDWA 5AWBA 4R6FA 5GQRK 5B4PA 2FT3A 4QBZA 1OOKG 3CVRA 4ECOA 2P1PB 5FTTB 2BEXA 4GLPA 3E4GA 3G3AA 4R6AA 2Z66A 4BV4R 3W3KA 3WPDA 3CIGA 4KNGA 1XWDC 4LI2A 4C2AB 1FT8A 1IO0A 5B0NA 4C2BB 3W3JA 1O6VA 4BSUA 3P72A 4ARRA 1P9AG 3OGKB 4XOSA 4MN8B 1XECA 4AW4A 4NKHA 4AY9X 3ZYIA 3VQ1A 4RWTC 4CP6A 1PGVA 4HQ1A 2OMZA 1ZIWA 4Y61B 3E2JA 4FMZA 4Q3IA 3A79B 1H6TA
chains in the Genus database with same CATH superfamily
4CC4A 4ARNA 3SB4A 3E3ZA 4RCWA 1K5GC 2Z7XB 4I6JB 5GMHA 1LTXA 4PEQB 3UL8A 4TZHA 4BSSA 4J0MA 4U7LA 2ASTB 1U0ND 1OGQA 1A4YA 4V2CA 4M7EA 3RFEA 3ULAA 4EZGA 3ULUA 3BZ5A 3C6OB 4RCAB 4IM6A 4Z8GA 3OGMB 4NZTM 4R6JA 4CC4C 4NKGA 5IYXC 1SQ0B 3JB9j 2OMUA 4QXEA 3ZYOA 2Q4GW 4P91A 3OJAA 4R6GA 1H6UA 1DCEA 3PMHG 2OMWA 3KJ4A 2JE0A 4NZRM 4FS7A 3RW6A 2O6RA 3RW7A 5AZ5A 4WYKA 3ULVA 3RFSA 3RGZA 2P1MB 4R07A 3UL7A 5GS2B 1G9UA 1DFJI 2Z65A 2XWTC 3WPIA 3RFJA 4U06A 5AWAA 5B0TA 2A0ZA 2WQXA 3DZEA 3G39A 4P8SA 3G3BA 4BSRA 4FD0A 3C6PB 5A5CA 1DS9A 2ASSB 2Z81A 3FXIA 1D0BA 4V2DA 3O53A 2WQUA 2OMXA 4L3FA 3WPBA 1JL5A 1FS2A 3ZYJA 2ELLA 5CMNA 1M9SA 4PQ8A 1M9LA 2Z62A 3E6JA 1WWLA 3W3NA 4KXFB 3O6NA 1O6TA 3UL9A 4FCGA 3WPHA 4Q3GA 2IFGA 1M10B 4R5DA 3W3MA 3VQ2A 3WPEA 4CNCA 1O6SA 4H09A 2WQWA 1QYYA 1XCDA 4KT1A 5IJDA 3REZA 4CILA 2OMTA 4GT6A 3WPCA 5IJBA 2V9SA 4ECNA 2P1OB 4R08A 1M0ZA 3TSRE 4R58A 1W8AA 2OMVA 4R0AA 4M7EC 5CMPA 4LI1A 5LFNA 3OGLB 5GMFA 3UN9A 4Q62A 1YRGA 1P8VA 5D3IA 3GOZA 3CIYA 2Z7XA 4WP6A 4R5CA 5GMGA 4U08A 4CNMA 2RA8A 3WN4A 4Z61C 2O6SA 5HDHA 4PERA 2WQVA 3WPFA 5IJCA 2Y5QA 2P1NB 4Z94G 2OMYA 2CA6A 5GS0A 2P1QB 4FHOA 4LSAA 1A9NA 1KOOA 1OTOA 5AWDA 4B8CD 4G8AA 3OJAB 1XEUA 1XKUA 1OZNA 4LSCA 1FO1A 1P8TA 2RR6A 4MQWX 1Z7XW 2UZXA 2JE1A 4U09A 4LSXA 4Z64C 2JQDA 2R9UA 3RIZA 2Z64A 2XOTA 3G06A 2UZYA 4Z79A 4V2EA 4XGOA 3ZYNA 4R09A 3W3GA 5AWCA 2BNHA 4YEBB 3WPGA 1GWBA 4QC0A 2Z82A 4UFRA 1OTNA 4PSJA 4OQTA 2WFHA 4K17A 1K5DC 4LSXC 4LXRA 4J4LA 1KOHA 3G04C 4XSQA 4L3AA 2V9TB 3C6NB 4PKIG 2V70A 3RJ0A 3M19A 4LXSA 1FQVA 2ID5A 2Z63A 3W3LA 3RGXA 2O6QA 5HZLB 1OTMA 3M18A 4FDWA 5AWBA 4R6FA 5GQRK 5B4PA 2FT3A 4QBZA 1OOKG 3CVRA 4ECOA 2P1PB 5FTTB 2BEXA 4GLPA 3E4GA 3G3AA 4R6AA 2Z66A 4BV4R 3W3KA 3WPDA 3CIGA 4KNGA 1XWDC 4LI2A 4C2AB 1FT8A 1IO0A 5B0NA 4C2BB 3W3JA 1O6VA 4BSUA 3P72A 4ARRA 1P9AG 3OGKB 4XOSA 4MN8B 1XECA 4AW4A 4NKHA 4AY9X 3ZYIA 3VQ1A 4RWTC 4CP6A 1PGVA 4HQ1A 2OMZA 1ZIWA 4Y61B 3E2JA 4FMZA 4Q3IA 3A79B 1H6TA
chains in the Genus database with same CATH topology
4CC4A 4ARNA 3SB4A 3E3ZA 4RCWA 1K5GC 2Z7XB 4I6JB 5GMHA 1LTXA 4PEQB 3UL8A 4TZHA 4BSSA 4J0MA 4U7LA 2ASTB 1U0ND 1OGQA 1A4YA 4V2CA 4M7EA 3RFEA 3ULAA 4EZGA 3ULUA 3BZ5A 3C6OB 4RCAB 4IM6A 4Z8GA 3OGMB 4R6JA 4CC4C 4NKGA 5IYXC 1SQ0B 3JB9j 2OMUA 4QXEA 3ZYOA 2Q4GW 4P91A 3OJAA 4R6GA 1H6UA 1DCEA 3PMHG 2OMWA 3KJ4A 2JE0A 4FS7A 3RW6A 2O6RA 3RW7A 5AZ5A 4WYKA 3ULVA 3RFSA 3RGZA 2P1MB 4R07A 3UL7A 5GS2B 1G9UA 1DFJI 2Z65A 2XWTC 3WPIA 3RFJA 4U06A 5AWAA 5B0TA 2A0ZA 2WQXA 3DZEA 3G39A 4P8SA 3G3BA 4BSRA 4FD0A 3C6PB 5A5CA 1DS9A 2ASSB 2Z81A 3FXIA 1D0BA 4V2DA 3O53A 2WQUA 2OMXA 4L3FA 3WPBA 1JL5A 1FS2A 3ZYJA 2ELLA 5CMNA 1M9SA 4PQ8A 1M9LA 2Z62A 3E6JA 1WWLA 3W3NA 4KXFB 3O6NA 1O6TA 3UL9A 4FCGA 3WPHA 4Q3GA 2IFGA 1M10B 4R5DA 3W3MA 3VQ2A 3WPEA 4CNCA 1O6SA 4H09A 2WQWA 1QYYA 1XCDA 4KT1A 5IJDA 3REZA 4CILA 2OMTA 4GT6A 3WPCA 5IJBA 2V9SA 4ECNA 2P1OB 4R08A 1M0ZA 3TSRE 4R58A 1W8AA 2OMVA 4R0AA 4M7EC 5CMPA 4LI1A 5LFNA 3OGLB 5GMFA 3UN9A 4Q62A 1YRGA 1P8VA 5D3IA 3GOZA 3CIYA 2Z7XA 4WP6A 4R5CA 5GMGA 4U08A 4CNMA 2RA8A 3WN4A 4Z61C 2O6SA 5HDHA 4PERA 2WQVA 3WPFA 5IJCA 2Y5QA 2P1NB 4Z94G 2OMYA 2CA6A 5GS0A 2P1QB 4FHOA 4LSAA 1A9NA 1KOOA 1OTOA 5AWDA 4B8CD 4G8AA 3OJAB 1XEUA 1XKUA 1OZNA 4LSCA 1FO1A 1P8TA 2RR6A 4MQWX 1Z7XW 2UZXA 2JE1A 4U09A 4LSXA 4Z64C 2JQDA 2R9UA 3RIZA 2Z64A 2XOTA 3G06A 2UZYA 4Z79A 4V2EA 4XGOA 3ZYNA 4R09A 3W3GA 5AWCA 2BNHA 4YEBB 3WPGA 1GWBA 4QC0A 2Z82A 4UFRA 1OTNA 4PSJA 4OQTA 2WFHA 4K17A 1K5DC 4LSXC 4LXRA 4J4LA 1KOHA 3G04C 4XSQA 4L3AA 2V9TB 3C6NB 4PKIG 2V70A 3RJ0A 3M19A 4LXSA 1FQVA 2ID5A 2Z63A 3W3LA 3RGXA 2O6QA 5HZLB 1OTMA 3M18A 4FDWA 5AWBA 4R6FA 5GQRK 5B4PA 2FT3A 4QBZA 1OOKG 3CVRA 4ECOA 2P1PB 5FTTB 2BEXA 4GLPA 3E4GA 3G3AA 4R6AA 2Z66A 4BV4R 3W3KA 3WPDA 3CIGA 4KNGA 1XWDC 4LI2A 4C2AB 1FT8A 1IO0A 5B0NA 4C2BB 3W3JA 1O6VA 4BSUA 3P72A 4ARRA 1P9AG 3OGKB 4XOSA 4MN8B 1XECA 4AW4A 4NKHA 4AY9X 3ZYIA 3VQ1A 4RWTC 4CP6A 1PGVA 4HQ1A 2OMZA 1ZIWA 4Y61B 3E2JA 4FMZA 4Q3IA 3A79B 1H6TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CC4 A;  4ARN A;  3SB4 A;  3E3Z A;  4RCW A;  1K5G C;  2Z7X B;  4I6J B;  5GMH A;  1LTX A;  4PEQ B;  3UL8 A;  4TZH A;  4BSS A;  4J0M A;  4U7L A;  2AST B;  1U0N D;  1OGQ A;  1A4Y A;  4V2C A;  4M7E A;  3RFE A;  3ULA A;  4EZG A;  3ULU A;  3BZ5 A;  3C6O B;  4RCA B;  4IM6 A;  4Z8G A;  3OGM B;  4R6J A;  4CC4 C;  4NKG A;  5IYX C;  1SQ0 B;  3JB9 j;  2OMU A;  4QXE A;  3ZYO A;  2Q4G W;  4P91 A;  3OJA A;  4R6G A;  1H6U A;  1DCE A;  3PMH G;  2OMW A;  3KJ4 A;  2JE0 A;  4FS7 A;  3RW6 A;  2O6R A;  3RW7 A;  5AZ5 A;  4WYK A;  3ULV A;  3RFS A;  3RGZ A;  2P1M B;  4R07 A;  3UL7 A;  5GS2 B;  1G9U A;  1DFJ I;  2Z65 A;  2XWT C;  3WPI A;  3RFJ A;  4U06 A;  5AWA A;  5B0T A;  2A0Z A;  2WQX A;  3DZE A;  3G39 A;  4P8S A;  3G3B A;  4BSR A;  4FD0 A;  3C6P B;  5A5C A;  1DS9 A;  2ASS B;  2Z81 A;  3FXI A;  1D0B A;  4V2D A;  3O53 A;  2WQU A;  2OMX A;  4L3F A;  3WPB A;  1JL5 A;  1FS2 A;  3ZYJ A;  2ELL A;  5CMN A;  1M9S A;  4PQ8 A;  1M9L A;  2Z62 A;  3E6J A;  1WWL A;  3W3N A;  4KXF B;  3O6N A;  1O6T A;  3UL9 A;  4FCG A;  3WPH A;  4Q3G A;  2IFG A;  1M10 B;  4R5D A;  3W3M A;  3VQ2 A;  3WPE A;  4CNC A;  1O6S A;  4H09 A;  2WQW A;  1QYY A;  1XCD A;  4KT1 A;  5IJD A;  3REZ A;  4CIL A;  2OMT A;  4GT6 A;  3WPC A;  5IJB A;  2V9S A;  4ECN A;  2P1O B;  4R08 A;  1M0Z A;  3TSR E;  4R58 A;  1W8A A;  2OMV A;  4R0A A;  4M7E C;  5CMP A;  4LI1 A;  5LFN A;  3OGL B;  5GMF A;  3UN9 A;  4Q62 A;  1YRG A;  1P8V A;  5D3I A;  3GOZ A;  3CIY A;  2Z7X A;  4WP6 A;  4R5C A;  5GMG A;  4U08 A;  4CNM A;  2RA8 A;  3WN4 A;  4Z61 C;  2O6S A;  5HDH A;  4PER A;  2WQV A;  3WPF A;  5IJC A;  2Y5Q A;  2P1N B;  4Z94 G;  2OMY A;  2CA6 A;  5GS0 A;  2P1Q B;  4FHO A;  4LSA A;  1A9N A;  1KOO A;  1OTO A;  5AWD A;  4B8C D;  4G8A A;  3OJA B;  1XEU A;  1XKU A;  1OZN A;  4LSC A;  1FO1 A;  1P8T A;  2RR6 A;  4MQW X;  1Z7X W;  2UZX A;  2JE1 A;  4U09 A;  4LSX A;  4Z64 C;  2JQD A;  2R9U A;  3RIZ A;  2Z64 A;  2XOT A;  3G06 A;  2UZY A;  4Z79 A;  4V2E A;  4XGO A;  3ZYN A;  4R09 A;  3W3G A;  5AWC A;  2BNH A;  4YEB B;  3WPG A;  1GWB A;  4QC0 A;  2Z82 A;  4UFR A;  1OTN A;  4PSJ A;  4OQT A;  2WFH A;  4K17 A;  1K5D C;  4LSX C;  4LXR A;  4J4L A;  1KOH A;  3G04 C;  4XSQ A;  4L3A A;  2V9T B;  3C6N B;  4PKI G;  2V70 A;  3RJ0 A;  3M19 A;  4LXS A;  1FQV A;  2ID5 A;  2Z63 A;  3W3L A;  3RGX A;  2O6Q A;  5HZL B;  1OTM A;  3M18 A;  4FDW A;  5AWB A;  4R6F A;  5GQR K;  5B4P A;  2FT3 A;  4QBZ A;  1OOK G;  3CVR A;  4ECO A;  2P1P B;  5FTT B;  2BEX A;  4GLP A;  3E4G A;  3G3A A;  4R6A A;  2Z66 A;  4BV4 R;  3W3K A;  3WPD A;  3CIG A;  4KNG A;  1XWD C;  4LI2 A;  4C2A B;  1FT8 A;  1IO0 A;  5B0N A;  4C2B B;  3W3J A;  1O6V A;  4BSU A;  3P72 A;  4ARR A;  1P9A G;  3OGK B;  4XOS A;  4MN8 B;  1XEC A;  4AW4 A;  4NKH A;  4AY9 X;  3ZYI A;  3VQ1 A;  4RWT C;  4CP6 A;  1PGV A;  4HQ1 A;  2OMZ A;  1ZIW A;  4Y61 B;  3E2J A;  4FMZ A;  4Q3I A;  3A79 B;  1H6T A; 
#chains in the Genus database with same CATH topology
 4CC4 A;  4ARN A;  3SB4 A;  3E3Z A;  4RCW A;  1K5G C;  2Z7X B;  4I6J B;  5GMH A;  1LTX A;  4PEQ B;  3UL8 A;  4TZH A;  4BSS A;  4J0M A;  4U7L A;  2AST B;  1U0N D;  1OGQ A;  1A4Y A;  4V2C A;  4M7E A;  3RFE A;  3ULA A;  4EZG A;  3ULU A;  3BZ5 A;  3C6O B;  4RCA B;  4IM6 A;  4Z8G A;  3OGM B;  4NZT M;  4R6J A;  4CC4 C;  4NKG A;  5IYX C;  1SQ0 B;  3JB9 j;  2OMU A;  4QXE A;  3ZYO A;  2Q4G W;  4P91 A;  3OJA A;  4R6G A;  1H6U A;  1DCE A;  3PMH G;  2OMW A;  3KJ4 A;  2JE0 A;  4NZR M;  4FS7 A;  3RW6 A;  2O6R A;  3RW7 A;  5AZ5 A;  4WYK A;  3ULV A;  3RFS A;  3RGZ A;  2P1M B;  4R07 A;  3UL7 A;  5GS2 B;  1G9U A;  1DFJ I;  2Z65 A;  2XWT C;  3WPI A;  3RFJ A;  4U06 A;  5AWA A;  5B0T A;  2A0Z A;  2WQX A;  3DZE A;  3G39 A;  4P8S A;  3G3B A;  4BSR A;  4FD0 A;  3C6P B;  5A5C A;  1DS9 A;  2ASS B;  2Z81 A;  3FXI A;  1D0B A;  4V2D A;  3O53 A;  2WQU A;  2OMX A;  4L3F A;  3WPB A;  1JL5 A;  1FS2 A;  3ZYJ A;  2ELL A;  5CMN A;  1M9S A;  4PQ8 A;  1M9L A;  2Z62 A;  3E6J A;  1WWL A;  3W3N A;  4KXF B;  3O6N A;  1O6T A;  3UL9 A;  4FCG A;  3WPH A;  4Q3G A;  2IFG A;  1M10 B;  4R5D A;  3W3M A;  3VQ2 A;  3WPE A;  4CNC A;  1O6S A;  4H09 A;  2WQW A;  1QYY A;  1XCD A;  4KT1 A;  5IJD A;  3REZ A;  4CIL A;  2OMT A;  4GT6 A;  3WPC A;  5IJB A;  2V9S A;  4ECN A;  2P1O B;  4R08 A;  1M0Z A;  3TSR E;  4R58 A;  1W8A A;  2OMV A;  4R0A A;  4M7E C;  5CMP A;  4LI1 A;  5LFN A;  3OGL B;  5GMF A;  3UN9 A;  4Q62 A;  1YRG A;  1P8V A;  5D3I A;  3GOZ A;  3CIY A;  2Z7X A;  4WP6 A;  4R5C A;  5GMG A;  4U08 A;  4CNM A;  2RA8 A;  3WN4 A;  4Z61 C;  2O6S A;  5HDH A;  4PER A;  2WQV A;  3WPF A;  5IJC A;  2Y5Q A;  2P1N B;  4Z94 G;  2OMY A;  2CA6 A;  5GS0 A;  2P1Q B;  4FHO A;  4LSA A;  1A9N A;  1KOO A;  1OTO A;  5AWD A;  4B8C D;  4G8A A;  3OJA B;  1XEU A;  1XKU A;  1OZN A;  4LSC A;  1FO1 A;  1P8T A;  2RR6 A;  4MQW X;  1Z7X W;  2UZX A;  2JE1 A;  4U09 A;  4LSX A;  4Z64 C;  2JQD A;  2R9U A;  3RIZ A;  2Z64 A;  2XOT A;  3G06 A;  2UZY A;  4Z79 A;  4V2E A;  4XGO A;  3ZYN A;  4R09 A;  3W3G A;  5AWC A;  2BNH A;  4YEB B;  3WPG A;  1GWB A;  4QC0 A;  2Z82 A;  4UFR A;  1OTN A;  4PSJ A;  4OQT A;  2WFH A;  4K17 A;  1K5D C;  4LSX C;  4LXR A;  4J4L A;  1KOH A;  3G04 C;  4XSQ A;  4L3A A;  2V9T B;  3C6N B;  4PKI G;  2V70 A;  3RJ0 A;  3M19 A;  4LXS A;  1FQV A;  2ID5 A;  2Z63 A;  3W3L A;  3RGX A;  2O6Q A;  5HZL B;  1OTM A;  3M18 A;  4FDW A;  5AWB A;  4R6F A;  5GQR K;  5B4P A;  2FT3 A;  4QBZ A;  1OOK G;  3CVR A;  4ECO A;  2P1P B;  5FTT B;  2BEX A;  4GLP A;  3E4G A;  3G3A A;  4R6A A;  2Z66 A;  4BV4 R;  3W3K A;  3WPD A;  3CIG A;  4KNG A;  1XWD C;  4LI2 A;  4C2A B;  1FT8 A;  1IO0 A;  5B0N A;  4C2B B;  3W3J A;  1O6V A;  4BSU A;  3P72 A;  4ARR A;  1P9A G;  3OGK B;  4XOS A;  4MN8 B;  1XEC A;  4AW4 A;  4NKH A;  4AY9 X;  3ZYI A;  3VQ1 A;  4RWT C;  4CP6 A;  1PGV A;  4HQ1 A;  2OMZ A;  1ZIW A;  4Y61 B;  3E2J A;  4FMZ A;  4Q3I A;  3A79 B;  1H6T A; 
#chains in the Genus database with same CATH homology
 4CC4 A;  4ARN A;  3SB4 A;  3E3Z A;  4RCW A;  1K5G C;  2Z7X B;  4I6J B;  5GMH A;  1LTX A;  4PEQ B;  3UL8 A;  4TZH A;  4BSS A;  4J0M A;  4U7L A;  2AST B;  1U0N D;  1OGQ A;  1A4Y A;  4V2C A;  4M7E A;  3RFE A;  3ULA A;  4EZG A;  3ULU A;  3BZ5 A;  3C6O B;  4RCA B;  4IM6 A;  4Z8G A;  3OGM B;  4R6J A;  4CC4 C;  4NKG A;  5IYX C;  1SQ0 B;  3JB9 j;  2OMU A;  4QXE A;  3ZYO A;  2Q4G W;  4P91 A;  3OJA A;  4R6G A;  1H6U A;  1DCE A;  3PMH G;  2OMW A;  3KJ4 A;  2JE0 A;  4FS7 A;  3RW6 A;  2O6R A;  3RW7 A;  5AZ5 A;  4WYK A;  3ULV A;  3RFS A;  3RGZ A;  2P1M B;  4R07 A;  3UL7 A;  5GS2 B;  1G9U A;  1DFJ I;  2Z65 A;  2XWT C;  3WPI A;  3RFJ A;  4U06 A;  5AWA A;  5B0T A;  2A0Z A;  2WQX A;  3DZE A;  3G39 A;  4P8S A;  3G3B A;  4BSR A;  4FD0 A;  3C6P B;  5A5C A;  1DS9 A;  2ASS B;  2Z81 A;  3FXI A;  1D0B A;  4V2D A;  3O53 A;  2WQU A;  2OMX A;  4L3F A;  3WPB A;  1JL5 A;  1FS2 A;  3ZYJ A;  2ELL A;  5CMN A;  1M9S A;  4PQ8 A;  1M9L A;  2Z62 A;  3E6J A;  1WWL A;  3W3N A;  4KXF B;  3O6N A;  1O6T A;  3UL9 A;  4FCG A;  3WPH A;  4Q3G A;  2IFG A;  1M10 B;  4R5D A;  3W3M A;  3VQ2 A;  3WPE A;  4CNC A;  1O6S A;  4H09 A;  2WQW A;  1QYY A;  1XCD A;  4KT1 A;  5IJD A;  3REZ A;  4CIL A;  2OMT A;  4GT6 A;  3WPC A;  5IJB A;  2V9S A;  4ECN A;  2P1O B;  4R08 A;  1M0Z A;  3TSR E;  4R58 A;  1W8A A;  2OMV A;  4R0A A;  4M7E C;  5CMP A;  4LI1 A;  5LFN A;  3OGL B;  5GMF A;  3UN9 A;  4Q62 A;  1YRG A;  1P8V A;  5D3I A;  3GOZ A;  3CIY A;  2Z7X A;  4WP6 A;  4R5C A;  5GMG A;  4U08 A;  4CNM A;  2RA8 A;  3WN4 A;  4Z61 C;  2O6S A;  5HDH A;  4PER A;  2WQV A;  3WPF A;  5IJC A;  2Y5Q A;  2P1N B;  4Z94 G;  2OMY A;  2CA6 A;  5GS0 A;  2P1Q B;  4FHO A;  4LSA A;  1A9N A;  1KOO A;  1OTO A;  5AWD A;  4B8C D;  4G8A A;  3OJA B;  1XEU A;  1XKU A;  1OZN A;  4LSC A;  1FO1 A;  1P8T A;  2RR6 A;  4MQW X;  1Z7X W;  2UZX A;  2JE1 A;  4U09 A;  4LSX A;  4Z64 C;  2JQD A;  2R9U A;  3RIZ A;  2Z64 A;  2XOT A;  3G06 A;  2UZY A;  4Z79 A;  4V2E A;  4XGO A;  3ZYN A;  4R09 A;  3W3G A;  5AWC A;  2BNH A;  4YEB B;  3WPG A;  1GWB A;  4QC0 A;  2Z82 A;  4UFR A;  1OTN A;  4PSJ A;  4OQT A;  2WFH A;  4K17 A;  1K5D C;  4LSX C;  4LXR A;  4J4L A;  1KOH A;  3G04 C;  4XSQ A;  4L3A A;  2V9T B;  3C6N B;  4PKI G;  2V70 A;  3RJ0 A;  3M19 A;  4LXS A;  1FQV A;  2ID5 A;  2Z63 A;  3W3L A;  3RGX A;  2O6Q A;  5HZL B;  1OTM A;  3M18 A;  4FDW A;  5AWB A;  4R6F A;  5GQR K;  5B4P A;  2FT3 A;  4QBZ A;  1OOK G;  3CVR A;  4ECO A;  2P1P B;  5FTT B;  2BEX A;  4GLP A;  3E4G A;  3G3A A;  4R6A A;  2Z66 A;  4BV4 R;  3W3K A;  3WPD A;  3CIG A;  4KNG A;  1XWD C;  4LI2 A;  4C2A B;  1FT8 A;  1IO0 A;  5B0N A;  4C2B B;  3W3J A;  1O6V A;  4BSU A;  3P72 A;  4ARR A;  1P9A G;  3OGK B;  4XOS A;  4MN8 B;  1XEC A;  4AW4 A;  4NKH A;  4AY9 X;  3ZYI A;  3VQ1 A;  4RWT C;  4CP6 A;  1PGV A;  4HQ1 A;  2OMZ A;  1ZIW A;  4Y61 B;  3E2J A;  4FMZ A;  4Q3I A;  3A79 B;  1H6T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...