4Q3GA

Structure of the osserk2 leucine rich repeat extracellular domain
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
219
structure length
219
Chain Sequence
DLNTEGDALYSLRQSLKDANNVLQSWDPTLVNPCTWFHVTCNPDNSVIRVDLGNAQLSGALVPQLGQLKNLQYLELYSNNISGTIPNELGNLTNLVSLDLYLNNFTGFIPETLGQLYKLRFLRLNNNSLSGSIPKSLTNITTLQELALDTNQLKSVPDGIFDRLTSLQKIWLHTNPWDCSCPRIDYLSRWLNKNSQKEQGSAKCSGSGKPVRSIICPTS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords OsSERK2
publication title Structure of the OsSERK2 leucine-rich repeat extracellular domain.
pubmed doi rcsb
source organism Oryza sativa
molecule tags Transferase
total genus 62
structure length 219
sequence length 219
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00560 LRR_1 Leucine Rich Repeat
A PF13855 LRR_8 Leucine rich repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 4q3gA00
1G9UA 2R9UA 4LI1A 3WPHA 4XSQA 4R08A 2WFHA 4M7EA 4GT6A 4PKIG 5A5CA 3RGZA 5LFNA 2XOTA 2XWTC 4PQ8A 4ARRA 4Z64C 4V2EA 1FQVA 4C2BB 5GMHA 4FD0A 1JL5A 1K5DC 2RR6A 2WQXA 5D3IA 4CC4C 4CNMA 2RA8A 2OMTA 1PGVA 4QBZA 2OMXA 3P72A 2BEXA 3RJ0A 2ELLA 3RFEA 2Z66A 3GOZA 3M19A 2V70A 2Z65A 3OJAA 3W3JA 4RWTC 1FS2A 3WPCA 4L3AA 2OMWA 4BSRA 3WPBA 4L3FA 2JQDA 4G8AA 4LSXC 1SQ0B 1H6TA 4R07A 3E2JA 2UZXA 2V9TB 4U7LA 2BNHA 5IYXC 5AZ5A 4CC4A 2Z7XB 1A4YA 4WYKA 5B0TA 4QC0A 4XGOA 4J4LA 4BSSA 3KJ4A 4J0MA 3REZA 4P91A 4V2DA 3UL9A 4R09A 4MQWX 4R6AA 1GWBA 4LSXA 2O6SA 3ULAA 1M10B 2Y5QA 1O6TA 3ULVA 3UL8A 3WN4A 2FT3A 1OGQA 3RW6A 2OMVA 5AWCA 3RW7A 4H09A 2O6RA 2A0ZA 2OMZA 2Z64A 5GMFA 2P1QB 4PEQB 3W3NA 4I6JB 4FDWA 4R5CA 1H6UA 3FXIA 1OTMA 4Z94G 5FTTB 4FHOA 1D0BA 3WPFA 4WP6A 3RFJA 3OGLB 3ZYJA 4RCWA 4PERA 1WWLA 5GS2B 4HQ1A 1OTOA 3VQ2A 4KXFB 3WPIA 4B8CD 1A9NA 1KOHA 2P1OB 3OGMB 2Z81A 5HZLB 4GLPA 5HDHA 3OJAB 5CMNA 3JB9j 3O6NA 4K17A 2V9SA 1XKUA 4LSAA 4LXRA 2JE0A 1O6SA 1XEUA 3W3MA 3DZEA 2WQVA 2JE1A 4UFRA 2Z63A 3RIZA 5IJCA 3C6PB 2Q4GW 1DFJI 4MN8B 2ASTB 4Y61B 3RGXA 4KT1A 5GQRK 4AY9X 3WPDA 2WQWA 4RCAB 4R6GA 3SB4A 1OOKG 3CVRA 4ECNA 3G3BA 3UL7A 2CA6A 5IJBA 3CIYA 4FCGA 1LTXA 5IJDA 1YRGA 4AW4A 2O6QA 3W3GA 3E3ZA 4EZGA 4V2CA 3A79B 1OTNA 1K5GC 1DS9A 4R6FA 4R58A 3ULUA 4NKGA 4Q62A 1DCEA 1M0ZA 4LI2A 1Z7XW 2IFGA 1QYYA 3BZ5A 1OZNA 3G04C 3ZYOA 1IO0A 4U09A 4YEBB 3CIGA 1O6VA 3C6NB 4CNCA 1FT8A 2OMYA 4R5DA 1W8AA 4Z8GA 2ASSB 3M18A 4CILA 5AWDA 3ZYIA 3TSRE 3ZYNA 3E6JA 4FMZA 4IM6A 4XOSA 4U06A 2OMUA 1P8VA 3UN9A 4BV4R 5AWBA 4Q3IA 4PSJA 4ARNA 5B0NA 4NKHA 2Z62A 3O53A 1FO1A 1XWDC 1U0ND 2WQUA 4LSCA 4R0AA 4LXSA 2Z82A 3C6OB 4Q3GA 1M9LA 4Z79A 4TZHA 1XECA 3PMHG 3W3KA 1ZIWA 4R6JA 1P8TA 5B4PA 4ECOA 1M9SA 3G39A 3G3AA 3WPEA 2ID5A 3E4GA 4M7EC 5AWAA 2Z7XA 3WPGA 4Z61C 5GMGA 1KOOA 2UZYA 2P1PB 5CMPA 2P1NB 4P8SA 5GS0A 4C2AB 3G06A 4CP6A 1XCDA 4OQTA 1P9AG 4KNGA 4U08A 3W3LA 4BSUA 2P1MB 3RFSA 3OGKB 3VQ1A 4QXEA 4FS7A
chains in the Genus database with same CATH superfamily
1G9UA 2R9UA 4LI1A 3WPHA 4XSQA 4R08A 2WFHA 4M7EA 4GT6A 4PKIG 5A5CA 3RGZA 5LFNA 2XOTA 2XWTC 4PQ8A 4ARRA 4Z64C 4V2EA 1FQVA 4C2BB 5GMHA 4FD0A 1JL5A 1K5DC 2RR6A 2WQXA 5D3IA 4CC4C 4CNMA 2RA8A 2OMTA 1PGVA 4QBZA 2OMXA 3P72A 2BEXA 3RJ0A 2ELLA 3RFEA 2Z66A 3GOZA 3M19A 2V70A 2Z65A 3OJAA 3W3JA 4RWTC 1FS2A 3WPCA 4L3AA 2OMWA 4BSRA 3WPBA 4L3FA 2JQDA 4G8AA 4LSXC 1SQ0B 1H6TA 4R07A 3E2JA 2UZXA 2V9TB 4U7LA 2BNHA 5IYXC 5AZ5A 4CC4A 2Z7XB 1A4YA 4WYKA 5B0TA 4QC0A 4XGOA 4J4LA 4BSSA 3KJ4A 4J0MA 3REZA 4P91A 4V2DA 3UL9A 4R09A 4MQWX 4R6AA 1GWBA 4LSXA 2O6SA 3ULAA 1M10B 2Y5QA 1O6TA 3ULVA 3UL8A 3WN4A 2FT3A 1OGQA 3RW6A 2OMVA 5AWCA 3RW7A 4H09A 2O6RA 2A0ZA 2OMZA 2Z64A 5GMFA 2P1QB 4PEQB 3W3NA 4I6JB 4FDWA 4R5CA 1H6UA 3FXIA 1OTMA 4Z94G 5FTTB 4FHOA 1D0BA 3WPFA 4WP6A 3RFJA 3OGLB 3ZYJA 4RCWA 4PERA 1WWLA 5GS2B 4HQ1A 1OTOA 3VQ2A 4KXFB 3WPIA 4B8CD 1A9NA 1KOHA 2P1OB 3OGMB 2Z81A 5HZLB 4GLPA 5HDHA 3OJAB 5CMNA 3JB9j 3O6NA 4K17A 2V9SA 1XKUA 4LSAA 4LXRA 2JE0A 1O6SA 1XEUA 3W3MA 3DZEA 2WQVA 2JE1A 4UFRA 2Z63A 3RIZA 5IJCA 3C6PB 2Q4GW 1DFJI 4MN8B 2ASTB 4Y61B 3RGXA 4KT1A 5GQRK 4AY9X 3WPDA 2WQWA 4RCAB 4R6GA 3SB4A 1OOKG 3CVRA 4ECNA 3G3BA 3UL7A 2CA6A 5IJBA 3CIYA 4FCGA 1LTXA 5IJDA 1YRGA 4AW4A 2O6QA 3W3GA 3E3ZA 4EZGA 4V2CA 3A79B 1OTNA 1K5GC 1DS9A 4R6FA 4R58A 3ULUA 4NKGA 4Q62A 1DCEA 1M0ZA 4LI2A 1Z7XW 4NZTM 2IFGA 1QYYA 3BZ5A 1OZNA 3G04C 3ZYOA 1IO0A 4U09A 4YEBB 3CIGA 1O6VA 3C6NB 4CNCA 1FT8A 2OMYA 4R5DA 1W8AA 4Z8GA 2ASSB 3M18A 4CILA 5AWDA 3ZYIA 3TSRE 3ZYNA 3E6JA 4FMZA 4IM6A 4XOSA 4U06A 2OMUA 1P8VA 3UN9A 4BV4R 5AWBA 4Q3IA 4PSJA 4ARNA 5B0NA 4NKHA 2Z62A 3O53A 1FO1A 1XWDC 1U0ND 2WQUA 4LSCA 4R0AA 4LXSA 2Z82A 3C6OB 4Q3GA 1M9LA 4Z79A 4TZHA 1XECA 3PMHG 3W3KA 1ZIWA 4R6JA 1P8TA 5B4PA 4ECOA 1M9SA 3G39A 3G3AA 3WPEA 2ID5A 3E4GA 4M7EC 5AWAA 4NZRM 2Z7XA 3WPGA 4Z61C 5GMGA 1KOOA 2UZYA 2P1PB 5CMPA 2P1NB 4P8SA 5GS0A 4C2AB 3G06A 4CP6A 1XCDA 4OQTA 1P9AG 4KNGA 4U08A 3W3LA 4BSUA 2P1MB 3RFSA 3OGKB 3VQ1A 4QXEA 4FS7A
chains in the Genus database with same CATH topology
1G9UA 2R9UA 4LI1A 3WPHA 4XSQA 4R08A 2WFHA 4M7EA 4GT6A 4PKIG 5A5CA 3RGZA 5LFNA 2XOTA 2XWTC 4PQ8A 4ARRA 4Z64C 4V2EA 1FQVA 4C2BB 5GMHA 4FD0A 1JL5A 1K5DC 2RR6A 2WQXA 5D3IA 4CC4C 4CNMA 2RA8A 2OMTA 1PGVA 4QBZA 2OMXA 3P72A 2BEXA 3RJ0A 2ELLA 3RFEA 2Z66A 3GOZA 3M19A 2V70A 2Z65A 3OJAA 3W3JA 4RWTC 1FS2A 3WPCA 4L3AA 2OMWA 4BSRA 3WPBA 4L3FA 2JQDA 4G8AA 4LSXC 1SQ0B 1H6TA 4R07A 3E2JA 2UZXA 2V9TB 4U7LA 2BNHA 5IYXC 5AZ5A 4CC4A 2Z7XB 1A4YA 4WYKA 5B0TA 4QC0A 4XGOA 4J4LA 4BSSA 3KJ4A 4J0MA 3REZA 4P91A 4V2DA 3UL9A 4R09A 4MQWX 4R6AA 1GWBA 4LSXA 2O6SA 3ULAA 1M10B 2Y5QA 1O6TA 3ULVA 3UL8A 3WN4A 2FT3A 1OGQA 3RW6A 2OMVA 5AWCA 3RW7A 4H09A 2O6RA 2A0ZA 2OMZA 2Z64A 5GMFA 2P1QB 4PEQB 3W3NA 4I6JB 4FDWA 4R5CA 1H6UA 3FXIA 1OTMA 4Z94G 5FTTB 4FHOA 1D0BA 3WPFA 4WP6A 3RFJA 3OGLB 3ZYJA 4RCWA 4PERA 1WWLA 5GS2B 4HQ1A 1OTOA 3VQ2A 4KXFB 3WPIA 4B8CD 1A9NA 1KOHA 2P1OB 3OGMB 2Z81A 5HZLB 4GLPA 5HDHA 3OJAB 5CMNA 3JB9j 3O6NA 4K17A 2V9SA 1XKUA 4LSAA 4LXRA 2JE0A 1O6SA 1XEUA 3W3MA 3DZEA 2WQVA 2JE1A 4UFRA 2Z63A 3RIZA 5IJCA 3C6PB 2Q4GW 1DFJI 4MN8B 2ASTB 4Y61B 3RGXA 4KT1A 5GQRK 4AY9X 3WPDA 2WQWA 4RCAB 4R6GA 3SB4A 1OOKG 3CVRA 4ECNA 3G3BA 3UL7A 2CA6A 5IJBA 3CIYA 4FCGA 1LTXA 5IJDA 1YRGA 4AW4A 2O6QA 3W3GA 3E3ZA 4EZGA 4V2CA 3A79B 1OTNA 1K5GC 1DS9A 4R6FA 4R58A 3ULUA 4NKGA 4Q62A 1DCEA 1M0ZA 4LI2A 1Z7XW 2IFGA 1QYYA 3BZ5A 1OZNA 3G04C 3ZYOA 1IO0A 4U09A 4YEBB 3CIGA 1O6VA 3C6NB 4CNCA 1FT8A 2OMYA 4R5DA 1W8AA 4Z8GA 2ASSB 3M18A 4CILA 5AWDA 3ZYIA 3TSRE 3ZYNA 3E6JA 4FMZA 4IM6A 4XOSA 4U06A 2OMUA 1P8VA 3UN9A 4BV4R 5AWBA 4Q3IA 4PSJA 4ARNA 5B0NA 4NKHA 2Z62A 3O53A 1FO1A 1XWDC 1U0ND 2WQUA 4LSCA 4R0AA 4LXSA 2Z82A 3C6OB 4Q3GA 1M9LA 4Z79A 4TZHA 1XECA 3PMHG 3W3KA 1ZIWA 4R6JA 1P8TA 5B4PA 4ECOA 1M9SA 3G39A 3G3AA 3WPEA 2ID5A 3E4GA 4M7EC 5AWAA 2Z7XA 3WPGA 4Z61C 5GMGA 1KOOA 2UZYA 2P1PB 5CMPA 2P1NB 4P8SA 5GS0A 4C2AB 3G06A 4CP6A 1XCDA 4OQTA 1P9AG 4KNGA 4U08A 3W3LA 4BSUA 2P1MB 3RFSA 3OGKB 3VQ1A 4QXEA 4FS7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1G9U A;  2R9U A;  4LI1 A;  3WPH A;  4XSQ A;  4R08 A;  2WFH A;  4M7E A;  4GT6 A;  4PKI G;  5A5C A;  3RGZ A;  5LFN A;  2XOT A;  2XWT C;  4PQ8 A;  4ARR A;  4Z64 C;  4V2E A;  1FQV A;  4C2B B;  5GMH A;  4FD0 A;  1JL5 A;  1K5D C;  2RR6 A;  2WQX A;  5D3I A;  4CC4 C;  4CNM A;  2RA8 A;  2OMT A;  1PGV A;  4QBZ A;  2OMX A;  3P72 A;  2BEX A;  3RJ0 A;  2ELL A;  3RFE A;  2Z66 A;  3GOZ A;  3M19 A;  2V70 A;  2Z65 A;  3OJA A;  3W3J A;  4RWT C;  1FS2 A;  3WPC A;  4L3A A;  2OMW A;  4BSR A;  3WPB A;  4L3F A;  2JQD A;  4G8A A;  4LSX C;  1SQ0 B;  1H6T A;  4R07 A;  3E2J A;  2UZX A;  2V9T B;  4U7L A;  2BNH A;  5IYX C;  5AZ5 A;  4CC4 A;  2Z7X B;  1A4Y A;  4WYK A;  5B0T A;  4QC0 A;  4XGO A;  4J4L A;  4BSS A;  3KJ4 A;  4J0M A;  3REZ A;  4P91 A;  4V2D A;  3UL9 A;  4R09 A;  4MQW X;  4R6A A;  1GWB A;  4LSX A;  2O6S A;  3ULA A;  1M10 B;  2Y5Q A;  1O6T A;  3ULV A;  3UL8 A;  3WN4 A;  2FT3 A;  1OGQ A;  3RW6 A;  2OMV A;  5AWC A;  3RW7 A;  4H09 A;  2O6R A;  2A0Z A;  2OMZ A;  2Z64 A;  5GMF A;  2P1Q B;  4PEQ B;  3W3N A;  4I6J B;  4FDW A;  4R5C A;  1H6U A;  3FXI A;  1OTM A;  4Z94 G;  5FTT B;  4FHO A;  1D0B A;  3WPF A;  4WP6 A;  3RFJ A;  3OGL B;  3ZYJ A;  4RCW A;  4PER A;  1WWL A;  5GS2 B;  4HQ1 A;  1OTO A;  3VQ2 A;  4KXF B;  3WPI A;  4B8C D;  1A9N A;  1KOH A;  2P1O B;  3OGM B;  2Z81 A;  5HZL B;  4GLP A;  5HDH A;  3OJA B;  5CMN A;  3JB9 j;  3O6N A;  4K17 A;  2V9S A;  1XKU A;  4LSA A;  4LXR A;  2JE0 A;  1O6S A;  1XEU A;  3W3M A;  3DZE A;  2WQV A;  2JE1 A;  4UFR A;  2Z63 A;  3RIZ A;  5IJC A;  3C6P B;  2Q4G W;  1DFJ I;  4MN8 B;  2AST B;  4Y61 B;  3RGX A;  4KT1 A;  5GQR K;  4AY9 X;  3WPD A;  2WQW A;  4RCA B;  4R6G A;  3SB4 A;  1OOK G;  3CVR A;  4ECN A;  3G3B A;  3UL7 A;  2CA6 A;  5IJB A;  3CIY A;  4FCG A;  1LTX A;  5IJD A;  1YRG A;  4AW4 A;  2O6Q A;  3W3G A;  3E3Z A;  4EZG A;  4V2C A;  3A79 B;  1OTN A;  1K5G C;  1DS9 A;  4R6F A;  4R58 A;  3ULU A;  4NKG A;  4Q62 A;  1DCE A;  1M0Z A;  4LI2 A;  1Z7X W;  2IFG A;  1QYY A;  3BZ5 A;  1OZN A;  3G04 C;  3ZYO A;  1IO0 A;  4U09 A;  4YEB B;  3CIG A;  1O6V A;  3C6N B;  4CNC A;  1FT8 A;  2OMY A;  4R5D A;  1W8A A;  4Z8G A;  2ASS B;  3M18 A;  4CIL A;  5AWD A;  3ZYI A;  3TSR E;  3ZYN A;  3E6J A;  4FMZ A;  4IM6 A;  4XOS A;  4U06 A;  2OMU A;  1P8V A;  3UN9 A;  4BV4 R;  5AWB A;  4Q3I A;  4PSJ A;  4ARN A;  5B0N A;  4NKH A;  2Z62 A;  3O53 A;  1FO1 A;  1XWD C;  1U0N D;  2WQU A;  4LSC A;  4R0A A;  4LXS A;  2Z82 A;  3C6O B;  4Q3G A;  1M9L A;  4Z79 A;  4TZH A;  1XEC A;  3PMH G;  3W3K A;  1ZIW A;  4R6J A;  1P8T A;  5B4P A;  4ECO A;  1M9S A;  3G39 A;  3G3A A;  3WPE A;  2ID5 A;  3E4G A;  4M7E C;  5AWA A;  2Z7X A;  3WPG A;  4Z61 C;  5GMG A;  1KOO A;  2UZY A;  2P1P B;  5CMP A;  2P1N B;  4P8S A;  5GS0 A;  4C2A B;  3G06 A;  4CP6 A;  1XCD A;  4OQT A;  1P9A G;  4KNG A;  4U08 A;  3W3L A;  4BSU A;  2P1M B;  3RFS A;  3OGK B;  3VQ1 A;  4QXE A;  4FS7 A; 
#chains in the Genus database with same CATH topology
 1G9U A;  2R9U A;  4LI1 A;  3WPH A;  4XSQ A;  4R08 A;  2WFH A;  4M7E A;  4GT6 A;  4PKI G;  5A5C A;  3RGZ A;  5LFN A;  2XOT A;  2XWT C;  4PQ8 A;  4ARR A;  4Z64 C;  4V2E A;  1FQV A;  4C2B B;  5GMH A;  4FD0 A;  1JL5 A;  1K5D C;  2RR6 A;  2WQX A;  5D3I A;  4CC4 C;  4CNM A;  2RA8 A;  2OMT A;  1PGV A;  4QBZ A;  2OMX A;  3P72 A;  2BEX A;  3RJ0 A;  2ELL A;  3RFE A;  2Z66 A;  3GOZ A;  3M19 A;  2V70 A;  2Z65 A;  3OJA A;  3W3J A;  4RWT C;  1FS2 A;  3WPC A;  4L3A A;  2OMW A;  4BSR A;  3WPB A;  4L3F A;  2JQD A;  4G8A A;  4LSX C;  1SQ0 B;  1H6T A;  4R07 A;  3E2J A;  2UZX A;  2V9T B;  4U7L A;  2BNH A;  5IYX C;  5AZ5 A;  4CC4 A;  2Z7X B;  1A4Y A;  4WYK A;  5B0T A;  4QC0 A;  4XGO A;  4J4L A;  4BSS A;  3KJ4 A;  4J0M A;  3REZ A;  4P91 A;  4V2D A;  3UL9 A;  4R09 A;  4MQW X;  4R6A A;  1GWB A;  4LSX A;  2O6S A;  3ULA A;  1M10 B;  2Y5Q A;  1O6T A;  3ULV A;  3UL8 A;  3WN4 A;  2FT3 A;  1OGQ A;  3RW6 A;  2OMV A;  5AWC A;  3RW7 A;  4H09 A;  2O6R A;  2A0Z A;  2OMZ A;  2Z64 A;  5GMF A;  2P1Q B;  4PEQ B;  3W3N A;  4I6J B;  4FDW A;  4R5C A;  1H6U A;  3FXI A;  1OTM A;  4Z94 G;  5FTT B;  4FHO A;  1D0B A;  3WPF A;  4WP6 A;  3RFJ A;  3OGL B;  3ZYJ A;  4RCW A;  4PER A;  1WWL A;  5GS2 B;  4HQ1 A;  1OTO A;  3VQ2 A;  4KXF B;  3WPI A;  4B8C D;  1A9N A;  1KOH A;  2P1O B;  3OGM B;  2Z81 A;  5HZL B;  4GLP A;  5HDH A;  3OJA B;  5CMN A;  3JB9 j;  3O6N A;  4K17 A;  2V9S A;  1XKU A;  4LSA A;  4LXR A;  2JE0 A;  1O6S A;  1XEU A;  3W3M A;  3DZE A;  2WQV A;  2JE1 A;  4UFR A;  2Z63 A;  3RIZ A;  5IJC A;  3C6P B;  2Q4G W;  1DFJ I;  4MN8 B;  2AST B;  4Y61 B;  3RGX A;  4KT1 A;  5GQR K;  4AY9 X;  3WPD A;  2WQW A;  4RCA B;  4R6G A;  3SB4 A;  1OOK G;  3CVR A;  4ECN A;  3G3B A;  3UL7 A;  2CA6 A;  5IJB A;  3CIY A;  4FCG A;  1LTX A;  5IJD A;  1YRG A;  4AW4 A;  2O6Q A;  3W3G A;  3E3Z A;  4EZG A;  4V2C A;  3A79 B;  1OTN A;  1K5G C;  1DS9 A;  4R6F A;  4R58 A;  3ULU A;  4NKG A;  4Q62 A;  1DCE A;  1M0Z A;  4LI2 A;  1Z7X W;  4NZT M;  2IFG A;  1QYY A;  3BZ5 A;  1OZN A;  3G04 C;  3ZYO A;  1IO0 A;  4U09 A;  4YEB B;  3CIG A;  1O6V A;  3C6N B;  4CNC A;  1FT8 A;  2OMY A;  4R5D A;  1W8A A;  4Z8G A;  2ASS B;  3M18 A;  4CIL A;  5AWD A;  3ZYI A;  3TSR E;  3ZYN A;  3E6J A;  4FMZ A;  4IM6 A;  4XOS A;  4U06 A;  2OMU A;  1P8V A;  3UN9 A;  4BV4 R;  5AWB A;  4Q3I A;  4PSJ A;  4ARN A;  5B0N A;  4NKH A;  2Z62 A;  3O53 A;  1FO1 A;  1XWD C;  1U0N D;  2WQU A;  4LSC A;  4R0A A;  4LXS A;  2Z82 A;  3C6O B;  4Q3G A;  1M9L A;  4Z79 A;  4TZH A;  1XEC A;  3PMH G;  3W3K A;  1ZIW A;  4R6J A;  1P8T A;  5B4P A;  4ECO A;  1M9S A;  3G39 A;  3G3A A;  3WPE A;  2ID5 A;  3E4G A;  4M7E C;  5AWA A;  4NZR M;  2Z7X A;  3WPG A;  4Z61 C;  5GMG A;  1KOO A;  2UZY A;  2P1P B;  5CMP A;  2P1N B;  4P8S A;  5GS0 A;  4C2A B;  3G06 A;  4CP6 A;  1XCD A;  4OQT A;  1P9A G;  4KNG A;  4U08 A;  3W3L A;  4BSU A;  2P1M B;  3RFS A;  3OGK B;  3VQ1 A;  4QXE A;  4FS7 A; 
#chains in the Genus database with same CATH homology
 1G9U A;  2R9U A;  4LI1 A;  3WPH A;  4XSQ A;  4R08 A;  2WFH A;  4M7E A;  4GT6 A;  4PKI G;  5A5C A;  3RGZ A;  5LFN A;  2XOT A;  2XWT C;  4PQ8 A;  4ARR A;  4Z64 C;  4V2E A;  1FQV A;  4C2B B;  5GMH A;  4FD0 A;  1JL5 A;  1K5D C;  2RR6 A;  2WQX A;  5D3I A;  4CC4 C;  4CNM A;  2RA8 A;  2OMT A;  1PGV A;  4QBZ A;  2OMX A;  3P72 A;  2BEX A;  3RJ0 A;  2ELL A;  3RFE A;  2Z66 A;  3GOZ A;  3M19 A;  2V70 A;  2Z65 A;  3OJA A;  3W3J A;  4RWT C;  1FS2 A;  3WPC A;  4L3A A;  2OMW A;  4BSR A;  3WPB A;  4L3F A;  2JQD A;  4G8A A;  4LSX C;  1SQ0 B;  1H6T A;  4R07 A;  3E2J A;  2UZX A;  2V9T B;  4U7L A;  2BNH A;  5IYX C;  5AZ5 A;  4CC4 A;  2Z7X B;  1A4Y A;  4WYK A;  5B0T A;  4QC0 A;  4XGO A;  4J4L A;  4BSS A;  3KJ4 A;  4J0M A;  3REZ A;  4P91 A;  4V2D A;  3UL9 A;  4R09 A;  4MQW X;  4R6A A;  1GWB A;  4LSX A;  2O6S A;  3ULA A;  1M10 B;  2Y5Q A;  1O6T A;  3ULV A;  3UL8 A;  3WN4 A;  2FT3 A;  1OGQ A;  3RW6 A;  2OMV A;  5AWC A;  3RW7 A;  4H09 A;  2O6R A;  2A0Z A;  2OMZ A;  2Z64 A;  5GMF A;  2P1Q B;  4PEQ B;  3W3N A;  4I6J B;  4FDW A;  4R5C A;  1H6U A;  3FXI A;  1OTM A;  4Z94 G;  5FTT B;  4FHO A;  1D0B A;  3WPF A;  4WP6 A;  3RFJ A;  3OGL B;  3ZYJ A;  4RCW A;  4PER A;  1WWL A;  5GS2 B;  4HQ1 A;  1OTO A;  3VQ2 A;  4KXF B;  3WPI A;  4B8C D;  1A9N A;  1KOH A;  2P1O B;  3OGM B;  2Z81 A;  5HZL B;  4GLP A;  5HDH A;  3OJA B;  5CMN A;  3JB9 j;  3O6N A;  4K17 A;  2V9S A;  1XKU A;  4LSA A;  4LXR A;  2JE0 A;  1O6S A;  1XEU A;  3W3M A;  3DZE A;  2WQV A;  2JE1 A;  4UFR A;  2Z63 A;  3RIZ A;  5IJC A;  3C6P B;  2Q4G W;  1DFJ I;  4MN8 B;  2AST B;  4Y61 B;  3RGX A;  4KT1 A;  5GQR K;  4AY9 X;  3WPD A;  2WQW A;  4RCA B;  4R6G A;  3SB4 A;  1OOK G;  3CVR A;  4ECN A;  3G3B A;  3UL7 A;  2CA6 A;  5IJB A;  3CIY A;  4FCG A;  1LTX A;  5IJD A;  1YRG A;  4AW4 A;  2O6Q A;  3W3G A;  3E3Z A;  4EZG A;  4V2C A;  3A79 B;  1OTN A;  1K5G C;  1DS9 A;  4R6F A;  4R58 A;  3ULU A;  4NKG A;  4Q62 A;  1DCE A;  1M0Z A;  4LI2 A;  1Z7X W;  2IFG A;  1QYY A;  3BZ5 A;  1OZN A;  3G04 C;  3ZYO A;  1IO0 A;  4U09 A;  4YEB B;  3CIG A;  1O6V A;  3C6N B;  4CNC A;  1FT8 A;  2OMY A;  4R5D A;  1W8A A;  4Z8G A;  2ASS B;  3M18 A;  4CIL A;  5AWD A;  3ZYI A;  3TSR E;  3ZYN A;  3E6J A;  4FMZ A;  4IM6 A;  4XOS A;  4U06 A;  2OMU A;  1P8V A;  3UN9 A;  4BV4 R;  5AWB A;  4Q3I A;  4PSJ A;  4ARN A;  5B0N A;  4NKH A;  2Z62 A;  3O53 A;  1FO1 A;  1XWD C;  1U0N D;  2WQU A;  4LSC A;  4R0A A;  4LXS A;  2Z82 A;  3C6O B;  4Q3G A;  1M9L A;  4Z79 A;  4TZH A;  1XEC A;  3PMH G;  3W3K A;  1ZIW A;  4R6J A;  1P8T A;  5B4P A;  4ECO A;  1M9S A;  3G39 A;  3G3A A;  3WPE A;  2ID5 A;  3E4G A;  4M7E C;  5AWA A;  2Z7X A;  3WPG A;  4Z61 C;  5GMG A;  1KOO A;  2UZY A;  2P1P B;  5CMP A;  2P1N B;  4P8S A;  5GS0 A;  4C2A B;  3G06 A;  4CP6 A;  1XCD A;  4OQT A;  1P9A G;  4KNG A;  4U08 A;  3W3L A;  4BSU A;  2P1M B;  3RFS A;  3OGK B;  3VQ1 A;  4QXE A;  4FS7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...