4FDWA

Crystal structure of a putative cell surface protein (bacova_01565) from bacteroides ovatus atcc 8483 at 2.05 a resolution
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
381
structure length
381
Chain Sequence
b'ASLEDFSIEQLPAKTIYALGENIDLTGLNVTGKYDDGKQRPVKVTSEQISGFSSSVPVDKQEVTITIEGKQKSFSVHISPVRVENGVLTEILKGYNEIILPNSVKSIPKDAFRNSQIAKVVLNEGLKSIGDMAFFNSTVQEIVFPSTLEQLKEDIFYYCYNLKKADLSKTKITKLPASTFVYAGIEEVLLPVTLKEIGSQAFLKTSQLKTIEIPENVSTIGQEAFRESGITTVKLPNGVTNIASRAFYYCPELAEVTTYGSTFNDDPEAMIHPYCLEGCPKLARFEIPESIRILGQGLLGGNRKVTQLTIPANVTQINFSAFNNTGIKEVKVEGTTPPQVFEKVWYGFPDDITVIRVPAESVEKYKNANGWRDFTNKITTF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords leucine rich hypothetical protein
publication title Crystal structure of a leucine rich hypothetical protein (BACOVA_01565) from Bacteroides ovatus ATCC 8483 at 2.05 A resolution
rcsb
source organism Bacteroides ovatus
molecule tags Structural genomics, unknown function
total genus 118
structure length 381
sequence length 381
ec nomenclature
pdb deposition date 2012-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07523 Big_3 Bacterial Ig-like domain (group 3)
A PF13306 LRR_5 BspA type Leucine rich repeat region (6 copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.3630 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4fdwA01
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 4fdwA02
4L3AA 1IO0A 2Z64A 4G8AA 4R5DA 5GS0A 4C2AB 4U7LA 2Z7XB 4CC4C 4ARNA 2XWTC 2V70A 4R6AA 4CP6A 1W8AA 4XOSA 5GMFA 3OGLB 4V2DA 3RIZA 4XGOA 2JQDA 4MQWX 4Y61B 1O6TA 3RFSA 3E2JA 4FS7A 4J0MA 4IM6A 4Q62A 4KXFB 3ULVA 1P8VA 4M7EA 3G3AA 4BSRA 3W3GA 1XKUA 4FD0A 4H09A 4LSXA 3UL9A 4R0AA 4WYKA 2WQWA 4RCAB 3C6PB 1K5GC 5B4PA 1YRGA 5CMNA 1A9NA 3RFEA 2Q4GW 5AWAA 5IJDA 4UFRA 4R07A 5D3IA 2O6SA 4LI2A 4R6JA 3RGXA 4QXEA 1OTNA 1DS9A 1K5DC 3WPBA 1FT8A 4R08A 4PQ8A 3CIGA 4FDWA 1Z7XW 3RW6A 4Z94G 2CA6A 2RA8A 4KNGA 3CIYA 5IJCA 1FS2A 4XSQA 4CC4A 1KOHA 4RCWA 5A5CA 1A4YA 4PSJA 3WPDA 1H6TA 3E4GA 4QC0A 1XWDC 4PERA 5CMPA 2XOTA 2JE1A 4Q3GA 3P72A 2OMTA 4ECNA 4I6JB 3UN9A 3BZ5A 4U09A 3ZYJA 2IFGA 1FQVA 1U0ND 4P8SA 5GMHA 2BEXA 1JL5A 1OGQA 4MN8B 4NKHA 5AWDA 2A0ZA 5FTTB 4BV4R 2P1NB 5HZLB 2Z7XA 3G06A 4ECOA 2WQUA 2Z62A 4FMZA 3G04C 1QYYA 4RWTC 5GMGA 2OMYA 3UL8A 3UL7A 1H6UA 1OTMA 4R58A 1M9SA 1FO1A 3WPHA 2ELLA 1P9AG 2ID5A 4AY9X 3OJAA 4ARRA 2V9TB 3SB4A 3O6NA 1GWBA 3KJ4A 3RJ0A 2OMZA 2JE0A 4YEBB 4QBZA 4LXRA 3ZYOA 2ASSB 4Z64C 4CNCA 4OQTA 4WP6A 1M10B 4R6GA 3ULUA 3WPGA 2OMWA 1M0ZA 2OMXA 3OGKB 3WPCA 3PMHG 1SQ0B 4R6FA 5AWBA 3WPFA 4LXSA 1D0BA 3VQ1A 3WPIA 4L3FA 5IYXC 3M19A 2Y5QA 3TSRE 1ZIWA 2V9SA 4EZGA 4LSAA 4R5CA 4U08A 4Z61C 4LSCA 1DCEA 2R9UA 4HQ1A 2OMVA 1OZNA 2Z82A 1O6SA 2WFHA 5GQRK 2P1PB 3W3LA 3WPEA 4CILA 1DFJI 4KT1A 4NKGA 3VQ2A 3A79B 5HDHA 1PGVA 5B0NA 4PEQB 2O6QA 4GLPA 3M18A 4GT6A 3W3NA 3W3KA 1M9LA 1KOOA 4LI1A 1G9UA 5GS2B 4B8CD 3ZYNA 4Z8GA 1O6VA 2OMUA 4Q3IA 2WQXA 4K17A 4C2BB 3RGZA 3OJAB 2O6RA 2BNHA 3W3JA 2P1OB 3E3ZA 4J4LA 3O53A 4V2CA 3E6JA 3C6NB 4BSSA 5AZ5A 3DZEA 4V2EA 2UZXA 3G39A 4CNMA 3RW7A 5AWCA 4FHOA 4FCGA 2UZYA 3JB9j 3ZYIA 4M7EC 2FT3A 1OTOA 3GOZA 4U06A 2Z65A 4AW4A 3W3MA 3CVRA 2RR6A 2Z66A 1OOKG 4LSXC 2Z63A 5LFNA 1LTXA 4TZHA 1P8TA 2P1MB 1XECA 4R09A 3C6OB 2P1QB 5B0TA 3RFJA 4BSUA 3G3BA 2ASTB 1XEUA 3OGMB 1WWLA 1XCDA 4PKIG 3ULAA 2Z81A 3WN4A 3FXIA 5IJBA 4P91A 2WQVA 4Z79A 3REZA
chains in the Genus database with same CATH superfamily
2B15A 2P47B 3GI8L 4L3AA 1ZOXA 1V55B 3IETA 3MZTA 4KFMA 4G7YL 4PSRA 3RGHA 3W39B 4CBZA 4HJEA 4R5DA 4MKMA 1I7TA 1QEXA 2HH0H 1YC8A 4JPKL 2HX8A 4MQXD 5CHNB 4HPHA 1RHFA 1RIHH 2Z31A 2A6JB 3GBEA 1AE6H 2IWEA 4IMLB 5DUPL 5IB1A 4BE5A 5C08E 4NO0A 1TJHH 4JM2F 5BVPH 2F7RA 3F12B 4G8IB 4NFDA 1U8OB 2FQDA 2PO6D 5AW0B 5GMFA 1SYSA 1NC2A 1OWWA 2DLEA 2JJWA 3QQXA 5CBAA 2EH7L 2XQYK 1CDIA 5G4NA 3ULVD 3ESVF 4QCIB 4NPYA 3OMAB 4P4KD 3CG8A 3O0RH 1FJ1B 1Z66A 1UOLA 1Z5LB 4PJ5E 3T0ED 5LQBL 1OPOA 3QCTL 3QO1B 4PI0A 3T4AA 4QKTA 1IKNA 2Y5EA 1S7UB 5JIMA 1DJWA 4PN6A 3LZNA 3L1GA 3UTTA 5JMRA 4XX1E 3HPJA 2XG4B 1BD2B 2WLIB 2H0FA 1B0RA 3H9SA 2ZYHA 2F8OA 1VGEL 3NCMA 4FQXB 4PGEB 4X9YA 3WIHH 2A6IB 2JIXB 3VXUB 3UEZA 4AEIL 3MA9H 5F7EL 4HAFA 1A1MA 1O7DC 3MBEB 4NJAL 5KYXB 1E5AA 2WN3A 4UDTB 2DS4A 1R47A 2VR5A 4A6YH 2BXYA 1UXMA 1BGXH 6FABL 5ANHA 4AM0B 2WKLA 4APQA 3BN3B 1ZSHA 4LVOB 3LRSB 2W60A 2Z91B 3MNDA 3RNQA 3IJEA 4AW7A 1AO7A 1MWAL 2NCMA 4IU3A 5ESQA 4Z7NE 2ENQA 4WSGA 3GUTA 1IKOP 2IXQA 4PJBE 2OMXB 4RAHA 3O6MH 1MFAL 3KPTA 4N2DA 4MNGE 2XZCL 1C16B 4DZBA 4JW3A 2H3NA 3DOIA 3U1PA 1IC5L 3IDXH 3H3BC 4Z0BL 2FHFA 4O58L 1MWAA 2KHAA 4NKMA 1OAXL 5D7IE 2AHIA 3MRMA 1F8TH 1MJJB 2A38A 2EKJA 3CLEH 1MLCB 5I6LA 5B38G 2R2HA 2YZ8A 3CFMA 4KZCA 5DUBA 5FW6A 1L5GB 5IGXL 2OM5A 2HN7B 3KR3H 4OLZL 2NY1C 4Z3IA 2QR0B 1DUZA 1JCVA 2GJ6D 2ZPKH 3EXLA 1DQVA 3EBAA 1T0MB 5DJ6B 3I85A 4AWJC 4ZD3H 1DS9A 1D6VL 3ZTDC 2J12B 4NQDE 1NBCA 1I7ZB 1FT8A 1WBYB 5HGDB 4OZFA 5I74B 2B14A 3J7HA 4R08A 4TUJA 2WYZA 5GZNC 4TUUA 4PV9A 1KXTA 1UWEL 1OW0C 3PHQA 5DI8B 3GIZL 4JQVC 1XGYH 4NQCD 4K3EL 4LCCC 5CEYB 2FBJH 3A23A 4W6XB 5DQDH 3D3VA 2MH4A 1JMZA 1JVKA 3CIYA 4JFUA 3MNZB 5JNYB 4FZEH 4UU9A 1NLDL 4AXWA 3BQUB 4KDVA 3DO4A 4AIZB 3RIKA 3SKOA 1IB5A 5K1VA 2BNRB 1QABA 3RDTB 1GPOH 4DUWA 3SGKC 4XNBA 4CAGA 1MHHB 2BSED 1AXTL 4EIUA 3P4OB 1VCBC 3BP4B 4FQLH 5T1KA 3VM5A 3ISWA 5A16A 2PW1B 4XXCC 2QADB 4J4PA 1UM6L 2Y7OA 2HJKA 2PTUA 3B2PA 3B34A 4Y4FD 4EBQL 3N1PC 1A2YA 1FYTD 4ANWA 2X4PB 4NB7A 2EEDA 2UWEB 5F6IC 4G1EB 3SIKA 4JRXA 3Q9QA 5LB1A 7PCYA 3NUKA 2EZ0D 1X9UA 4HH9B 4KU1A 1FNFA 1NICA 4WCYH 1IEAA 2ADIB 1OTTD 4X7DC 3A6CL 3KYOB 4GAGL 3ZE1E 3V0EA 4KC3B 5GMHA 1K5NB 1PMYA 4JZJB 2FEEI 2OMUB 5DZJA 1J8HD 3LHPL 2IQ9H 4FJYA 2QKIA 4YDKH 3WTWA 1GAFL 5FYJD 2RIKA 3FYEB 4FTVA 1OE2A 4NKHA 2Z8RA 4NOFA 3ZHKA 5I1EL 1E9PA 2B1HH 2XPGB 1J5OL 5KSBA 3H85A 1DQDL 3MFGB 4W4OC 4I48A 3U46B 4PJFB 3VX1A 2V2TB 5ALBL 2BHZA 1THAA 3VDAA 1GR7A 4M03A 5E2JA 3RIFF 2EDHA 1T22B 2C26A 2BPBA 1L7IH 2GEEA 1AIFB 4MQTB 3TIEB 1RXLA 4OF0A 2XY1A 2OMYA 2A83A 1H8NA 3MCYA 4LIQH 3FOLB 4BIKA 3UBHA 1FNEB 1P5VB 3OAUH 4KO9A 5SX4I 2OZNA 4R7VA 4R58A 1MCRA 5HYQA 1HINL 2NUPA 3BYTA 4YDNA 3WPHA 2VDNB 4LAQH 3U36A 4J39A 4OGXL 3OJAA 3HHSB 4PS4H 1TLKA 5J57B 4B9FA 4NQED 5K5YA 1V3KA 5M95B 2B59A 2HT3C 1RK1B 4XH2B 3BGMA 5GS1A 1TTFA 2YR3A 3OMZA 3L3HB 4UAHA 1GWBA 1IGML 2IAMA 3DRTB 3LZFH 1T04A 5CU9A 1A64A 3WO4C 4Q8BA 3X17A 2B1OA 2VCOA 2C3HA 1KJMB 1LWHA 4JKLA 2PYEB 4G8EA 3TF4A 5KVDL 1INEL 2WO4A 1B0GA 2XWBA 5EWIH 3RZCD 1FL5B 3MRHA 5EU6E 3B5HA 4YHLL 4KMTH 3DWTA 4MB4A 2ROYA 3W38A 3MRPB 2XRAH 2C3VB 2BP3A 2ATAA 4L29B 1IFHH 1I3UA 1V3JA 3PMHG 3T0VA 4HZLB 5IY5B 5AW8B 2QJDA 2IPKA 4MB3A 1BZDA 3G6AB 4FC3E 4PJDF 5KS9B 1U42A 2J4WH 5H35A 1F58L 1N7MH 1FL6A 3B2DC 1W72B 4NZTL 1IAII 4GSUA 1KENH 2FO4A 2COQA 2X1OA 2DPKA 3L4UA 2VR6A 3MOBH 4RDQF 4D7BA 2A9MH 1PNCA 3FAXA 3HZ3A 4QO1B 3S3CB 1R3JA 2H5UA 3IETB 2PWFA 1XTLA 1U8JA 4PJHA 3TSRE 1I7TB 4YVNA 5IMKA 4IRSA 5EEWA 3PJNA 5IB1B 2HRPL 1IQDA 5D4IA 4JFHD 1I3GH 4NO0B 1ADQH 3WJLC 5EF1A 4GRMA 2ZIDA 4MA7L 4CMHB 1Z9SA 4C4KO 5CGYC 3HNVH 1ZTXE 3OPUA 3DOSA 4DQAA 2CJSA 4EEEA 1DQJA 3ABLB 3MACH 1USZA 5CBAB 1NC2B 1HT6A 2AERT 2ERJC 2X6AA 1G9HA 1X6NA 2KZBA 1W72H 1K3ZA 2IFFL 4HA1A 4KJPC 5FA3A 4KH2A 2EXTA 4OIIL 1ZLEA 3WIFA 1MW3A 2QDVA 3G04A 5DD1H 3T4AB 5E2WH 1JI1A 4PB9L 1T1WA 1L9PA 1JWMA 4MAYA 2X4SA 3UTTB 1FSKB 5C6PB 3HPJB 3DYPA 3QHZH 3PFUA 1IC0A 1B0RB 4YSQA 3H9SB 3C08H 2AFNA 4OGYL 2OFQA 5HDHA 4AZ8A 1CGTA 2N7BA 2VSDA 3CSBA 1PGVA 2EEBA 1A1MB 4YFLI 5D7JC 2QHRL 2WTRA 2AAVA 1JOIA 1RLBA 1N5YH 3HG2A 3P73A 2AF2A 2FR4B 1PJ9A 2EEXA 3C12A 4APQB 1XR8B 4ZFOB 2W60B 3CFDA 3RNQB 3IJEB 1AO7B 5GGRA 4IU3B 9CGTA 4Q0XL 4U05A 5ESQB 4B5EA 1HEHC 1GKEA 2EVIA 3DPBB 4MNQE 3GUTB 2IXQB 1IIKA 3UBXA 1JD7A 3WUWA 3SDXF 4DZBB 5B21A 3TEZA 2GJPA 2ZF9A 3Q1EA 3Q2NA 3P11L 2H3NB 3BEVA 2NY7L 2UUDH 3H7LA 1MPAH 2VIRB 3VXPA 3DPDA 2E8ZA 1S9WA 4MZIA 1MWAB 4ISVA 5HYJA 2Q20A 3MRMB 1BSIA 1IQWL 1DJYA 1VB9A 1F45A 5H37G 5IQMA 2R2HB 2P8MA 5DUBB 3U0PA 3MVSA 3HAEA 3PGFL 2WUCL 2GIXA 2OL3L 4U6VH 3RY4A 1PU0A 1DO6A 4XP9L 1KV7A 4Z5RA 1XSOA 3RAJH 1DUZB 5I71B 2OK0H 4JJ5A 4JZNA 1MXGA 2CCVA 3RQ3A 1AANA 2GSMB 3COOA 3QUXD 2K3HA 3LIUA 3CHRA 4OZFB 4NJAH 2OL3A 4TUJB 3TVMD 1R5IA 2P5WB 3JB9j 3TESA 4M7EC 4PV9B 1KXTB 4YIQB 4WK4B 5F7BA 3PHQB 5E6IC 4E9QA 2JB6A 3FQUA 2FNBA 3BAEH 2C7UA 5IOKA 3PXJA 3AWGA 1JHLH 5DA4A 2NZ9C 1NANI 1SHWA 5FB8A 2XWEA 3B6SA 3D3VB 2RR6A 3MZGB 3HZYA 4NC1C 3VI3A 3RHWK 3S37L 4UU9B 4Z7AA 1OOWA 3C9NA 2LTQC 4AXWB 4U3HA 4IW4C 5HDBF 2FIRT 3SKOB 2ZOKA 4AOFA 1CLVA 1CD1A 4Z0BH 4KY1L 4V11A 4ZXBD 4G6MH 5JUEL 5LDSA 3K46A 3NA9L 3ULUH 1FZKB 3VQMA 3CH1A 3Q8EA 5T1KB 5E2TL 5A16B 5LG1A 5JHDA 1W8OA 2JJUA 2WLKA 2N0MA 4OLZH 3TU6A 1T7WA 5EEXA 1WWLA 1J0KA 2HJKB 1AGBB 3BUPA 1AXSA 3EH2A 4WEBH 1A2YB 5BQ7A 1VFUA 2GT9B 1B2WH 3U1SL 4UAOB 3JWDH 4NFCA 5IJBA 4JRXB 1YPZE 3WJJC 1E3ZA 5G55A 2Q6WA 4DOHE 4L0PB 4P91A 2BMKA 1NLBH 3ZMNA 4GW1A 3V5KB 1IEAB 1JPSL 2APBA 2XTJD 3N50A 4PJEE 2VSKB 5ACLA 3SDDA 1JZ8A 1R3KA 2CDFA 3WD5L 3TV3L 3BH9A 4JVPA 4LP4A 3IRCA 3UP6A 4ENEC 2QKIB 4O4YL 4FTVB 3FN9A 3IFPA 3MRDA 4WHYG 5J6SA 2LLLA 1I9RH 2ITFA 1WD8A 3NTCL 5KSBB 2CUIA 5TDNA 4C2AB 2CA4A 1RJLA 3FTUA 3FMGH 2DI7A 4I48B 4XNUL 5AVYB 4OI7A 3FFCE 1GYCA 1CIDA 1WAAF 4FFWD 5ADOH 4R6AA 4ZUWA 1PQZA 3S3JA 2W0KA 4HD5A 4JO5A 1AXTH 3CXDH 5HPOA 2FJSA 4MXWL 2XZQL 3RL2B 4GYBA 1A3LH 3HKFA 2OMYB 2A83B 3GPSA 3U2IA 1UM6H 4LCWA 3IDYB 5DEGA 1KJ3H 2VSMB 4AH2A 2D7NA 2EICA 4PG9A 3QI9C 4X9BA 4EN3A 4AJWA 4L3EA 3ARVA 3AG1B 5AVTB 3CGTA 3QIBA 5HYQB 3THMH 2JQDA 3LEYL 1O6TA 1OM9A 2NUPB 3ULVE 2IGTA 4N8CL 3ZT5A 3QJTB 4RWYH 1AVAA 1QFWM 3U36B 2BNQA 3BT2L 1NFDF 2B59B 2ZAGA 3A6CH 3EO1A 5T5FH 5IBLC 4ZFGL 4IM6A 1QG3A 3BGMB 2F2HA 5GS1B 3VXNA 4DK5A 4PHZA 1J5IA 1BD2D 2IAMB 1T04B 3TXAA 4FQXD 4X6CF 4NPKA 1KN4L 2HT2C 1B4JH 3OGOE 4PCTA 3VXUD 4I2XB 4DVBA 3MBED 4P46C 2WBKA 1DQLH 3L3KB 4ETQA 4H09A 1O9VA 4FXKA 1B0GB 2DQUL 3MRHB 3JWNE 2BZDA 3T6VA 2H32A 4KK5D 1U8QA 4JGMA 2WNXA 4MHHG 1SMDA 3VMNA 5FCUH 1NCWL 2WLZA 3CZFA 4L5FH 4UOJA 1V7ML 4OD3L 3IVKA 5JQHC 2P80A 3ARUA 5ICUA 2FJGA 3TV8A 1Q9LA 4UQIM 2IPKB 5T5NF 2IAND 2Q4GW 1RUML 3AB0C 2TRHA 4QMEA 2IH1A 4G8FA 5BW7C 4GKNA 2XV2A 4LFHD 4W68A 5H35B 1FL6B 1OCRB 2EH8L 3T4YA 1WWWX 3U7YL 1DJXA 2FO4B 2ZX9A 4TOYL 4OB5H 4OVVA 3V4VH 1JZHA 5KVMC 2O6SA 3OPZH 5CKGA 3S35L 3BUDA 4KHXH 5HGGS 2WXRA 4OGXH 2W9DH 4M3JA 4X0NA 1R3JB 3F6JA 2BWDA 2AJVL 3KDMA 1NM9A 3ARYA 3WPBA 1LXMA 5LJYH 3L16A 1U8JB 5ANMA 1IGMH 4PJHB 4IQHA 4XN1A 1Q0YL 1KB3A 1H0DA 5C7XH 3INUH 3ZDYB 5IMKB 1AS8A 4IRSB 4NM4L 2NXZB 4FDWA 4I3SH 1E3FA 1LO4H 3MJ8A 4GBXC 5FGCB 3CSTA 3W11D 1NIDA 3ARQA 1IQDB 3Q2CA 3EDKA 3LHAA 4DSYA 3QORC 3QJQB 1ONQA 3Q1SL 4P5KA 3U4EA 2G5BA 1NKRA 2IWKA 2RA8A 4GRMB 4UV7H 4JUSA 1Z9SB 1VHPA 4N0CD 2R23A 1IL1A 3DOSB 4M9PA 1DQJB 1CXLA 3P3TA 2NQ3A 2RFXA 2GBTA 5CUSH 4A7TA 4XNYL 2F8IA 3UBGA 4PY7A 4OCRH 1PKQE 1YEHH 3QXAA 5FA3B 4IKKA 3QEQB 4A67A 1MG2C 3WIFB 3G04B 4FXGC 4S1RH 4W9EC 1OGAE 1JWMB 1NGZA 2X4SB 4I7ZC 3RWIA 2XI9A 1BYOA 2BNRD 3OL2A 3RDTD 2P26A 3WFEL 4N6QA 3V0WH 4N8PA 4NFBA 1MFBH 3N85L 3QVAA 4PR5A 4EOWH 4AZ8B 1CICD 4H8VA 4ODVH 4TQHA 3BSZH 4HEME 1XF3B 4WNSA 4A2GA 1BQUA 2WTRB 5DK0A 2AJUH 2CR0A 4P23A 2IG2H 4HKBA 2ADJA 4U1SA 5KW9L 4AE0A 1M7DA 4DT2A 5LNDA 2ZXCA 1FYTE 3L5HA 5EZPA 1S7TA 2AK1H 3A4DA 4K8RD 5I1CL 1N12A 2YPLD 3POHA 1JFQL 2X0WA 4Z7QE 3C2SA 5I23A 1ACYH 4P5MA 3E1ZA 3UBXB 3WUWB 3KPOA 5E9DE 4HCRH 5CJXA 1OP5K 1N5AA 3BEVB 5AWDA 4Y8DC 4WVRA 5CNHA 3MLYL 1IO4C 1WO2A 1CL7I 1HI6A 1MW1A 2IDQA 3F7RA 4ISVB 4PLOB 2Q5BA 1CBVL 3RWCA 3LAFA 1UB6A 4OIIH 4AQEA 2P8MB 3U0PB 5IFAH 3HAEB 5FW8A 1G94A 1HCZA 4HS3A 5CJBA 2AJXL 4NKQB 2QVKA 2VMFA 4A7QA 1WV7T 4Z5RB 4W9DC 4HOXA 5DO2C 2H47C 3S5LA 4JJ5B 4JZNB 4LQFL 4YAQA 4KKBC 2ICCA 2PYFA 4B0MM 1H6UA 4Y1AE 3ME0A 2NW3A 3WTXA 1E90A 1MFVA 3VTMA 2OL3B 3ATAA 5KAQG 1R5IB 4XBPA 3F00A 3GSVA 4PJDA 1DFXA 1OB1A 2DQTL 2JB6B 2VLME 5SWZD 2R7EA 2CRZA 3ZSSA 5EU7C 2C7UB 5AW2B 1JDCA 1D6EA 3A47A 1I1AA 2IV9A 3UC2A 5AW5B 5FB8B 3B6SB 4OQTL 4Y19A 4PJ7A 3HZYB 3VI3B 4MQ7A 4K94C 4RGMB 2XPZA 5T3XL 3GSNL 3C9NB 2X3BA 4BELD 1ZIBA 2JJTA 1A7NH 5EDXA 5LNGA 5CILH 4JHAH 2HX7A 2XIDA 1XCTA 1HWHB 2ZOKB 2VM4A 3T3PF 4KXZH 4P05A 2NY7H 1NCHA 1CD1B 4TUKL 1ZGLA 3VE0B 4GRLA 4PJAF 4OCXH 4PGCA 3SE3A 5I18H 4OQTA 3CZEA 1K4DA 3QPXH 4LXFA 3WTYA 3GSNA 4BM7A 3CH1B 3BZFA 2PYED 3O9WC 4A66A 1ZPUA 2YOAA 3F8UB 3VRIB 5JHDB 4X80L 3CU1A 4NUGL 1IARB 4MS6A 3WIAA 3IDJB 2OP4H 1ND0A 1Z5YD 4XO5A 1MRFH 1AXSB 4J3VA 5BQ7B 2Y23A 1DSFL 3IEAA 5D71L 3WHE1 1Y6MR 2ITEA 4QYAA 4AIOA 5DHVB 5AQ0A 5IT2H 4B9PA 1HHIA 2AITA 5EOQL 3O3AA 2Q6WB 4K9EH 1CF8L 1OCOB 4HK3N 2XT1B 2BMKB 5D8JL 3LPGA 4GW1B 3WNJA 1Z3RA 2PP9A 4ABUA 3HMXL 1E30A 3DBSA 2ENJA 3SDDB 3GO1H 1R3KB 2X0UA 2CDFB 1DBJL 1R3IL 4NGHH 1CGWA 1QZ1A 5TDPB 2B4CH 2DWEA 3ECWA 3VFMA 5F7UA 2UX7A 4KUCD 4HIJA 1CDBA 1SRDA 4P2YA 4YSAA 3LY6A 3WY4A 4N5EC 1MNNA 4G83A 3IFPB 4IMKC 2HRLA 4WFFD 3HMXA 5DGRA 5L4JA 1JD9A 5TDNB 1RJLB 1ROWA 2QEJA 2OV0A 4YDMA 4JFFA 2D03H 2JCCE 4TQ8A 1R5VA 5E2UL 1P7HL 5DR5H 4ZUWB 1PQZB 5I26A 1L6PA 2X87A 1B4LA 4Y89A 2Z31D 3BKYH 4LL9A 2VDLL 5E2TH 5AZUA 4PTTA 5DHVH 5SWQA 3U82B 4JFHE 4F3FA 2K45A 2DM4A 1GS8A 3IFLH 4LCWB 4MDJB 5DEGB 3SDXA 3ZR6A 4CW1A 2WAHA 2XZAH 4KITB 5IROD 4E68A 1FH2A 4PG9B 4EN3B 2OTWA 3S34L 1NC2D 4L3EB 4M1CD 1OD9A 2ZUQB 2VXQL 3Q44A 4QGYA 2FEJA 4GI9A 1GIGL 1BAGA 3N42B 1N59A 4WI7A 5HVGB 3PDOA 5FW7A 4BQBA 1QWNA 2BNQB 3BT0A 2Q2EB 1MJUH 2M26A 3H2QA 3EO1B 4KNTA 2XSKA 4XZUA 2VXQA 2N1KA 3SPGA 3VXNB 3VGDA 5AZEL 3SJVE 2OKMA 2IH3A 1F3RB 3NJNA 4B7IA 3TJPA 2GCYA 5I6KA 4KK8C 3C6LC 2YPVL 4DVBB 1UKQA 4MMZB 5IF0A 3LH9A 5DZLA 2DQEL 1M9LA 4HJ0C 2KLRA 3SE4A 1CXEA 4CSPA 4ETQB 4FXKB 3L8QA 3JTBA 2Y2WA 4XO9A 5DJDA 3O4OB 2H32B 3QCVL 1U8QB 2YQ3A 3EJQA 4IKNA 5A2CA 3QISA 2YPVA 3CC1A 4POZC 4APQD 3RGZA 3K4DA 3CZFB 1PY4A 2KPNA 1HAUA 4M7JH 3IKKA 3BKJH 3IVKB 5J0BA 3NIDF 3L95B 3OSVA 4KI1A 5AVZB 4P9ML 1PDKA 4H2AA 1Q9LB 3OHXB 5F9JA 3QUGA 2KI6A 2CU9A 2IH1B 5GHWL 4G8FB 4GKNB 4JG5A 4M9OA 3CAFA 3T4YB 2B39A 5AZ5A 3HIZA 3KYAA 5AWNL 1R0AH 1HWGB 1NMAL 1MKFA 1IRAY 4H44C 2WINA 3DDGA 4KK9D 1QSFE 4UF7C 4Y9GA 4CNMA 3PXHA 3VFGH 5D1QA 4JRFA 2YC1A 3RW7A 1MVYA 3KDMB 3UTQA 3TS8A 1NCDL 4JCLA 1RIUL 4MJ4A 5ANMB 4B5ZA 2A9NL 1VIWA 3CH8A 1H0DB 4YHZH 2FWOA 5EULV 2WVSA 1OTOA 3MJ8B 2XLLA 4P2RE 2ZCHH 4K5OA 1J1OL 1ONQB 4P5KB 2G5BB 4AEEA 3HFFA 2B1AL 4GIPD 2FT6A 2WNKA 3M8OH 2R23B 1IL1B 2O6FA 2OR7A 1F1GA 3V6ZA 3R0MA 2RFXB 2V5RA 4WJ5A 3ETTA 1TU2B 5TE4L 2D3LA 1J9SA 3FCSA 1FNSL 1W9XA 4TZHA 3QXAB 2PPCA 4FA6A 1P8TA 2YK1L 3KYMA 3CPUA 1XECA 1KTRL 2OYPA 2DDQH 4G80A 2TSAA 5F7DA 4U6YA 3U9PH 1HIML 3RFJA 2APVA 4AYMC 5L4MA 1NGZB 2FBOJ 4G8GA 3RWIB 1T89C 5KOMC 3VFPA 4U7MA 3KS0H 4TOYH 4JJHA 1JF1A 3GJEA 2DWYA 2VTFA 1MHPH 2YBGA 5ECGA 4XPGL 3ULUF 3MCLH 3EKCA 3VFOA 5CCHE 4P23B 1NDGA 1HH9A 2FGZA 4HKBB 2CPCA 2ADJB 4U1SB 1Q0YH 1M7DB 5AKTA 1S9XB 5F9WB 3S5ZA 5HVWA 1S7TB 4XAWH 3VGAB 4KVCL 3GF8A 1QHPA 5IQLA 5I5RA 3D9AL 5C0ND 4MD4B 1RU9H 3MRFB 1NFDA 3IF1A 1ASQA 3MJ9H 2AXFA 2GFBA 2FUQA 4P5MB 2VERN 1P4LB 2AGJH 2Z64A 4G8AA 3KPOB 5D1XA 3LYRA 1ZWIA 1N5AB 4F7TA 2NY3B 1AHMA 3OD3A 1A6VL 4LSUH 4NAQA 4PP2A 2NY0B 1UOWA 4DPBX 4X6CA 1Z2KA 3RWCB 2BSBA 4CSSA 3K71A 2DWDA 3H4HA 2ALAA 5IBUB 1LYQA 4AQEB 2QFPA 4JFXA 4GAAA 4HS3B 3QFDA 5FA4A 4G42A 4G5ZH 4KV5E 4OF6A 3IDUA 4NP9A 1XH3B 3TIDB 4L9LC 3P4NA 4P9HL 1MEXH 3KHQA 3NABL 4YAQB 3S5LB 4N28A 5CR1A 3LQAC 2PYFB 4GQ9L 1MFEH 1X7QA 5I30L 2BRRH 2NW3B 3ME0B 7PAZA 4X4MA 3SDYH 1NH6A 5FFGA 2CBOA 4XBPB 1M05A 3ETBF 3SKMA 2L3BA 3RFSA 4PCSA 4OZHE 3GSVB 4PJDB 3E2JA 1H15B 1OB1B 4M7KH 1BQHA 3DECA 2R7EB 1JBJA 3LVTA 3KYKH 4AMKL 1NIAA 3I9GL 4A39A 3V4UL 2OTUA 1D6EB 4YH6A 1I1AB 5GS2D 3BWAA 3WKML 4J0MA 1MF2L 4N1HB 1P8VA 4PJ7B 35C8H 1QBLH 4R84A 3BKCH 4MQ7B 3BZDA 3UADA 2UY7A 2X0VA 3QZWA 1SNRA 2HXAA 4MQXC 5I75C 4E41E 1U8MA 1XCTB 3DETD 6PCYA 3DBXB 2BFGA 2EQDA 3VQLA 1F00I 3TEWA 1ZGLB 4KI5E 5DJXA 4PJ8B 4GRLB 2JE8A 5F7MC 1RVFH 4PGCB 3MBXL 4WI5A 3WFBL 5KVGL 1A9VA 4J3OH 2JKJA 2PP8A 4WGWB 4LSXA 1A6WH 3GSNB 2X7LB 2XYCA 3ROLA 2PO6C 2R0ZH 4URTB 4CGTA 3ARBA 4Z7IA 1ZE3H 2AJXH 3E2HC 4NNPL 3TCLA 5BV7C 4P4KC 3U2JA 1ND0B 1HZHH 1OP3K 5LHDA 4L4VE 3T0EC 1BEYH 5E6SB 4HP5A 1YECH 1UM5L 4ABQA 3FO0L 4KKCC 1NCCH 3L5XH 1HHIB 3O3AB 4HWEH 4M62H 5MENE 2BK8A 1Z1WA 3EBHA 3SGJA 4WWID 5BNXD 3DJRA 2BOLA 3TWCL 3D07A 4N1EA 4N9GA 4B9KC 3VFMB 2DWEB 4JFYA 5HXMA 4TTGA 3BPNC 3T2PA 1YJDC 4WI4A 1OPGH 1N9PA 2F5AH 1CGSL 2QDWA 3AADB 3TA3D 1UVQA 3EHBD 4MFHA 1QRNE 5ID0B 4LPTA 3CIGA 5JW5A 3B4NA 2HWZL 1Y1UA 4JFFB 4KTEL 2EE6A 3TN0C 1DVXA 1HCFX 4NP4L 4PD4J 1R5VB 1JZ3A 5E8DL 3WDIA 3L9RA 3F7YA 3I50H 5D2LE 4HK0A 5IJCA 3JVGC 4PTTB 5SWQB 4CC4A 2XXFA 5IQNA 1T0OA 4F3FB 4H7VA 4RCWA 4NCC2 2X2IA 3SDXB 4CW1B 4YDIH 3ARFA 2VO5A 4N2CA 1RK0A 3TP4A 2OTWB 2VDLB 5E99L 1KB9J 4F7MA 4ICXA 1FG2A 2YFOA 1YYMH 5DVKA 1Q72L 4JX0A 1OAKH 5KVEL 4H8PA 3SDCA 4Z8FH 1XWDC 1N59B 3TJEL 3PDOB 1T1XA 4JO1L 3P3SA 2JE1A 4JHBA 1SN2A 4PJGF 5D6CA 1BLNA 4MAYD 4XZUB 3TBSA 3A0OA 3VXSE 1RUKH 4E5XA 5DMGD 1KYOJ 3DX2A 5AZ2H 2IH3B 3CVHL 4N25A 4YUEH 4PJIA 2GCYB 2PXYD 4C8XA 4B9IA 1Z6JT 4JPVL 2PPEA 5IF0B 1UD6A 2J56A 3UJTH 4BGDA 2X4RA 1O9WA 1G7IA 1WTGT 4XHQA 3HPLA 4C57C 4IIQC 1RMFL 2MNUA 2XVLA 5DJDB 4WV1A 1MCOH 2XFXA 1PD1A 1CXKA 3CVHA 1RHHA 3HW7A 1EHXA 1UADC 3TT3L 5AKRA 2W0FA 2R8SH 4ZODA 4LVNB 1Z3GH 3OM3B 3LKRA 2ZONA 2EIKB 4M29A 4F33B 1MFCH 1GGBL 2X6CA 4FP8L 4N2MA 1PDKB 4D9LL 1JXGA 2YKLL 2YPLE 3LPPA 5F9JB 2JVUA 3VU2A 4BV4R 1NGQL 2C9QA 2X3CA 4KK6D 1AQKL 3S34H 1I8LA 4PJAA 1NIEA 1UURA 4YE4L 5JR1L 4KJQC 2WIIA 3EDEA 3PGDA 4KOCA 1F5WA 5HYJD 1PLBA 5ERWA 3L5JA 1QYYA 2WINB 2K1MA 5D1QB 3PPEA 2OR9L 3UTQB 4J3WA 2FX8L 4NN6C 1QR1A 1VEPA 3IJYA 1X9QA 4JN1L 3H54A 3QUHA 3PDGA 2FWOB 1G5GA 3WSQL 1A4KA 1I4FA 5IM7A 4HC1L 3MOQA 5L7XL 2AI0H 1BZOA 3L5WA 4FLRA 1T2QH 1TQWA 3W5NA 5SWZE 1SXZA 3TASA 3X3FL 4WJ5B 4M5YL 3ZKXC 3NJFA 1VACA 2CHDA 5IMMA 4HCIA 3FCSB 3UTZA 4HC1A 4FQ2L 3RKPA 1EGJH 3MYJA 1TDQA 4LT7A 4YSCA 3WGVB 5B7EA 4CNCA 4DP0X 5I6MA 3DRQA 4G80B 3DDFA 2ESVA 2LHAA 1EFXA 5F7DB 4U6YB 4YSSA 1KZYA 2JKSA 4Y4KD 4G8GB 5ACMA 2NY2B 4KBPA 1YEKL 4BZYA 3VFPB 4DEUA 1M0ZA 2R83A 1JF1B 1TO5A 3GJEB 3SE9L 3T8XA 2H1XA 2EIMB 3MLRL 1AAJA 1SHMA 3MA7A 4M7LL 1P2CA 3BWZA 4Z95H 4JM2D 2BSSA 3NJIA 4XB8A 1J86A 4UILL 3SZKC 3VFOB 2G4EA 1EMTH 1NDGB 1HH9B 2C4FU 2Q76A 2DBLH 2F19H 3KBHE 3VWJA 5K1NA 1M1XB 3P77A 1UASA 3L3JA 2ZSVB 4ZNEE 1NMCB 4OLYL 2H0PA 4OBRA 4PH8A 4RFEA 1WLHA 3HNTH 4XC1H 2GB2A 4AVHA 2FB4H 3MUZ1 4ZPTA 1NFDB 1R1CA 2Z65C 3IF1B 4R9HA 1WCQA 2GFBB 5DWUH 2D3VA 1BOYA 2C1PA 3HB3B 1CYGA 3LJ3A 3SDDD 3QUZA 5D1XB 1ZWIB 3FF7A 4KUZL 1Q8MA 4I77H 2IV8A 4NKIH 4PP2B 4F24A 5FCSH 3P9LA 5GGTL 1NCUA 2Q8AL 2WTPA 5B8CA 5DJZA 2DWDB 3K71B 1T21A 2A74C 2YD3A 4JFXB 4GKLA 5FA4B 3WFDL 2H0EA 4DN3H 1RZJC 4U6XA 3ZGHA 3Q05A 5JHLL 3P4NB 5GGTA 1GCYA 5BVJA 5TPWL 4PWEA 3V6OC 4JS7A 3KPMA 1X7QB 5I19L 1GYVA 1QFWH 1GOHA 2YEQA 4TNEA 3M17A 1OALA 1M05B 2ICEC 3K4AA 3SKMB 5JHLA 3S36L 1BQHB 5F6HJ 3BN9D 4I9WD 4EN3D 1SDDA 3VXRD 2OTUB 3QIBD 4PRPA 1PLCA 3BWAB 4HIEA 4LPUA 1RPKA 4NEHB 2YKKA 2GY7B 1AQDA 5DU7A 2D4FA 1MI5A 5JQ6L 4B9CA 15C8H 4EDXA 4PEQB 2BM3A 2JH2A 4BK5C 2UY7B 3LQZA 3QZWB 2E7HA 3N9GH 1LO5A 3AS1A 5DJXB 5JOPD 4MJIA 4WWKA 1B4RA 1JN6A 4U1KA 4OF3A 4CJ0A 2NZ1A 5HGBA 3UBXI 1FAIH 4ANKA 3VNZA 3PP3H 2CIKB 1H6EA 5J8OA 3UAEA 4Q3IA 1IGFL 4RSVA 4IRJA 2DBJA 2JWYA 2NT1A 3ARBB 1Q4NX 3GNML 3GMMA 3QUYD 4H88L 2DQCH 1EJOL 3TCLB 3OR6A 5LCVL 4P04A 3L54A 1NM4A 4X9GA 5FO7A 1E6JH 4GUPA 3QWRD 4M1DL 5HHXL 3ILPA 4GQ9H 4YFDB 5HP5A 2P80D 1XZWA 3T6XA 3FT4A 5SX5H 1FNLA 5CZXC 5LCVA 1NDMA 1OZUA 2CO2A 2CZNA 1NEZA 3T04D 2GIMA 1RH8A 4N9GB 1ZMYA 4JFYB 1AKPA 3TOPA 3T0WA 4FHOA 2Y7QA 3DVIA 1KEGL 4HIHA 3V7MA 2UZYA 1J0IA 3CVIL 5E7FA 2G60L 3VD1A 1UEMA 1BZ9A 4U1LA 1UVQB 3M1OA 4GSXA 4Y16D 3PWPE 2N3JA 1F97A 3QG6A 4OFQA 3TPKA 3DSFL 3W1ZA 3WFBH 5KVGH 3EJRA 4JL1A 3IFNH 4BUHA 3L9RB 3GHEL 2BSRA 4DKEL 5IJKA 4WKXA 3F7YB 3QG7L 2BY0A 4UINH 5CLWA 1E4HA 2Z66A 3SKJL 4HK0B 2QQNH 4PTUA 2IPUG 1VADA 4NQSA 4A2EA 3SBWA 1Q1JL 4AL8C 4NNPH 3VD9A 1J1XH 1QUPA 1A6UH 1QACA 2P5EA 2XV6B 1RK0B 2X9YA 4QRSA 4P48A 4DAGL 4DGVH 3LNGA 4J8RA 4K9JA 1FG2B 1ASPA 1TETH 4QOKB 3SDCB 1BZEA 5E0QA 4ILDA 1T1XB 2WMPA 1AZUA 5D6CB 2B16A 2BWIA 5HY9A 1QWUA 5ADPL 5A3ID 4G7SB 1WHPA 2E27L 4K3JL 4PKIG 2JTYA 4E5XB 4OZGA 3STBA 3K80A 3QUXC 5FYLL 3TBSB 3ZTCC 1F02I 1PY9A 3B2VL 3TVMC 4KHTH 3PV6A 1JWSA 5D96C 1KJVA 5TFSH 4PJIB 3QXWA 4URKA 1ACCA 1MRDH 5I6PA 3BD3A 2X4RB 3ZDXE 3SPIA 1G7IB 2EIDA 2GC4C 3HPLB 2WQVA 3QS3A 3LZLA 4WV1B 2APFA 5T3ZE 1UWGL 3CVHB 5GISH 1ORQA 2OX5A 3ATBA 2Q9OA 4ZX5A 1JXJA 1HCVA 2H41A 1FI8C 4JHVA 4KXAA 2W0FB 3FQRB 5FDYA 5EC2A 3N06B 4XCEA 4XVJH 3LKRB 1B90A 3ALXA 4JFDE 2WLMA 4ZXBC 3IGKA 3OX8A 2E7LC 5L88H 4ARNA 2DYPA 1EWHA 1U8LA 4QI3A 4AUYA 4FAAB 3PAUA 2BJML 5E51A 2QTEA 5C0DA 1TMCB 3PGDB 1K6QL 1SN0A 2IDFA 4LLQA 4NXKA 2KKQA 3NCYP 5ERWB 5JOEA 3OJMB 1T03L 3X3GL 3C87A 4W6YB 1LP9E 4RZKA 4KMQA 2E0PA 4YHOL 4G9FE 4MWFA 1HOEA 1SXNA 4TNFA 4N3UA 4LEBA 4H0IA 1LE5A 4NZ8A 1GGCL 2YXVA 1JCKA 4LHJB 1NFKA 1A4KB 4JPVH 4FQHA 3WFCL 4ZTEA 1I4FB 5AB1A 4V2BA 3TBTA 1X5YA 4NWUL 1I1YA 4JAMA 2XWCA 4JMXA 3MV01 1HEJC 4W4NA 1RMFH 1MCWW 2D7MA 3K2IA 3L5WB 5F21B 1OF0A 3VXME 4ZAKA 4XBMA 1UT2A 1G4MA 3G6JE 1JNJA 1TVDA 1CD8A 1GW6A 3V0DA 5C07E 3QYNA 5EUOE 1VACB 1I1AD 2BIHA 2F7OA 5IMMB 5L2JA 3UTZB 2XV0A 5I9QC 1YEEL 3MYJB 4LARL 2PTTA 4HUVA 1YQVL 2OJ1A 2VLRE 3BVTA 3L3IA 3L3GA 4Y19D 2DLHA 2YKLH 2VOTA 3DRQB 1Z0MA 2YGPA 2ESVB 5TF0A 2VZOA 3ERXA 2DI9A 5C6WH 1MREL 3B7YA 3ZE0F 4KROD 1G9NH 4GXUN 3T8XB 1YUHA 2O5YH 1KLFA 1SVBA 4N2IA 3X2QB 5T3XD 1FH5H 3OAWA 3MA7B 1I31A 5MEOA 4LHQB 1TQSA 3FU3A 2BSSB 2AEIT 4U4IA 4X6BA 3ILDA 3MNMA 5ALCH 5KSAA 1BLIA 3KPQA 4UFRA 1EAOA 2Q76B 3VWJB 2D3NA 3LIZL 3P77B 4L4JA 1QI5A 3L3JB 4XMKL 1PG7L 3JT2A 3QJRB 3DGCR 1FVCA 2NNRA 4RFEB 3QQ4A 2CCWA 3WCYA 3LSOA 4PJGA 1FIGL 4ZPTB 4FQXC 3EYUH 1T3FA 2P8LA 4JQIL 5DFTA 2C1PB 1RY7B 3LIZA 3B83A 3QUZB 1UYWH 4IOSA 2X9WA 3MBEC 3CX2A 5GRZA 3QDJE 2N7AA 2PP7A 1B2YA 3KD4A 3P9LB 1DDHA 3I6LD 4Z7OE 3BZEB 5C6TL 1IEHA 2XN9D 1BA9A 3MN8A 1DEDA 4WUUE 5DJZB 1T21B 2QL1A 4JQIA 4K55A 5T33L 2AVFA 2R4SH 4NPJA 4LVOC 3SYCA 1EZVX 1V05A 4KQ3H 4U6XB 1SDAB 5TK4A 4Z7NF 5JDJA 3IDGA 4GUCA 1QYGL 4PJBF 3QZOA 4WO4D 5BVJB 2XWTA 3MLRH 3IYLW 3NIDB 1NCAH 3NGBB 4QWWC 1GMIA 3E4GA 4MASA 3M17B 3CC5A 4IKIA 5D7IF 5KTEL 1P84K 4Z0XA 4FQQA 1A7OL 1M3IA 3PAZA 1HC1A 5JPNA 1SDDB 4HF5H 5DD5L 3UC0H 4HIEB 1AQDB 1MI5B 3UJIL 4EDXB 4NAJA 4OD2A 4XP6L 1ETJA 4TRPH 1MELA 1QVOA 2A73A 2AJYL 2Z4QA 3LQZB 4Y2DA 2VRAA 1DBBL 1LO5B 2NXYB 1DFBL 2G2NA 2QSQA 1K8IA 3JV0A 1E2ZA 3LX9A 4JVUA 4WWKB 5I74C 3V6BR 5J13B 4QY8A 1JN6B 1SHSA 2WP3T 3UROR 4M6AA 4U1KB 3WXVH 1R34A 2IBZY 5HGBB 5IHUH 1DQMH 4U1GB 2Q8AH 3BPOB 5D5ME 3L7FA 5FO8A 1KULA 3DYOA 4PFEA 4IRJB 4FTDA 1LDSA 1NGPL 3FT0A 3GMMB 2VABA 4IS6A 3ML8A 3WNMA 4AYSA 2W65A 1BG9A 3OR6B 2BW4A 3CIQA 5E9AA 1XGQA 2A0ZA 1Q90A 5FO7B 1ZKAA 1JMXA 5HZLB 3TBWA 1MCKA 5CS7A 4YWGH 2JQZA 3MLWL 3ILPB 4OLXH 1CIUA 2WQUA 1EAQA 1RLWA 5FKAA 4N2FA 1O75A 1XGRA 3FT4B 1BQSA 3RDTC 3KBPA 4U2ZA 3ISRA 1NDMB 2F54D 4HWBL 2R69H 1NEZB 2MFNA 3CFQA 3K2UL 5CEZL 1G7HA 1QZNA 2DH3A 4JN2A 4LDCA 5TK2A 2HKHH 4B60A 3LS5H 2QADC 2CIIA 3UYPA 2B77A 3VFTA 1G1CA 2UZYB 2HTKC 5H37H 3C09B 4HXBL 1GKOA 2QGCA 4HWBA 4ATWA 5IBLD 3PWNA 5B7FA 2NNCA 4G6FB 3ASOB 4U1LB 5D1QD 4QXUH 4WENB 1TQVA 3RVUC 1ET8A 2DMGA 3V8OA 4K8RC 2CUHA 4AGOA 3UAJD 1ILSA 3ZXAC 3SB4A 4O2CA 2YD4A 3AU1A 1KBPA 5ISZE 4KKNA 1RULL 3FQTA 3TZVA 5CM1A 4R2GB 3TFBA 5INCA 4XPAL 3SPHA 3ZE1F 3GI9H 4FFZL 3RWDB 4PTUB 3RX5A 1G87A 2YAHA 2E4FA 4NQSB 4FE9A 3FHQA 4DKDC 2ZT9C 4YEBB 3CVBA 2E56A 1J8SA 4GMSH 1U95A 2P5EB 4WEUD 3W57A 5E1GA 5BO1H 1YMMA 1JZ2A 3D52A 4FFZA 4J8RB 2X1PA 4M1DH 1FLTX 5DHMC 2FX7H 2Z0BA 5E5MA 1TNNA 3IN0A 1HL9A 1CURA 1F4YL 1I1FA 5EZIH 2WMPB 3OZ9H 2VR9A 4XMTA 5HY9B 4BSJA 5FX3A 5A7EA 3HC3H 4RGND 4OZGB 5F70A 3K5SA 3VRJA 8PAZA 3VXOA 3FQNB 1E4JA 3PV6B 1JWSB 4JGUA 1KJVB 1KCVH 3MTXA 4UMSA 4W70A 5DS8A 3VDBA 4KX7A 3WN5A 3WPIA 5AD0A 4AYDC 2UY6A 3DUHA 1ZLSH 3ESOA 1OP9A 5HI5D 4OSUH 4UTAH 3T0DA 3JWOC 4WI2A 1ORQB 1YG9A 4XNXL 5EC2B 5C09E 4BXVA 4Q6KA 4XCEB 1JPFA 4KDTA 2DMKA 2O26U 4RRPA 2QLVB 2RCSL 4RAVA 4YEEA 2VXUL 3FOMB 2DYPB 5GGVL 1U8LB 3BP7A 4EZGA 2OSWA 1H3UA 3N44F 5C0DB 4LLQB 3WNOA 5GSVA 2MSPA 4ZI8A 5TE7L 5JMOC 4AQZA 4PMEA 4Z3TA 4BHUA 2YAEA 2XV3A 4TLKA 2BSDA 4A7GF 1MZZA 4HJJH 3TBYA 5JPMA 1D3CA 1AR1D 4WHYH 3TT1L 1QSVA 2IPUK 1N70A 2R9HC 4WTZG 3KGRA 4UM9D 4Z7VF 2Z82A 2WFHA 2AK4A 2VLKE 2VRQA 4MWFB 4PRHA 2UXFA 2HMID 1PIFA 3VCLA 4I3GA 2NCEA 3MRNA 2GK0A 4TNWK 1LE5B 3ESUF 1PD0A 1SXBA 1UH3A 4JGJA 5LWYL 3SYQA 3LD8B 2RACA 4ZK8A 3O4LD 4DP2X 4X5XA 2DW5A 2WM0A 4FQHB 3TBTB 3TO4A 1I1YB 1E27A 3P02A 4JAMB 4OZIF 2YQGA 5DURB 1YYLH 2F0CA 2WPGA 3N41B 2ED6A 4MSWA 4RMRA 4ZAKB 2BH0A 1FVEA 1AHWA 3MNWA 3J2PA 5L2JB 4KY2A 4R3SA 1JZIA 1M56B 3BKML 4PJCE 1AACA 5CJOL 3ZHFA 2DL2A 2PTTB 3A67L 4HUVB 2PPFA 3T9WA 3L3GB 1CK0H 4ALAL 4CKQA 4FMFA 3AVEA 3F58L 1QA9A 4X5RA 2W9LA 1H3VA 1D9KA 2Z31C 3DX8B 4TVSa 4BUQA 1O6VA 4JRYA 1AP2A 4QRPD 1G84A 3SOBH 2ZUWA 1XCXA 2ZKWA 3SBPA 4K17A 3ZL1A 1YUHB 4JREB 4PRIE 4YDVA 1BFSA 5E70A 4ZDHA 4CMHC 1A6PA 5MEOB 1AFVH 1MAMH 2UXTA 3CD4A 1R19A 4OV5A 2R29H 2TAAA 2CWRA 4M93B 4X6BB 4UQCA 3ARBD 2C3XA 1NINA 2O4EA 3GKWL 4N8VG 4S0TD 2C9XA 4E42A 5KSAB 3RPKA 1KGJA 2QQQA 3LB6D 3UCRA 1Y6KR 3KPQB 1J5CA 4P07A 4BSSA 1LK3L 3EFOB 1WISA 3K6DA 4QRRB 3V4PL 3VRLF 3T4AC 1ECZA 1KC5L 1IKNC 3QNXA 4AGMA 3DZEA 2NYZA 3QQ4B 2ZWLT 3PHSA 3FT2A 3GSXA 3RGVA 3LSOB 3O45A 4HJGA 4PJGB 3BI9X 4BINA 3PWVA 1BAFH 3FS9A 1M9WA 1T3FB 2P8LB 3E9TA 4AQ1A 2DLIA 1Z0NA 3V4PA 4IRZH 3CLWA 3CNKA 5LKNA 1CLYH 4KO7A 4DNLA 4I85A 2R0LH 2WXKA 5AL8A 2DIAA 3E6FA 3GOZA 1DDHB 1KCSH 3O3DA 1CZ8H 4LARH 4QHUA 3V5DA 1UD3A 1YQVH 2Y72A 3HZVA 4JPWL 3Q2VA 3OKYA 4A7SA 5H8DA 4APQC 3BEWA 1BIHA 1IGYA 3O2WL 5BS0E 3CVRA 3HC4L 4LSSH 5C3TA 4MD0A 5I16A 1ZTMA 3GZKA 2ZWYA 3IDGB 2APXA 5LFNA 3S3SA 4Q4IA 2XWTB 2ZKMX 1RJZB 3D2TA 3D48R 1RQ5A 1XAKA 2F18A 1YEFH 3CC5B 3S4SA 3SYPA 2ALWA 4Z0XB 2ED7A 3NK4A 2VUOA 4FQQB 3R1GL 2HFGL 5IV2A 5JPNB 3ARFD 3TH3T 3NRPA 2J44A 2XJLA 4KK9C 1I7UA 4Y2LA 2VDKL 4N5UA 4QRQA 4N24A 5BRZD 3S2CA 1J0HA 2Y2TA 5BRPA 3FSOA 1NOFA 5I71C 1L9QA 4OD2B 2A73B 2Z4QB 3NCFB 4XZ4A 2V5TA 3AT9A 3GBNH 5DT1H 3MUJA 1K8IB 5IWLA 4TQEH 3FK3A 4H4NA 5I8OL 5J6GA 4QY8B 4XCNB 4YJZL 3ES6A 4Z79A 1P6WA 2X4QA 3BZ4A 3L7FB 5FO8B 1T7XA 3GBLA 4TULL 1BREA 3AXLA 1JV5A 3ET9F 4L48A 4BFJA 2CKNA 2VABB 4KQ4L 2COVD 3UGUA 2FZ3A 3RIAK 4NQQA 2J21A 1DJGA 1XGQB 4JFQA 1BG1A 4HBQA 1OSPH 3PRZA 5H94A 2Y1YA 2K7PA 4OI9A 5L2KE 3ZHNA 5EA0L 3ZR5A 1XL4A 2R2CA 5FKAB 1XGRB 4ACPA 1NA8A 1A6ZA 3LRHA 4F8TA 4XO3A 1FUNA 2P28B 1L7TH 3MO1A 5C08A 1OP3H 1ETZA 1G7HB 4JN2B 4D9RD 5IB5A 2YBRA 4ZMLA 1ZK9A 3AREA 1BAWA 2V7HB 4BH7A 2YMXH 4G7VL 3BWUF 2CIIB 2E86A 1QKZL 2WNWA 4J4PC 5DCCA 3UYPB 1CLOL 3RIZA 3VFTB 3AC0A 4NC2B 4WO0A 4X4ZA 3ZBMA 1BF5A 4XGOA 1F2XK 2WB1A 1OSZA 1QW9A 3PWNB 4PS7A 2F74A 1WRFA 4LLUA 3LH8A 1TQBB 4M8VA 1IT9L 3MUY1 4UAOC 3R7RA 1YPZF 3H56A 5EU5A 4PJ5A 4WI8A 2XDHA 3LRGA 5C0NC 4EUPA 4O2CB 3AU1B 3FQTB 4PJEF 3TZVB 5INCB 3GBDA 2ISDA 5JXAL 2IAAC 1IBZA 4TVPE 4C58B 3NBNA 3EJTA 3QDAA 1W0WA 4XMUA 3BP5A 2QKIC 3KL5A 1KACB 2WJ7A 1ZEAL 1U95B 2JK5A 3NSXA 1WA2X 1Y18B 3ZDZE 5L8JB 3L4ZA 1U6AH 3WENA 1VKXA 4DQOL 1OGSA 1RUAL 4GRWB 1QBAA 4X2UA 1TJIH 2DLGA 1SUJA 4P8QA 1CC3A 2ROXA 4JG0H 2WBJD 5E5MB 3RUGE 4KMLB 3U0WL 4YXKL 2W80C 1LO2L 1I1FB 1H19A 5E4IA 5AOIA 2ESVD 1EFXD 4GAJL 4L4TD 3VRJB 4KRNA 3VXOB 3VX0A 3PP4L 4PJBA 2FL5A 2A77H 4XMLL 2GTQA 4OF8A 3L45A 4PB0L 4MNGA 1QSZA 3IDYC 3WN5B 3F7PC 1IE5A 1YLBB 5AD0B 1OHQA 1ECYA 4AG4H 2UY6B 5D7IA 4XP4L 3KPSE 1KPVA 2ZSWA 4QRUA 2B0SH 4CN6A 1R24A 3P3YA 3B43A 4MJJA 3SY0A 1AC6A 2QQLH 3D51A 4PJXB 5AOJA 3DX9A 3VWJD 3HUJE 4XPHL 2XA8L 3O6FA 4CVWA 1A14H 1JPFB 4GRWH 4H26A 4K71B 3DETC 4NM8L 4XPTH 1I8MA 5GS1C 2Q7AA 3KLHC 4AX3A 2IAMC 4OCWH 3JTTA 4RAVB 2JLLA 3VO0A 2A99A 4NQDA 2YAFA 4G72B 3RI5F 3BP7B 4DJMA 5CCGE 3QUZD 1OGPA 2QQKL 2Y7SA 2DEYX 2Y9RT 1NWPA 5GSVB 1N6QH 4G6JL 3WAJA 1CR9L 4A68A 3G5XA 4LFHG 4LSQH 4S1SL 3DURA 3TBYB 5JPMB 5GIRA 2R4RH 2OJZH 1UWFA 4R26L 1H3PH 3MLZH 4BQ8A 2AK4B 4FZ8H 3GKZA 4PRHB 3VCLB 1OTUD 3GXPA 3MRNB 1D5MA 2GK0B 1AZZC 1ZVSA 2QPFA 5KBPA 2DJUA 1EK3A 4Y9EA 4XN7A 4X5XB 1PZ5A 5AKSA 3E9UA 1MY7A 2DWSA 1P1VA 1U92A 3TO4B 5J06A 1E27B 4FG6C 5E95B 5I76B 5E56A 4KJWC 1EZSA 3LZRA 1H5BA 3DV4A 4J2XA 4WWNA 3ZL4L 3WEMA 3PWJB 2EEFA 2BOBA 1FVEB 4KTDH 1AHWB 3OLEA 2AW2A 4PRPD 3ARZA 4ZQKA 1HYSC 2OZ4L 3O6KL 2YSTA 1EUTA 4FCAA 1MI5D 4U09A 3N0AA 3QIUD 2ZYSA 5ACZA 3FAWA 1FQVA 1QA9B 1U0ND 4IRSC 1DL7L 1D9KB 4JRYB 5EV7A 1AP2B 5F1SA 1DLFL 2YA0A 1UXSA 4MA8L 4MJID 4WWKD 5TQ2L 2OZ4A 3K7UA 1FFNB 4ES8A 1KXVA 5L6YL 2VN4A 5HDRA 4IOIA 1GW0A 4YDVB 4JR9H 4ZDHB 1IAIM 3U2SA 3OG6B 4Y88A 5F72S 2KBGA 4OV5B 4F8QA 1NIFA 3MROA 4E42B 1D7DA 2D0GA 4X6DE 5E6IB 3LNIA 3VVWA 3K4ZA 4JY6A 5DTFA 5DMKA 4A2MA 5IB2A 1NPUA 4QHLA 1OE3A 4FNUA 2NTFA 3G04C 3SN6N 3BAJA 1S8DA 1BWWA 3QNXB 4TSCH 2CXGA 4MAYC 2LOEA 1ZVHA 5FUZL 2B08A 3FT2B 3RGVB 3O45B 4HJGB 1DVFD 1JNNL 3PWVB 3RKDC 2ED8A 2HG0A 4E0RA 1VA9A 2F54E 2CM5A 1X44A 2XVKA 3V4PB 1PNDA 3EJUA 4AQ1B 1E3XA 2RMNA 5C0CD 3I3EA 4AM0Q 4ODXA 2IIJA 3EYOB 5HYFA 1FPTH 3BDXA 3GXDA 3OGCA 4G59C 4BQ6A 3FO9A 3O3DB 4LOUD 2YUWA 4QHUB 1A25A 3V5DB 1JHKH 2EDKA 1MUJA 3HZVB 3ULUD 4WI0A 1PJWA 1FVDB 4G6FD 3BEWB 1IGYB 2AABL 3V7AE 2R1WA 4LDEB 3I9AA 3IJHA 5D72H 5I16B 1UXWA 4FQ1L 2P45B 4Z7QF 3B3BA 4H25A 5HGHB 3QC6X 5CJQL 3QWOA 4R2GD 1U4EA 4M6ML 1JF5A 1QWHA 1F4HA 4ANVA 5HHVH 2NW2A 3HI6H 3UYOD 3EIFA 3BHBA 4HU8A 3AQYA 2VR3A 3S4SB 3LPOA 1CO1A 2JJSA 2PCFA 4WLCA 4ONGL 5IV2B 1AYRA 1C7TA 1ZA3A 3HLKA 4PAZA 4RCAA 2NX5D 5C92A 2Y3AA 5EU6A 4OFKA 5FHAH 4X50A 4X5PA 1VFOA 4KAQH 1J18A 4P5TD 3MV7A 4A7GA 3D85B 1G7JB 1DSYA 4KVNH 4R6FA 4CMMA 4AZUA 3ARDD 2C7FA 2JCWA 2VDKB 4RGNE 4GXVL 2DV6A 3EJPA 3ILQD 5J6GB 2BP0A 1WAAE 3I75A 4XPBL 4PHXA 4N87A 5ECJE 2K70A 3ES6B 1QSED 3CFCL 2FNWA 1UACH 2X4QB 3BIKA 3DX1A 3BZ4B 4M43H 4WF7A 5F0LB 1INDL 4F8OA 1S7RA 3AXLB 5K59F 2FATL 5IYXC 1JV5B 4WHDA 3U9UB 4C56B 2H3KA 3K5RA 3SOTA 2ADYA 5F93C 2WYIA 1JV2A 2F68X 2FZ3B 4PRNA 4UDUB 4A55A 3QI9B 1F3DJ 4JFQB 5CFAA 4RGMC 4TKWA 1EUUA 2MQGA 4OF5A 1LK2A 1OAZL 1QLFA 2VLLA 3I3DA 4JO2H 2ZJSH 1ZTXL 4WZ9A 3OQ3B 4Z61C 1A6ZB 3CFTA 1NBYA 1IJNA 3EYSH 2VN6A 4G3YL 5AENA 2XU9A 4QXGH 3MO1B 4J3TA 5C08B 5GZOA 2R9UA 4HQ1A 1ETZB 1HKLH 4UTBH 5JIDA 5IB5B 2YBRB 4KNSA 3E1F1 3AREB 5EZJA 4NJ9H 2VLJA 1ULVA 3EZ8A 3W3LA 1ZK5A 5FLVA 4HWUA 5C0GA 4HEPG 5I73B 4P46B 1OSZB 3NACH 1BQLH 4K7PY 2F74B 4HBCH 4LLUB 2BIQA 1VDGA 2HSIA 2EIJB 4FJZA 2QGBA 4G1MA 3M1BA 3FN0H 5IJBC 4L3CA 1LWJA 4PJ5B 1UJ3A 5EU5B 2FDBP 3MGOB 2EE9A 2DICA 4EUPB 4GFTB 2HB0A 4Z3HA 3A79B 2VDOL 1N4XH 1A0QL 4X7SH 4D3CH 5LGKA 5IR1A 4OJFH 3T1WA 1GC1L 3TFKD 5ILTL 4UQAA 3SDDC 3VNYA 5ITBH 5EF0A 5GRVL 3M18A 5JLZA 2J8UA 3K74B 1PS3A 3F6LA 4CGUB 2O6EA 1W0WB 3BP5B 1I3RA 2ZOLA 3CUPA 2I9TA 5E6UB 1UGNA 4N86A 3W0WE 3UH8A 4N4YB 1VKXB 1JERA 4XVSH 3NZHH 3D0LA 5SV3A 4TLTA 5FYKD 5DSCB 2JCCF 3FU9A 4BK8A 1VERA 1GH7A 2VE6B 4KH9A 4WI3A 4DP4X 3IU4H 2KYIA 8FABA 2GQHA 5E7BA 3KH4A 1WTLA 2BNHA 3SE8H 2G5UA 2CJUH 2L4OA 3TBBA 4MNQA 4QRPE 4PJBB 3MJWA 2CGZA 4P5SA 3V9CA 2LU3A 1CDYA 3QXUA 3QEHA 4YZFE 4MNGB 4Z3EA 1BQ5A 1IGJA 2BVOA 3PL6A 4JHWL 3LRMA 4EN3C 1JYVA 5D7IB 3QIBC 1KPVB 4J28A 1JRHH 2VR7A 1EO8L 2OSLA 1R24B 2FHCA 5B1BB 1OLZA 3SY0B 1HHKA 4N2GA 3DX9B 3CN0A 1MHEA 2VERA 1AMYA 2EKSA 1YDPA 3O6FB 5A1AA 4H26B 1I8MB 4J5VA 5GRXG 4DEWA 5CFHA 3ZYIA 5JXAH 5M7QA 3QJSB 5C0CA 1NWOA 3HS8A 3JTTB 1XFPA 3NJJA 3AQDA 4NQDB 4LASH 1I9JL 3MOAL 1OXYA 4LBAA 1S6NA 2BY1A 2CO3A 3MRLA 4BKLA 4IOSD 4HT1H 1M6OA 1RUAH 4FXKC 1RCYA 2WIMA 4LKXA 3DUUA 3O4OC 2CO7A 3RB7A 3G5XB 2OJEA 2AMGA 4IU2A 3O3EA 5A2KH 2IDTA 3DURB 4E9RA 5DJ2A 5GIRB 1LO0L 3GZPA 1ES0B 1TJXA 2WCSA 5GJTH 1A4BA 1GHFL 2R51A 4XE5B 4A38A 1D5MB 4UV4H 1ZVSB 4H8HA 4XMLH 2JKIS 4EQ3A 3CDFA 4OM0H 1QLRA 4HUCA 1PZ5B 1XEUA 1U92B 1U2YA 4HS6A 4XP4H 4OM1L 1H5BB 1EEQA 3DV4B 2CLZA 3HG5A 3KPNA 4M6OH 4PWKA 2BOBB 4W1TA 3KWTA 3L2MA 4OZFG 2ENYA 2NT0A 4K15A 1SJMA 1LO3L 4ZQKB 5HHOD 1G6RH 3NPSB 3VUAA 3FQWB 2Z1PA 3NVQA 1JVLA 3W2DL 5F96L 4BKTC 4Y2DD 1OAQH 1KB5L 4IJ3B 5ACZB 5GS0L 4L0YA 4JJOA 1YPZA 2B9BA 2QGEA 4PYHA 1LDPL 1UXSB 5TDOA 5LBSL 4FQIH 1A8JH 2Z6FA 4PJEA 2ZUSA 5E8PA 2J5WA 5KVFH 4IOIB 2XG5A 3U2SB 3GM8A 5JW4Q 5I2IA 1KB5A 1CR9H 4YGVB 5GS0A 1XIWD 4XBEH 2LU7A 1YN6A 4U4BA 3QRLA 3MROB 1A7RL 2X42A 4JFEE 2UWEE 1VEMA 4OT1L 1WCBA 2V6HA 4JY6B 5DTFB 5IB2B 3RILA 5E1IA 4LIQE 4XWGL 1CQYA 3FFCA 1S8DB 3QW9A 3VYOA 2L7QA 4XE0A 3OGLB 5EO0A 3P30L 3EH4B 1SDYA 4CL7A 4UOW0 4E0RB 3ULVL 3HS9A 2IPTL 3T3PE 4ODXB 2H1PH 2QVTA 4ADJA 4WFEE 4X7TA 3OGCB 4TM9A 3O6KH 4P4RA 3FO9B 2H2PC 4P23C 2X2JA 3PWLA 4NN5B 4XCFL 5AW3B 1I9IH 1MUJB 2DQJL 5BUAA 3WXWL 3QWNA 4WI0B 5GGQH 1D5IL 5CEZD 4Q62A 3ULVA 3QZLA 3V0FA 5IHLB 5F9WC 1BOGA 2R1WB 3NQIA 4XAKD 5HI4D 3VGAC 3OMNB 3G3AA 3NRQA 3IJHB 1UXWB 2FUTA 5T1LD 3APCA 4H25B 3UX9B 3MLSL 3QWOB 2LR4A 5CJXC 2NW2B 3GEWB 2NY3C 1WWBX 3BHBB 4EIZC 4BSWA 2FT8A 2NY0C 4K94H 3TGXA 2PCFB 4GG8B 1F3JB 1AJ7L 4ZFQA 3D69A 3FH8A 3L7EB 1ZA3B 4LPYA 1YMMD 2BP8B 4RCAB 2JI3A 4XCYA 2EDMA 3FPXA 4Z23A 4KV5F 3FL7A 4OLVH 4HMCA 4O2FA 4FX5A 4YLBA 5E1AA 3MV7B 4POYA 1L0YA 4A7UA 2O72A 1DQQA 4CMMB 4PP1D 4I1RA 1DBAL 4L4TE 5C0IA 3TEXA 2BP0B 3I75B 4ZS6D 4PYGA 1T1ZA 5ESAA 4AEHH 3SE6A 4M1GH 3BIKB 2R2EA 1T7YA 1ZANH 3RGXA 2WCPA 1S7RB 3II1A 4ZUSB 1I1AC 3A3YB 2W8CA 4ERSL 2AABH 1JV2B 2VZTA 3B8YA 4PRNB 2XN2A 1YEDA 4Y5XA 3CHSA 1JTOA 3QUMA 4A2LA 1TTAA 3IKCA 5CJQH 2JJTC 3ZN6A 1LK2B 1QLFB 2VLLB 1CE1H 1JNLH 2WWMC 5E5UB 1LQSR 4KI5F 5FGBA 3U0TB 2GJ6A 1OAYH 4KROC 4G71B 4LKCB 5DC4B 4GRLC 1K8DA 3S2AA 1NBYB 5J9PA 1FP5A 3ALWA 3SE3C 2I5YH 3QHFL 5TF1H 3EBGA 3LH2H 2CO6B 1F4WL 1Y7VA 5EZJB 4GT0A 4EI5A 2WQRA 2O30A 2VLJB 5GRUH 5DYOA 3GWJA 2VMDA 4NZUL 3EOAA 3UJJL 3HTLX 5C0GB 2VL5A 4XO4A 4ZYKA 1PKQA 3QRGH 5BOPA 3IMWA 3ML9A 4G1MB 2AK4D 3M1BB 2J43A 4ICWA 1ZRUA 2LFGA 4L3CB 1UJ3B 4PRHD 1AQ8A 4V1DB 1IGCL 3AW5A 4ZS7L 4FGMA 1OGAA 4KPHL 1XGPA 2HT4D 3DVGB 3FZUC 3O6LL 3GB7A 3LZOA 2Y36L 3NIFE 4A7VA 2HAZA 4ECNA 4PG2A 4NZFA 3TO4D 3PGCA 4XBGA 2VZ3A 4YHKH 5JLZB 2J8UB 4N90D 2ZOLB 3CUPB 2I9TB 5B4MD 4HEMA 1WEJL 5I6NA 2WLLB 1RFDH 3M07A 4MGXA 1VFAA 2IFGA 1BFVH 5D7SL 5FUCE 3D0LB 4M48H 2NSQA 2VN3A 3N04A 5EOCL 4WHTA 3GM0A 5HI3C 3UTTE 2JELL 4Y4FA 4BFGA 3IRPX 1N6VA 1JL5A 1FYTA 3CBJB 4RMTA 3FF8A 3KLQA 3SQOH 4OKDA 4C83B 3UYRL 4G3YH 1R9FA 4XC3L 8FABB 5KJRH 4O02H 4G9DA 1LMKA 1D9KD 2LAGB 2WLNA 2DH2A 5EU4A 1NGWA 4MNQB 3BD5A 5DMYA 3G06A 3QEHB 4XCCH 4ECOA 5E9DA 4P2QE 2BVOB 3PL6B 3BFOA 3C60A 5HYSA 4UIKH 3LKQA 2ZG1A 3UCQA 3K0YA 2G0LA 2JKRM 5I82A 4GMTL 5DD0L 1QFUL 2K8QA 3ABGA 3K3QA 4YK4B 1AO7E 2CNYA 2OSLB 2XICA 4Z9KB 4KGJA 1BVKA 1HHKB 2YAQA 1D2PA 1MHEB 5BUPA 5CD5D 2EKSB 1YDPB 3PHAA 2HJLA 3FB7A 1OTSD 4D9QD 1NCGA 3GS7A 2XWRA 3JV6A 3P0VL 3RGVD 3UTPD 2R59A 1PSKL 4Y1TA 3FQ4A 4TSAL 5FHBH 3E6HA 5F71A 2AV1A 4A2DA 4Y1AA 1TQCB 1T0PB 3B37A 4LB8A 4AY9X 1Y0LA 4BKLB 3QXVA 1D2OA 2XBTA 1M6OB 4HFUL 4ZW6A 3K6NA 5C0CE 4JANA 3SE4C 2EAEA 4RIRA 1MLBA 2CK0L 4DPRA 4LKXB 3DUUB 1DDTA 1PFCA 2CO7B 3UBXG 2Y4SA 3WUWG 4IU2B 2OJEB 3O3EB 4J6RL 1LM8V 3BMVA 3ULUE 4RQQA 4BK4A 1P4BL 2ASSB 4LVNC 2AV7A 3FO1A 1RIVL 5DQ9A 4M7ZB 3D4GA 2P5WE 5B1JA 1ODAA 1F4XL 4AMXA 3VSVA 4FADA 3HAEG 5DUML 2IDUA 1KOAA 4FFYL 5FO2A 1QLRB 4ZW7A 3WY2A 4W6WB 5HD8D 4HS6B 2BRQA 4DGIL 1SM3L 5LGHL 3GHBH 4BFIA 3D3VE 1IIIA 4ODTL 5DGQA 1YNLL 3HFMH 4FFYA 5IMOA 3RZCA 5D1QC 2NX5E 3AG4B 2LFEA 4ODSL 2ZUYA 1V5JA 3O2VH 4YO0A 4U3XA 4ZX3A 3QQDA 4JMNA 1Q0XL 5I1IL 4E9VA 3IAPA 4Z3JA 3AFLA 1IBHA 4QJ4B 5TDOB 1YNTF 4QTFA 4NUMA 4UB0H 4U49A 3WE6A 5E8PB 1JGVL 5DRZA 2NY5L 2XG5B 3KPRB 3NJHA 4NN7B 1QSEE 1ODUA 3H0TB 5I2IB 3HS0A 3BE1H 1WPCA 4F8PA 1MIEH 5F1IA 4U7KA 1YN6B 1CS6A 5I17A 2YJQA 4HV8A 2DB8A 3MRQA 4RISH 3H3PL 1A6AA 1WCBB 2E9WA 2XBZA 4JRXE 3W3BA 1URZA 4BZ1L 4LSPL 1DCEA 1QLEB 4CADA 3FFCB 1MFMA 3CSGA 3HHMA 3FC8A 2JCCA 4OLWL 5EF3A 4RZCA 2OMVA 2PR4L 4PREA 5J5EA 2BDNL 5EO0B 4NWTH 4U31A 4JKPL 2NY2C 3WKPA 4MBOA 1O6SA 1IAMA 4RVBA 4BZ1A 5GGSA 2EDYA 3QNFA 1FHNA 3QH3A 4H5SA 5KSBE 4X7TB 3QO0A 5JZ7D 5HI5C 4P4RB 5IVOA 3PWLB 2RH0A 1C5BL 1NBVL 3LQAH 3LXAA 4LF3A 4NKGA 4CC1A 3CDYA 3RNKA 1BPVA 2D73A 3QBTB 3GGWA 1NMCC 5BV7B 3ZTNH 1BOGB 3ZYZA 4X83A 4PJ5D 4U2YA 2UV3A 3EYQD 4DCQB 3T0EB 2GHWB 4JG9A 3AJ7A 4CA4A 1OK0A 4Z78A 1QLEH 2Z64C 4G8AC 3SJVA 4LEXH 5D1XC 4XOEA 5C8JA 1AY1L 2HFFA 4L5FE 1W6LA 3ZYNA 3QQ9C 3VMOA 4E9LA 3D69B 1A1OA 3O8XA 3FQXA 5HTSA 4UT7H 4DUXA 4LHUA 4H0GA 4XCYB 3H55A 5E5RB 4O2FB 3W3JA 5E1AB 2HMIC 1C1EL 2P1OB 4JCWA 1QNZL 4FQCL 4FG4A 5CAYB 1DQQB 5F3HA 1C8PA 2A6KA 3FUHA 4ODHL 3E6JA 5C0IB 1KF9B 1JGUL 4I2XE 5BV7H 4ESKA 4J23A 4L8SA 3CMGA 3JT0A 2WWKT 3QJXA 3DK2A 1T1ZB 3T0AA 5ESAB 1RZKL 3MC0A 1YEJL 1II4E 2YUVA 4P9HC 5AYTA 3WEAA 5CGMA 2R2EB 4WIQA 3MV8D 1EAPA 3KYNB 1KN2L 1ZY9A 2H7WA 3EDJA 3E38A 3O0LA 1YEDB 1QSFA 2VZSA 2O5ZH 4Y5XB 2C34A 5DC2A 1W15A 3QUMB 1NCBL 5JW4M 2AEQH 1KBGL 1NCOA 3IKCB 2AP2A 5SX4H 3RLSA 5IVZA 1RZFH 2GJ6B 4FLHA 3N43B 3QHTC 4JDTL 1YJDH 4LZKA 4O9HL 4QHNA 1K8DB 3W3MA 5J9PB 3OAZH 3MPCA 5IQ7H 4NQDD 4O5LH 3BVXA 4LSXC 3CU7A 1G9ML 2JKWA 1E43A 4TN9A 5I15L 3ATFA 3ARBC 5DJYA 4EI5B 2TRYA 3ELQA 5DYOB 2Q86A 2AEPL 4D7PA 1RJCA 3C5ZA 3EOAB 4W93A 4X5WA 3FTYA 5E94A 4WQOA 2VL5B 3FSWA 4IIQB 1PEZA 5B7MA 4N2EA 4ZYKB 1WWAX 1PKQB 2ORBL 5KYUA 1RUQH 3DIDA 2E7CA 5IQOA 1OK8A 4RSYA 4ZTOH 2VH5H 3HZMA 1XGPB 2V8MA 3QUMH 1A7PL 3GB7B 3SGJC 3X11B 2KH2B 2WB7A 3H9HA 2EE2A 4NRYA 4K7PH 4AGPA 4XPFL 3PGCB 4JDZA 4XBGB 5M94B 5IEKA 4GG6E 1TTGA 3DTUB 3ZKND 2J88L 4GSDH 1SEQH 1CFQA 1TJGH 2WLHA 1FFRA 5HJBA 3QEQE 1J1PH 1NUGA 1VFAB 4FNLL 4H40A 1P7BA 4GINA 4FL4C 1HNFA 5ABZA 1UUSA 3L08A 2YQ2A 4LSVH 2EDRA 4ZW8A 5EBWA 2WUBH 4WHTB 1IAIH 4YSRA 4Y4FB 5AW9B 5AYQA 5E8NB 3K81A 3HN3A 5D1ZA 5C0RL 1FYTB 4MMYA 3MLPA 4ELMF 4G9DB 3KJ6L 1JPTL 3NG5A 5EU4B 5IJCC 1NGWB 1F4WH 4Y1SA 3FU6A 1E4XL 3GJFB 2F15A 5D7EA 5ICXB 4CC4C 1LLAA 2AANA 4LNRA 1A9EA 5IB3A 4GO6B 4NZUH 4OCNC 3C60B 1G5AA 3ARFC 3RYMA 5HYSB 3KMDA 1T66D 3LKQB 4F8LA 5A6LA 5MEQA 5DRWB 2DWXA 3T3MB 4YXLL 4I5BA 1EBAA 2OQJB 2JB5L 3MLVH 4RETB 4UI2A 1BVKB 3SDCC 2PLTA 3ZKXB 1WBZA 4H8QA 4OD1H 3NEEA 1KEMH 4JB9L 5CP7A 2HJLB 2XTLA 3FB7B 5TGBB 3N5AA 3U25A 3AG2B 1U36A 4K23H 4CDHA 3F7QA 3E6HB 2AV1B 1E7UA 5D7LE 2W9EH 4Y1AB 1OARH 2ZP9A 2XUWA 3MDJA 1Y0LB 3WJMA 3ZDXF 5J11B 4LEEA 3GRWH 4DTGL 1XGTA 4OZHA 1RUPL 4JANB 4GKZB 4RIRB 2YAPA 2EVGA 1SEBA 4QAMB 4FABL 1MLBB 3GJFH 5TH2A 4GI8A 3AZUA 5C1MB 4WV1C 3WTUA 1QW8A 5C3LD 2WQAA 1I8KA 2VXSL 4P3CL 4BV1A 2FT7A 4RQQB 1ZLDA 4M8QB 1OSYA 2AV7B 2K9UA 3FO1B 5FGRA 2DQIH 5I24A 4GJTB 2ATPA 3I74A 4XAKE 5DQ9B 5FS5A 2R0WH 5FYJH 5I6XB 5IBUG 1R3HA 3W9DA 4AEFA 5I8KL 4ELKA 1H8OA 2V17H 2VXTH 3SGDI 4WYKA 4H1LB 3P0YL 4GOSA 1I8LC 3C6PB 2HP4A 1G7LA 3CFKA 1IVLA 3S5LG 2I9LA 2UZIL 4BFIB 3M6DA 4IK6A 3QDGD 5I1JH 2IWFA 1LP9F 1UA6H 3TYFA 5IMOB 2R56H 3RZCB 5EU6D 1RP9A 1M57B 4I0PA 3GMQA 4F27A 4X7FC 1R17A 1EH9A 3EOTH 2FECL 4YO0B 3RJQB 3QQDB 5D7KE 3FB6A 5GQBA 1R5WA 4TVPH 2VUYA 5MENA 1N3NA 3A6BH 1HS6A 2FQEA 1VGKA 4X99A 5JIIA 2H6PA 3D87B 5I1GL 3SO5A 2WP3O 1JFHA 1X5FA 1TZGL 3WE6B 2VC2L 5DRZB 5JHDE 2IANA 2DQHL 4H2CA 3TLRA 1TSHA 1JK8A 1TR7A 3IJ7A 4LGPB 4ZMOA 4AQAA 3VD4A 1FGVL 1SVCP 4XWOC 1RZGB 5F1IB 3TCXA 4WSJA 4B6ZA 3IGAA 5EUOF 3OB8A 4H1LH 5I17B 4HV8B 3MRQB 3V0JA 2ED9A 2A6DB 12E8L 1A6AB 2ZKHH 4I4WA 1NSNL 3X1BA 1AZBA 2Z92A 1NBZA 3F65A 1KYAA 4OLUH 4CADB 4KZDH 4AKQA 1SN5A 3UAAA 2JCCB 4RZCB 2OMVB 3DSNA 4PREB 1NUDA 3BLKA 1NANH 4FA7B 4XNZB 1O6SB 1A4YA 2EDLA 1OLLA 1WZ1H 2J71A 1WICA 2X1XR 3L6FA 4MA3A 4P3WA 5D2LA 1XGUA 5GGSB 5K39A 2PN5A 3ZX1A 3QJOA 2HRGA 4K5NA 2CG9X 1RZJH 3G9VA 3MXVL 3QH3B 3Q7JA 4H5SB 5GRYA 3GK8L 3QO0B 1A5FL 2XOTA 1CU4L 1KXQE 2OPCA 1MCEA 1MJ7H 2PR9A 4X8GA 1UCBL 5E23A 3VWJC 3FNKA 3QULB 4LF3B 4TUOA 2YN5A 3RNKB 3L1OL 2MHAA 2VSCA 2OMTA 1Q0XH 1IZJA 3K6SA 5JORA 4F5CA 3Q0HA 4RMVA 4PU2A 3RVVD 1QQDA 3NAAL 1I82A 1WUNT 2AQNA 3IM1A 2FO1A 4IM8A 3X13A 4B96A 4R8WH 1LEGA 4Z78B 3VXSA 1A65A 2X2YA 3FQ1A 4HDIA 3IMUA 3BZ5A 3QUZC 2XACC 5FECA 4Y2NA 5C8JB 1WBXA 4TSBL 2HFFB 2WOBA 2D2OA 1BQKA 2WGXA 3G5VA 4F15B 4Z7OF 2QELA 1AR2A 4HSQA 3RWHA 5B8CC 1A1OB 3ARRA 1CICA 3FQXB 3O8XB 4DN4L 2BNQE 1QATA 2DY2A 4LHUB 1AH1A 3GRBA 3IJSA 1CD9B 3EFDL 2K6YA 3ARGA 4FLOA 4G7RB 3EOYG 3P0GB 4L8BA 3S96A 2WXGA 1CLZL 1RP8A 2XWZA 4M6NH 4PD4K 5TQ0L 5FTTB 1MCJA 3Q5OA 4RNRA 4Y5YA 1OTUC 4NZTM 4JKPH 2EUVA 1SOKA 2FSEA 2YRLA 5F3HB 4FCHA 3GTNA 1JTTA 2HLFD 2A6KB 3HVDA 1SMOA 4FNSA 1KFAH 1FC2D 3DX7B 4L1TA 3WO3B 2J8OA 5D2NE 1AZRA 4MAUL 2YPLA 4L8SB 4FMZA 4WTWA 1UXLA 4RA3A 1TQTA 3TTYA 2EXYD 2FWUA 1IU1A 5DQJA 3VGFA 4G5AA 1KB9K 1MCCA 1YQ2A 1EAPB 4YHIA 3AS3A 2DQGH 4UOQA 4YHMH 3EFFB 5DLMH 5B39A 4LPVA 1UKTA 1QSFB 1Z9PA 3EDFA 4PS3A 1DR9A 2XYBA 3EDDA 5F0MB 1KCWA 1N8ZB 2BP5M 1P9AG 3W9EA 2VWEE 3HG0A 1NAMH 1KYOK 5IVZB 2DLFH 1X5JA 2AQTA 4QHNB 2YPKA 4LNVA 1N67A 4WWKC 1AY1H 5T1DH 3WN6A 5J13C 3MUHL 4NIYE 5TE6L 4UQDA 4AJVA 1KPUA 2YIHA 2CKBH 5D5MF 1JZ5A 4U1GC 1CGVA 3BPOC 4NQXA 4ZFZA 2OMZA 3GMOA 4IRJC 2F58L 5KJ7E 1UD2A 5JO5A 1XQ4A 2BY2A 5DJYB 4LCIH 5KUMA 4DP8X 4PJ9A 3UERA 2D31A 4FQPA 3MRJA 4HIIA 5SWZA 2Q86B 1EHKB 1UT9A 2KDGA 4HUNB 3C5ZB 3MRGA 4X5WB 3MXWH 5E94B 4HWZA 5E6RB 5F1NA 5KYUB 4FXLA 2BS8A 5HDWA 3G5ZA 1CQKA 3LDBB 2MOGA 1JGUH 4Y9FA 2KERA 4AL8H 5CD3A 2CD0A 3WLWD 2YD7A 2WANA 1LE9A 1YCSA 1AC0A 2EDNA 3D6GA 1ED3A 5JIHA 3HZMB 3NESA 4X6EA 4BFOA 5D4HA 4DGYL 2G9HA 4XP5H 4NRYB 4GP4B 4JDZB 2UVFA 5IEKB 4YDJA 5AWBA 3WPFA 3MRKA 2DKSA 3ABMB 2BHFA 3VQ1A 1SXCA 1BJ1J 4LOUC 1CFQB 2HLEB 3C09C 4AITA 1S78D 3UGXA 4WY7H 3Q5TA 5EBWB 4TNWF 1IGIL 4FLQA 4N1CA 3D0VA 4YE0A 5EORH 1W91A 4FHBD 4X6FA 5HJDA 3SDAD 4AIXA 4ZNEA 1IBGL 1WJ3A 4HIXH 3S8FB 2CHXA 4X5LA 5L8KB 4PWFA 4R2GC 5IJKC 2A4EA 1L0XA 1NCNA 3QPQD 2OXHA 1C08A 4KNUA 5I15H 4H20L 4BGLA 2E9BA 1M7IA 1FN4A 3SBWC 4DO4A 3UXFA 2XTJB 1A9EB 5IB3B 3DI2B 5KYWA 4I0KA 4K2UL 2VDPH 4LSCA 2A0LD 3Q8BA 4FJ6A 4ZO7A 5MEQB 2Z0UA 4CNIA 1FGNH 4XP1H 4HVBA 4I5BB 7FABL 3CCHA 3FSZA 4F58L 1R46A 4ZMVA 1CTMA 3I9IA 3MLXH