The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
118
|
sequence length |
381
|
structure length |
381
|
Chain Sequence |
ASLEDFSIEQLPAKTIYALGENIDLTGLNVTGKYDDGKQRPVKVTSEQISGFSSSVPVDKQEVTITIEGKQKSFSVHISPVRVENGVLTEILKGYNEIILPNSVKSIPKDAFRNSQIAKVVLNEGLKSIGDMAFFNSTVQEIVFPSTLEQLKEDIFYYCYNLKKADLSKTKITKLPASTFVYAGIEEVLLPVTLKEIGSQAFLKTSQLKTIEIPENVSTIGQEAFRESGITTVKLPNGVTNIASRAFYYCPELAEVTTYGSTFNDDPEAMIHPYCLEGCPKLARFEIPESIRILGQGLLGGNRKVTQLTIPANVTQINFSAFNNTGIKEVKVEGTTPPQVFEKVWYGFPDDITVIRVPAESVEKYKNANGWRDFTNKITTF
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| molecule keywords |
leucine rich hypothetical protein
|
| publication title |
Crystal structure of a leucine rich hypothetical protein (BACOVA_01565) from Bacteroides ovatus ATCC 8483 at 2.05 A resolution
rcsb |
| source organism |
Bacteroides ovatus
|
| molecule tags |
Structural genomics, unknown function
|
| total genus |
118
|
| structure length |
381
|
| sequence length |
381
|
| ec nomenclature | |
| pdb deposition date | 2012-05-29 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF07523 | Big_3 | Bacterial Ig-like domain (group 3) |
| A | PF13306 | LRR_5 | BspA type Leucine rich repeat region (6 copies) |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Beta | Sandwich | Immunoglobulin-like | Immunoglobulin-like | ||
| Alpha Beta | Alpha-Beta Horseshoe | Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) | Ribonuclease Inhibitor |
