4Q3GA

Structure of the osserk2 leucine rich repeat extracellular domain
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
219
structure length
219
Chain Sequence
DLNTEGDALYSLRQSLKDANNVLQSWDPTLVNPCTWFHVTCNPDNSVIRVDLGNAQLSGALVPQLGQLKNLQYLELYSNNISGTIPNELGNLTNLVSLDLYLNNFTGFIPETLGQLYKLRFLRLNNNSLSGSIPKSLTNITTLQELALDTNQLKSVPDGIFDRLTSLQKIWLHTNPWDCSCPRIDYLSRWLNKNSQKEQGSAKCSGSGKPVRSIICPTS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords OsSERK2
publication title Structure of the OsSERK2 leucine-rich repeat extracellular domain.
pubmed doi rcsb
source organism Oryza sativa
total genus 62
structure length 219
sequence length 219
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00560 LRR_1 Leucine Rich Repeat
A PF13855 LRR_8 Leucine rich repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 4q3gA00
3WPDA 4HQ1A 3G06A 5A5CA 4YEBB 5AWBA 3G04C 2ASSB 4XSQA 2V9SA 4U7LA 4M7EC 2P1QB 2XOTA 4U08A 2Q4GW 3O53A 4R0AA 3E4GA 3OGKB 4P8SA 2IFGA 4R6JA 2O6QA 4QC0A 4GLPA 4J4LA 2CA6A 4R5DA 2OMVA 3ZYOA 4BSRA 2JE1A 4ARRA 3W3NA 5AZ5A 3M18A 4FDWA 4R09A 4PQ8A 3RIZA 1G9UA 4R08A 4R6FA 3G39A 1XECA 5CMNA 3GOZA 4FS7A 3W3KA 4R07A 4XGOA 1M0ZA 3WPBA 5GMFA 4LI1A 1H6TA 3SB4A 4UFRA 1LTXA 2FT3A 4ECNA 2ELLA 2Z63A 3ZYNA 5LFNA 4NKGA 4RCWA 3UL8A 4Q3IA 5AWAA 4K17A 2Z7XA 3E3ZA 2UZXA 3G3BA 1A9NA 4U06A 2WQUA 1D0BA 1Z7XW 5HZLB 4Z64C 4FD0A 4V2DA 4R58A 1OZNA 3WN4A 3C6NB 4V2CA 3RFEA 2V70A 2OMWA 1O6TA 1DS9A 3TSRE 3RFJA 4L3AA 5IYXC 2BNHA 4R6AA 4OQTA 1K5DC 3REZA 1XEUA 4LSCA 4XOSA 3WPCA 1O6SA 4AY9X 5B0TA 3WPEA 2WQXA 3ZYJA 4R5CA 3UN9A 3WPIA 4NKHA 4MN8B 4RCAB 4FMZA 3W3LA 1ZIWA 1W8AA 2R9UA 2P1NB 3C6OB 4Q3GA 1SQ0B 4GT6A 3RJ0A 4Z61C 4LXRA 4LXSA 3WPGA 3WPHA 1OTNA 2XWTC 3RGZA 1OTOA 4QBZA 4QXEA 3E2JA 5HDHA 2Y5QA 2JE0A 2Z82A 2WQVA 1O6VA 2Z7XB 3M19A 1WWLA 5GMGA 1JL5A 2V9TB 2OMTA 2Z62A 5GS2B 1KOHA 2WFHA 1M9SA 1FS2A 3UL7A 3UL9A 1P9AG 4ARNA 4C2AB 4C2BB 2WQWA 5GS0A 3W3JA 1DCEA 5GMHA 2OMUA 5B0NA 3RFSA 4WYKA 3PMHG 4R6GA 1H6UA 3BZ5A 1IO0A 1M10B 4PSJA 4I6JB 3A79B 4RWTC 4Z94G 1XKUA 4G8AA 2OMXA 4IM6A 3WPFA 3W3MA 3CIGA 4WP6A 2O6RA 1A4YA 1KOOA 4CP6A 2OMYA 3CIYA 1PGVA 4CNMA 5GQRK 4CC4A 4Y61B 3RW7A 2Z65A 5B4PA 3ZYIA 2ID5A 4Q62A 5FTTB 4H09A 3VQ2A 4FHOA 4LI2A 4MQWX 4U09A 1OGQA 3O6NA 4LSXC 4Z79A 2P1OB 5AWDA 4KT1A 4PEQB 4EZGA 1QYYA 3OJAA 4TZHA 2ASTB 2P1MB 2JQDA 3VQ1A 3RGXA 4BV4R 3ULVA 3W3GA 3FXIA 3OGMB 4CILA 1K5GC 4PERA 3KJ4A 3CVRA 4P91A 1FO1A 4V2EA 4KNGA 4L3FA 4CC4C 3DZEA 1P8TA 1OOKG 5CMPA 3OGLB 2RR6A 5IJBA 3ULUA 2BEXA 5AWCA 4KXFB 1YRGA 4Z8GA 1FT8A 4ECOA 2Z64A 1M9LA 2Z66A 4B8CD 1FQVA 3RW6A 3JB9j 1U0ND 5IJDA 2Z81A 2A0ZA 4FCGA 4M7EA 1XCDA 2P1PB 4BSSA 2O6SA 2RA8A 4LSXA 3C6PB 3G3AA 1GWBA 3E6JA 5IJCA 1OTMA 1XWDC 4LSAA 4AW4A 4J0MA 2UZYA 5D3IA 3ULAA 1P8VA 3P72A 1DFJI 3OJAB 2OMZA 4BSUA 4PKIG 4CNCA
chains in the Genus database with same CATH superfamily
3WPDA 4HQ1A 3G06A 5A5CA 4YEBB 5AWBA 3G04C 2ASSB 4XSQA 2V9SA 4U7LA 4M7EC 2P1QB 2XOTA 4U08A 2Q4GW 3O53A 4R0AA 3E4GA 3OGKB 4P8SA 2IFGA 4R6JA 2O6QA 4QC0A 4GLPA 4J4LA 2CA6A 4R5DA 2OMVA 3ZYOA 4BSRA 2JE1A 4ARRA 3W3NA 5AZ5A 3M18A 4FDWA 4R09A 4PQ8A 3RIZA 1G9UA 4R08A 4R6FA 3G39A 1XECA 5CMNA 3GOZA 4FS7A 3W3KA 4R07A 4XGOA 1M0ZA 3WPBA 5GMFA 4LI1A 1H6TA 3SB4A 4UFRA 1LTXA 2FT3A 4ECNA 2ELLA 2Z63A 3ZYNA 5LFNA 4NKGA 4RCWA 3UL8A 4Q3IA 5AWAA 4K17A 2Z7XA 3E3ZA 2UZXA 3G3BA 1A9NA 4U06A 2WQUA 1D0BA 1Z7XW 5HZLB 4Z64C 4FD0A 4V2DA 4R58A 1OZNA 3WN4A 3C6NB 4V2CA 3RFEA 2V70A 2OMWA 1O6TA 1DS9A 3TSRE 3RFJA 4L3AA 5IYXC 2BNHA 4R6AA 4OQTA 1K5DC 3REZA 1XEUA 4LSCA 4XOSA 3WPCA 1O6SA 4AY9X 5B0TA 3WPEA 2WQXA 3ZYJA 4R5CA 3UN9A 3WPIA 4NKHA 4MN8B 4RCAB 4FMZA 3W3LA 1ZIWA 1W8AA 2R9UA 2P1NB 3C6OB 4Q3GA 1SQ0B 4GT6A 3RJ0A 4Z61C 4LXRA 4LXSA 3WPGA 3WPHA 1OTNA 2XWTC 3RGZA 1OTOA 4QBZA 4QXEA 3E2JA 5HDHA 2Y5QA 2JE0A 2Z82A 2WQVA 1O6VA 2Z7XB 3M19A 1WWLA 5GMGA 1JL5A 2V9TB 2OMTA 2Z62A 5GS2B 1KOHA 2WFHA 1M9SA 1FS2A 3UL7A 3UL9A 1P9AG 4ARNA 4C2AB 4C2BB 2WQWA 5GS0A 3W3JA 1DCEA 5GMHA 2OMUA 5B0NA 3RFSA 4WYKA 3PMHG 4NZRM 4R6GA 1H6UA 3BZ5A 1IO0A 1M10B 4PSJA 4I6JB 3A79B 4RWTC 4Z94G 1XKUA 4G8AA 2OMXA 4IM6A 3WPFA 3W3MA 3CIGA 4WP6A 2O6RA 1A4YA 1KOOA 4CP6A 2OMYA 3CIYA 1PGVA 4CNMA 5GQRK 4CC4A 4Y61B 3RW7A 2Z65A 5B4PA 3ZYIA 2ID5A 4Q62A 5FTTB 4H09A 3VQ2A 4FHOA 4LI2A 4MQWX 4U09A 1OGQA 3O6NA 4LSXC 4Z79A 2P1OB 5AWDA 4KT1A 4PEQB 4EZGA 1QYYA 3OJAA 4TZHA 2ASTB 2P1MB 2JQDA 3VQ1A 3RGXA 4BV4R 3ULVA 3W3GA 3FXIA 3OGMB 4CILA 1K5GC 4PERA 3KJ4A 3CVRA 4P91A 1FO1A 4V2EA 4KNGA 4L3FA 4CC4C 3DZEA 1P8TA 1OOKG 5CMPA 3OGLB 2RR6A 5IJBA 3ULUA 2BEXA 5AWCA 4KXFB 1YRGA 4Z8GA 1FT8A 4ECOA 2Z64A 1M9LA 2Z66A 4B8CD 1FQVA 3RW6A 4NZTM 3JB9j 1U0ND 5IJDA 2Z81A 2A0ZA 4FCGA 4M7EA 1XCDA 2P1PB 4BSSA 2O6SA 2RA8A 4LSXA 3C6PB 3G3AA 1GWBA 3E6JA 5IJCA 1OTMA 1XWDC 4LSAA 4AW4A 4J0MA 2UZYA 5D3IA 3ULAA 1P8VA 3P72A 1DFJI 3OJAB 2OMZA 4BSUA 4PKIG 4CNCA
chains in the Genus database with same CATH topology
3WPDA 4HQ1A 3G06A 5A5CA 4YEBB 5AWBA 3G04C 2ASSB 4XSQA 2V9SA 4U7LA 4M7EC 2P1QB 2XOTA 4U08A 2Q4GW 3O53A 4R0AA 3E4GA 3OGKB 4P8SA 2IFGA 4R6JA 2O6QA 4QC0A 4GLPA 4J4LA 2CA6A 4R5DA 2OMVA 3ZYOA 4BSRA 2JE1A 4ARRA 3W3NA 5AZ5A 3M18A 4FDWA 4R09A 4PQ8A 3RIZA 1G9UA 4R08A 4R6FA 3G39A 1XECA 5CMNA 3GOZA 4FS7A 3W3KA 4R07A 4XGOA 1M0ZA 3WPBA 5GMFA 4LI1A 1H6TA 3SB4A 4UFRA 1LTXA 2FT3A 4ECNA 2ELLA 2Z63A 3ZYNA 5LFNA 4NKGA 4RCWA 3UL8A 4Q3IA 5AWAA 4K17A 2Z7XA 3E3ZA 2UZXA 3G3BA 1A9NA 4U06A 2WQUA 1D0BA 1Z7XW 5HZLB 4Z64C 4FD0A 4V2DA 4R58A 1OZNA 3WN4A 3C6NB 4V2CA 3RFEA 2V70A 2OMWA 1O6TA 1DS9A 3TSRE 3RFJA 4L3AA 5IYXC 2BNHA 4R6AA 4OQTA 1K5DC 3REZA 1XEUA 4LSCA 4XOSA 3WPCA 1O6SA 4AY9X 5B0TA 3WPEA 2WQXA 3ZYJA 4R5CA 3UN9A 3WPIA 4NKHA 4MN8B 4RCAB 4FMZA 3W3LA 1ZIWA 1W8AA 2R9UA 2P1NB 3C6OB 4Q3GA 1SQ0B 4GT6A 3RJ0A 4Z61C 4LXRA 4LXSA 3WPGA 3WPHA 1OTNA 2XWTC 3RGZA 1OTOA 4QBZA 4QXEA 3E2JA 5HDHA 2Y5QA 2JE0A 2Z82A 2WQVA 1O6VA 2Z7XB 3M19A 1WWLA 5GMGA 1JL5A 2V9TB 2OMTA 2Z62A 5GS2B 1KOHA 2WFHA 1M9SA 1FS2A 3UL7A 3UL9A 1P9AG 4ARNA 4C2AB 4C2BB 2WQWA 5GS0A 3W3JA 1DCEA 5GMHA 2OMUA 5B0NA 3RFSA 4WYKA 3PMHG 4R6GA 1H6UA 3BZ5A 1IO0A 1M10B 4PSJA 4I6JB 3A79B 4RWTC 4Z94G 1XKUA 4G8AA 2OMXA 4IM6A 3WPFA 3W3MA 3CIGA 4WP6A 2O6RA 1A4YA 1KOOA 4CP6A 2OMYA 3CIYA 1PGVA 4CNMA 5GQRK 4CC4A 4Y61B 3RW7A 2Z65A 5B4PA 3ZYIA 2ID5A 4Q62A 5FTTB 4H09A 3VQ2A 4FHOA 4LI2A 4MQWX 4U09A 1OGQA 3O6NA 4LSXC 4Z79A 2P1OB 5AWDA 4KT1A 4PEQB 4EZGA 1QYYA 3OJAA 4TZHA 2ASTB 2P1MB 2JQDA 3VQ1A 3RGXA 4BV4R 3ULVA 3W3GA 3FXIA 3OGMB 4CILA 1K5GC 4PERA 3KJ4A 3CVRA 4P91A 1FO1A 4V2EA 4KNGA 4L3FA 4CC4C 3DZEA 1P8TA 1OOKG 5CMPA 3OGLB 2RR6A 5IJBA 3ULUA 2BEXA 5AWCA 4KXFB 1YRGA 4Z8GA 1FT8A 4ECOA 2Z64A 1M9LA 2Z66A 4B8CD 1FQVA 3RW6A 3JB9j 1U0ND 5IJDA 2Z81A 2A0ZA 4FCGA 4M7EA 1XCDA 2P1PB 4BSSA 2O6SA 2RA8A 4LSXA 3C6PB 3G3AA 1GWBA 3E6JA 5IJCA 1OTMA 1XWDC 4LSAA 4AW4A 4J0MA 2UZYA 5D3IA 3ULAA 1P8VA 3P72A 1DFJI 3OJAB 2OMZA 4BSUA 4PKIG 4CNCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WPD A;  4HQ1 A;  3G06 A;  5A5C A;  4YEB B;  5AWB A;  3G04 C;  2ASS B;  4XSQ A;  2V9S A;  4U7L A;  4M7E C;  2P1Q B;  2XOT A;  4U08 A;  2Q4G W;  3O53 A;  4R0A A;  3E4G A;  3OGK B;  4P8S A;  2IFG A;  4R6J A;  2O6Q A;  4QC0 A;  4GLP A;  4J4L A;  2CA6 A;  4R5D A;  2OMV A;  3ZYO A;  4BSR A;  2JE1 A;  4ARR A;  3W3N A;  5AZ5 A;  3M18 A;  4FDW A;  4R09 A;  4PQ8 A;  3RIZ A;  1G9U A;  4R08 A;  4R6F A;  3G39 A;  1XEC A;  5CMN A;  3GOZ A;  4FS7 A;  3W3K A;  4R07 A;  4XGO A;  1M0Z A;  3WPB A;  5GMF A;  4LI1 A;  1H6T A;  3SB4 A;  4UFR A;  1LTX A;  2FT3 A;  4ECN A;  2ELL A;  2Z63 A;  3ZYN A;  5LFN A;  4NKG A;  4RCW A;  3UL8 A;  4Q3I A;  5AWA A;  4K17 A;  2Z7X A;  3E3Z A;  2UZX A;  3G3B A;  1A9N A;  4U06 A;  2WQU A;  1D0B A;  1Z7X W;  5HZL B;  4Z64 C;  4FD0 A;  4V2D A;  4R58 A;  1OZN A;  3WN4 A;  3C6N B;  4V2C A;  3RFE A;  2V70 A;  2OMW A;  1O6T A;  1DS9 A;  3TSR E;  3RFJ A;  4L3A A;  5IYX C;  2BNH A;  4R6A A;  4OQT A;  1K5D C;  3REZ A;  1XEU A;  4LSC A;  4XOS A;  3WPC A;  1O6S A;  4AY9 X;  5B0T A;  3WPE A;  2WQX A;  3ZYJ A;  4R5C A;  3UN9 A;  3WPI A;  4NKH A;  4MN8 B;  4RCA B;  4FMZ A;  3W3L A;  1ZIW A;  1W8A A;  2R9U A;  2P1N B;  3C6O B;  4Q3G A;  1SQ0 B;  4GT6 A;  3RJ0 A;  4Z61 C;  4LXR A;  4LXS A;  3WPG A;  3WPH A;  1OTN A;  2XWT C;  3RGZ A;  1OTO A;  4QBZ A;  4QXE A;  3E2J A;  5HDH A;  2Y5Q A;  2JE0 A;  2Z82 A;  2WQV A;  1O6V A;  2Z7X B;  3M19 A;  1WWL A;  5GMG A;  1JL5 A;  2V9T B;  2OMT A;  2Z62 A;  5GS2 B;  1KOH A;  2WFH A;  1M9S A;  1FS2 A;  3UL7 A;  3UL9 A;  1P9A G;  4ARN A;  4C2A B;  4C2B B;  2WQW A;  5GS0 A;  3W3J A;  1DCE A;  5GMH A;  2OMU A;  5B0N A;  3RFS A;  4WYK A;  3PMH G;  4R6G A;  1H6U A;  3BZ5 A;  1IO0 A;  1M10 B;  4PSJ A;  4I6J B;  3A79 B;  4RWT C;  4Z94 G;  1XKU A;  4G8A A;  2OMX A;  4IM6 A;  3WPF A;  3W3M A;  3CIG A;  4WP6 A;  2O6R A;  1A4Y A;  1KOO A;  4CP6 A;  2OMY A;  3CIY A;  1PGV A;  4CNM A;  5GQR K;  4CC4 A;  4Y61 B;  3RW7 A;  2Z65 A;  5B4P A;  3ZYI A;  2ID5 A;  4Q62 A;  5FTT B;  4H09 A;  3VQ2 A;  4FHO A;  4LI2 A;  4MQW X;  4U09 A;  1OGQ A;  3O6N A;  4LSX C;  4Z79 A;  2P1O B;  5AWD A;  4KT1 A;  4PEQ B;  4EZG A;  1QYY A;  3OJA A;  4TZH A;  2AST B;  2P1M B;  2JQD A;  3VQ1 A;  3RGX A;  4BV4 R;  3ULV A;  3W3G A;  3FXI A;  3OGM B;  4CIL A;  1K5G C;  4PER A;  3KJ4 A;  3CVR A;  4P91 A;  1FO1 A;  4V2E A;  4KNG A;  4L3F A;  4CC4 C;  3DZE A;  1P8T A;  1OOK G;  5CMP A;  3OGL B;  2RR6 A;  5IJB A;  3ULU A;  2BEX A;  5AWC A;  4KXF B;  1YRG A;  4Z8G A;  1FT8 A;  4ECO A;  2Z64 A;  1M9L A;  2Z66 A;  4B8C D;  1FQV A;  3RW6 A;  3JB9 j;  1U0N D;  5IJD A;  2Z81 A;  2A0Z A;  4FCG A;  4M7E A;  1XCD A;  2P1P B;  4BSS A;  2O6S A;  2RA8 A;  4LSX A;  3C6P B;  3G3A A;  1GWB A;  3E6J A;  5IJC A;  1OTM A;  1XWD C;  4LSA A;  4AW4 A;  4J0M A;  2UZY A;  5D3I A;  3ULA A;  1P8V A;  3P72 A;  1DFJ I;  3OJA B;  2OMZ A;  4BSU A;  4PKI G;  4CNC A; 
#chains in the Genus database with same CATH topology
 3WPD A;  4HQ1 A;  3G06 A;  5A5C A;  4YEB B;  5AWB A;  3G04 C;  2ASS B;  4XSQ A;  2V9S A;  4U7L A;  4M7E C;  2P1Q B;  2XOT A;  4U08 A;  2Q4G W;  3O53 A;  4R0A A;  3E4G A;  3OGK B;  4P8S A;  2IFG A;  4R6J A;  2O6Q A;  4QC0 A;  4GLP A;  4J4L A;  2CA6 A;  4R5D A;  2OMV A;  3ZYO A;  4BSR A;  2JE1 A;  4ARR A;  3W3N A;  5AZ5 A;  3M18 A;  4FDW A;  4R09 A;  4PQ8 A;  3RIZ A;  1G9U A;  4R08 A;  4R6F A;  3G39 A;  1XEC A;  5CMN A;  3GOZ A;  4FS7 A;  3W3K A;  4R07 A;  4XGO A;  1M0Z A;  3WPB A;  5GMF A;  4LI1 A;  1H6T A;  3SB4 A;  4UFR A;  1LTX A;  2FT3 A;  4ECN A;  2ELL A;  2Z63 A;  3ZYN A;  5LFN A;  4NKG A;  4RCW A;  3UL8 A;  4Q3I A;  5AWA A;  4K17 A;  2Z7X A;  3E3Z A;  2UZX A;  3G3B A;  1A9N A;  4U06 A;  2WQU A;  1D0B A;  1Z7X W;  5HZL B;  4Z64 C;  4FD0 A;  4V2D A;  4R58 A;  1OZN A;  3WN4 A;  3C6N B;  4V2C A;  3RFE A;  2V70 A;  2OMW A;  1O6T A;  1DS9 A;  3TSR E;  3RFJ A;  4L3A A;  5IYX C;  2BNH A;  4R6A A;  4OQT A;  1K5D C;  3REZ A;  1XEU A;  4LSC A;  4XOS A;  3WPC A;  1O6S A;  4AY9 X;  5B0T A;  3WPE A;  2WQX A;  3ZYJ A;  4R5C A;  3UN9 A;  3WPI A;  4NKH A;  4MN8 B;  4RCA B;  4FMZ A;  3W3L A;  1ZIW A;  1W8A A;  2R9U A;  2P1N B;  3C6O B;  4Q3G A;  1SQ0 B;  4GT6 A;  3RJ0 A;  4Z61 C;  4LXR A;  4LXS A;  3WPG A;  3WPH A;  1OTN A;  2XWT C;  3RGZ A;  1OTO A;  4QBZ A;  4QXE A;  3E2J A;  5HDH A;  2Y5Q A;  2JE0 A;  2Z82 A;  2WQV A;  1O6V A;  2Z7X B;  3M19 A;  1WWL A;  5GMG A;  1JL5 A;  2V9T B;  2OMT A;  2Z62 A;  5GS2 B;  1KOH A;  2WFH A;  1M9S A;  1FS2 A;  3UL7 A;  3UL9 A;  1P9A G;  4ARN A;  4C2A B;  4C2B B;  2WQW A;  5GS0 A;  3W3J A;  1DCE A;  5GMH A;  2OMU A;  5B0N A;  3RFS A;  4WYK A;  3PMH G;  4NZR M;  4R6G A;  1H6U A;  3BZ5 A;  1IO0 A;  1M10 B;  4PSJ A;  4I6J B;  3A79 B;  4RWT C;  4Z94 G;  1XKU A;  4G8A A;  2OMX A;  4IM6 A;  3WPF A;  3W3M A;  3CIG A;  4WP6 A;  2O6R A;  1A4Y A;  1KOO A;  4CP6 A;  2OMY A;  3CIY A;  1PGV A;  4CNM A;  5GQR K;  4CC4 A;  4Y61 B;  3RW7 A;  2Z65 A;  5B4P A;  3ZYI A;  2ID5 A;  4Q62 A;  5FTT B;  4H09 A;  3VQ2 A;  4FHO A;  4LI2 A;  4MQW X;  4U09 A;  1OGQ A;  3O6N A;  4LSX C;  4Z79 A;  2P1O B;  5AWD A;  4KT1 A;  4PEQ B;  4EZG A;  1QYY A;  3OJA A;  4TZH A;  2AST B;  2P1M B;  2JQD A;  3VQ1 A;  3RGX A;  4BV4 R;  3ULV A;  3W3G A;  3FXI A;  3OGM B;  4CIL A;  1K5G C;  4PER A;  3KJ4 A;  3CVR A;  4P91 A;  1FO1 A;  4V2E A;  4KNG A;  4L3F A;  4CC4 C;  3DZE A;  1P8T A;  1OOK G;  5CMP A;  3OGL B;  2RR6 A;  5IJB A;  3ULU A;  2BEX A;  5AWC A;  4KXF B;  1YRG A;  4Z8G A;  1FT8 A;  4ECO A;  2Z64 A;  1M9L A;  2Z66 A;  4B8C D;  1FQV A;  3RW6 A;  4NZT M;  3JB9 j;  1U0N D;  5IJD A;  2Z81 A;  2A0Z A;  4FCG A;  4M7E A;  1XCD A;  2P1P B;  4BSS A;  2O6S A;  2RA8 A;  4LSX A;  3C6P B;  3G3A A;  1GWB A;  3E6J A;  5IJC A;  1OTM A;  1XWD C;  4LSA A;  4AW4 A;  4J0M A;  2UZY A;  5D3I A;  3ULA A;  1P8V A;  3P72 A;  1DFJ I;  3OJA B;  2OMZ A;  4BSU A;  4PKI G;  4CNC A; 
#chains in the Genus database with same CATH homology
 3WPD A;  4HQ1 A;  3G06 A;  5A5C A;  4YEB B;  5AWB A;  3G04 C;  2ASS B;  4XSQ A;  2V9S A;  4U7L A;  4M7E C;  2P1Q B;  2XOT A;  4U08 A;  2Q4G W;  3O53 A;  4R0A A;  3E4G A;  3OGK B;  4P8S A;  2IFG A;  4R6J A;  2O6Q A;  4QC0 A;  4GLP A;  4J4L A;  2CA6 A;  4R5D A;  2OMV A;  3ZYO A;  4BSR A;  2JE1 A;  4ARR A;  3W3N A;  5AZ5 A;  3M18 A;  4FDW A;  4R09 A;  4PQ8 A;  3RIZ A;  1G9U A;  4R08 A;  4R6F A;  3G39 A;  1XEC A;  5CMN A;  3GOZ A;  4FS7 A;  3W3K A;  4R07 A;  4XGO A;  1M0Z A;  3WPB A;  5GMF A;  4LI1 A;  1H6T A;  3SB4 A;  4UFR A;  1LTX A;  2FT3 A;  4ECN A;  2ELL A;  2Z63 A;  3ZYN A;  5LFN A;  4NKG A;  4RCW A;  3UL8 A;  4Q3I A;  5AWA A;  4K17 A;  2Z7X A;  3E3Z A;  2UZX A;  3G3B A;  1A9N A;  4U06 A;  2WQU A;  1D0B A;  1Z7X W;  5HZL B;  4Z64 C;  4FD0 A;  4V2D A;  4R58 A;  1OZN A;  3WN4 A;  3C6N B;  4V2C A;  3RFE A;  2V70 A;  2OMW A;  1O6T A;  1DS9 A;  3TSR E;  3RFJ A;  4L3A A;  5IYX C;  2BNH A;  4R6A A;  4OQT A;  1K5D C;  3REZ A;  1XEU A;  4LSC A;  4XOS A;  3WPC A;  1O6S A;  4AY9 X;  5B0T A;  3WPE A;  2WQX A;  3ZYJ A;  4R5C A;  3UN9 A;  3WPI A;  4NKH A;  4MN8 B;  4RCA B;  4FMZ A;  3W3L A;  1ZIW A;  1W8A A;  2R9U A;  2P1N B;  3C6O B;  4Q3G A;  1SQ0 B;  4GT6 A;  3RJ0 A;  4Z61 C;  4LXR A;  4LXS A;  3WPG A;  3WPH A;  1OTN A;  2XWT C;  3RGZ A;  1OTO A;  4QBZ A;  4QXE A;  3E2J A;  5HDH A;  2Y5Q A;  2JE0 A;  2Z82 A;  2WQV A;  1O6V A;  2Z7X B;  3M19 A;  1WWL A;  5GMG A;  1JL5 A;  2V9T B;  2OMT A;  2Z62 A;  5GS2 B;  1KOH A;  2WFH A;  1M9S A;  1FS2 A;  3UL7 A;  3UL9 A;  1P9A G;  4ARN A;  4C2A B;  4C2B B;  2WQW A;  5GS0 A;  3W3J A;  1DCE A;  5GMH A;  2OMU A;  5B0N A;  3RFS A;  4WYK A;  3PMH G;  4R6G A;  1H6U A;  3BZ5 A;  1IO0 A;  1M10 B;  4PSJ A;  4I6J B;  3A79 B;  4RWT C;  4Z94 G;  1XKU A;  4G8A A;  2OMX A;  4IM6 A;  3WPF A;  3W3M A;  3CIG A;  4WP6 A;  2O6R A;  1A4Y A;  1KOO A;  4CP6 A;  2OMY A;  3CIY A;  1PGV A;  4CNM A;  5GQR K;  4CC4 A;  4Y61 B;  3RW7 A;  2Z65 A;  5B4P A;  3ZYI A;  2ID5 A;  4Q62 A;  5FTT B;  4H09 A;  3VQ2 A;  4FHO A;  4LI2 A;  4MQW X;  4U09 A;  1OGQ A;  3O6N A;  4LSX C;  4Z79 A;  2P1O B;  5AWD A;  4KT1 A;  4PEQ B;  4EZG A;  1QYY A;  3OJA A;  4TZH A;  2AST B;  2P1M B;  2JQD A;  3VQ1 A;  3RGX A;  4BV4 R;  3ULV A;  3W3G A;  3FXI A;  3OGM B;  4CIL A;  1K5G C;  4PER A;  3KJ4 A;  3CVR A;  4P91 A;  1FO1 A;  4V2E A;  4KNG A;  4L3F A;  4CC4 C;  3DZE A;  1P8T A;  1OOK G;  5CMP A;  3OGL B;  2RR6 A;  5IJB A;  3ULU A;  2BEX A;  5AWC A;  4KXF B;  1YRG A;  4Z8G A;  1FT8 A;  4ECO A;  2Z64 A;  1M9L A;  2Z66 A;  4B8C D;  1FQV A;  3RW6 A;  3JB9 j;  1U0N D;  5IJD A;  2Z81 A;  2A0Z A;  4FCG A;  4M7E A;  1XCD A;  2P1P B;  4BSS A;  2O6S A;  2RA8 A;  4LSX A;  3C6P B;  3G3A A;  1GWB A;  3E6J A;  5IJC A;  1OTM A;  1XWD C;  4LSA A;  4AW4 A;  4J0M A;  2UZY A;  5D3I A;  3ULA A;  1P8V A;  3P72 A;  1DFJ I;  3OJA B;  2OMZ A;  4BSU A;  4PKI G;  4CNC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...