4FDWA

Crystal structure of a putative cell surface protein (bacova_01565) from bacteroides ovatus atcc 8483 at 2.05 a resolution
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
381
structure length
381
Chain Sequence
ASLEDFSIEQLPAKTIYALGENIDLTGLNVTGKYDDGKQRPVKVTSEQISGFSSSVPVDKQEVTITIEGKQKSFSVHISPVRVENGVLTEILKGYNEIILPNSVKSIPKDAFRNSQIAKVVLNEGLKSIGDMAFFNSTVQEIVFPSTLEQLKEDIFYYCYNLKKADLSKTKITKLPASTFVYAGIEEVLLPVTLKEIGSQAFLKTSQLKTIEIPENVSTIGQEAFRESGITTVKLPNGVTNIASRAFYYCPELAEVTTYGSTFNDDPEAMIHPYCLEGCPKLARFEIPESIRILGQGLLGGNRKVTQLTIPANVTQINFSAFNNTGIKEVKVEGTTPPQVFEKVWYGFPDDITVIRVPAESVEKYKNANGWRDFTNKITTF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords leucine rich hypothetical protein
publication title Crystal structure of a leucine rich hypothetical protein (BACOVA_01565) from Bacteroides ovatus ATCC 8483 at 2.05 A resolution
rcsb
source organism Bacteroides ovatus
molecule tags Structural genomics, unknown function
total genus 118
structure length 381
sequence length 381
ec nomenclature
pdb deposition date 2012-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07523 Big_3 Bacterial Ig-like domain (group 3)
A PF13306 LRR_5 BspA type Leucine rich repeat region (6 copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.3630 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4fdwA01
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 4fdwA02
2JQDA 4BV4R 2V70A 1IO0A 1OTNA 4FCGA 4G8AA 4MQWX 4FHOA 3TSRE 3WN4A 3UL7A 3C6PB 5B4PA 1FT8A 4U09A 4PERA 4WP6A 3RW6A 2ELLA 3WPDA 4GLPA 3ZYOA 3OJAB 4RWTC 2IFGA 4Z64C 3WPEA 3KJ4A 4IM6A 3G04C 5GMHA 1DS9A 4ECOA 1M9LA 3OGMB 3CIYA 4C2AB 4Y61B 5AWAA 2JE0A 1ZIWA 2XWTC 1XWDC 3FXIA 1H6TA 4R6AA 4GT6A 5AWDA 3RIZA 5AWCA 2Z7XA 1OZNA 1LTXA 2O6SA 4LSCA 4LXRA 4AY9X 3W3LA 2RR6A 4Q3IA 1Z7XW 3M19A 4LSXA 1PGVA 2P1NB 4U06A 3M18A 4PEQB 3W3KA 2V9SA 4FS7A 4R0AA 3G06A 3GOZA 3W3JA 4Z79A 4EZGA 4J0MA 5A5CA 4KXFB 3VQ2A 3C6OB 4U7LA 4R6GA 4LSXC 2Z66A 3VQ1A 4V2EA 4M7EC 2OMWA 1FQVA 4R07A 3OGLB 2Z81A 5IJDA 4QBZA 1U0ND 4PKIG 1YRGA 1M9SA 1OTMA 2P1PB 3G3BA 3OJAA 4V2DA 1G9UA 4CNMA 2P1QB 3DZEA 4CILA 4C2BB 5HDHA 1DFJI 3O53A 4CC4A 4Q3GA 4NKHA 2WQWA 5B0NA 4RCAB 4RCWA 1P8VA 1M10B 4P8SA 4L3FA 1OGQA 5IJBA 3RGZA 2P1OB 4BSUA 4Q62A 3ULAA 2OMZA 4V2CA 5GQRK 3UL8A 4LI2A 3E4GA 1K5GC 3OGKB 5CMPA 4CC4C 4QC0A 4Z8GA 4ARRA 4L3AA 2XOTA 4WYKA 3WPBA 4KT1A 3SB4A 2Z62A 3C6NB 2OMTA 2UZYA 2ASSB 2Z64A 4R58A 3E6JA 2A0ZA 1XKUA 2OMVA 3RFSA 4FD0A 4J4LA 1K5DC 1H6UA 2WQVA 2V9TB 4H09A 1JL5A 1SQ0B 3UL9A 4UFRA 5GMGA 5GS2B 2ASTB 3ZYIA 2WQXA 3ULVA 5HZLB 3G3AA 4K17A 1QYYA 3UN9A 2ID5A 2JE1A 1XEUA 4Z94G 5GS0A 3ZYJA 3WPIA 2UZXA 3E2JA 2OMYA 3WPCA 4P91A 4LXSA 1O6TA 3RW7A 4BSSA 5CMNA 4R6JA 1D0BA 2OMUA 3E3ZA 4FMZA 3WPGA 2R9UA 1KOHA 4FDWA 2OMXA 3RFEA 3W3NA 4XSQA 1O6VA 1M0ZA 1OTOA 2Z82A 4AW4A 4R5DA 1A4YA 4PQ8A 3CVRA 5B0TA 2BEXA 4R09A 3W3GA 4XGOA 3A79B 4R08A 2Q4GW 3O6NA 3W3MA 3RFJA 4OQTA 3WPHA 3G39A 1P9AG 2Y5QA 4XOSA 4B8CD 1XECA 3REZA 1P8TA 1A9NA 2RA8A 3PMHG 4HQ1A 4BSRA 5AWBA 4R6FA 1XCDA 4CNCA 5FTTB 3ZYNA 2WFHA 5IJCA 1KOOA 5AZ5A 4I6JB 1GWBA 1DCEA 4LI1A 3WPFA 2BNHA 3JB9j 2Z65A 4QXEA 2Z7XB 4NKGA 4PSJA 2O6RA 1WWLA 3RJ0A 1FO1A 5LFNA 4KNGA 2Z63A 3CIGA 4MN8B 4CP6A 4ECNA 1W8AA 4R5CA 4TZHA 4M7EA 3RGXA 2FT3A 3P72A 4Z61C 2WQUA 4LSAA 4YEBB 2P1MB 4U08A 4ARNA 1FS2A 1O6SA 5IYXC 5D3IA 3BZ5A 5GMFA 1OOKG 2CA6A 2O6QA 3ULUA
chains in the Genus database with same CATH superfamily
4Y1TA 1N5AB 4PJHB 4PRID 2FO8A 1RI8A 1RZQA 1B2WH 4KKBD 2B5IC 1JNNL 5HHOA 1IE5A 4BV4R 3QIUD 1T80A 2Y3NA 5DHEA 2HJFB 3TYGL 3OR6A 5KBMA 4QCIB 4BGDA 3ZLQC 5JHLA 1NGYB 4H26A 3P3YA 3H3BC 1BFVH 2UXTA 3O4LE 4ZPVA 3T3ME 4KKZA 4NYLB 1FN4A 1LO5B 2P8PB 3BLPX 3HHMA 4I4WB 3TSRE 2RJMA 4LEEA 1F4WL 5HI4C 1UXSA 3EZ8A 3KZ8A 1E9PB 3RUGB 3LB6D 3VXRE 3QC6X 3VYNA 1AYOA 1I3GH 1YEGH 3G5XA 3CXDH 3IRPX 3PP4L 4Y2NA 4Q97A 5DYOB 1JPSH 2QMKA 1IKNC 3KPMB 4HW6A 1KTCA 2D7TL 3CHSA 3MLVH 1I1YA 4ZODA 2ZSVA 2IXQA 2C34A 4QMEA 1QI3A 1XXDC 4OZ4B 1LO2H 2BVEA 4H8VA 5MENE 5F70A 3C08L 1V10A 1XWVA 2P5ED 1A6VL 1PNDA 1QSEE 4GXVL 3GXTA 3W37A 3IGFA 5SWSE 5DVPA 5GGTH 1IAMA 5L4MA 2EO7A 5D7IB 4GKNA 4PYHA 2H9GA 4JPWL 4NO2B 1KBKA 2VT0A 3KGTA 3PV7A 2ATPB 1XR9B 3HG2A 3B9KD 3PLYA 2BHYA 1UM4H 1JK9B 4Y61B 1PG7L 1EHAA 3EDEA 1LM8V 1YMME 3GSUB 3CZEA 1SMAA 3F7RA 1UWEL 5FKAA 4W9HC 5LGJB 1XF1A 2BVUA 2R2HB 3JSSA 2BZCA 3U82B 1U9KA 5IMKB 4WI9A 2OZNA 1QFWH 4M62H 3ULAB 3FUMA 4MXWL 1FHGA 4ICWA 1NFIA 5KSUB 1SHXA 4YGAB 1I7UA 2IBZX 1WZ1L 4UUJB 1KF9B 2Q7AA 4QRFA 4WTQA 3IVKA 1UGNA 4N3UA 5CJ8A 1T1ZA 3LZOA 2X09A 3EFOA 2JJWA 4LO9A 5F3FA 5JPNC 4GO9A 5D55A 1LNUB 5FA3B 2YMXL 2YSTA 1Q94A 3RU8L 2V9RA 2XZCL 3HPLB 3WNJA 1II4E 4KV5E 2XZAH 4BM7A 5ANMB 1FL3B 3ABZA 3QRBA 4M7JL 4N8UA 5I2IA 1N18A 1AP2B 4NHUB 2N0KA 4JJOA 4AW7A 3H2PA 3HFMH 1WAAA 3D0VB 3VCLA 4F2MB 1T4KB 4PY7A 1G94A 5JW4N 1UD5A 4LSSH 2G0LA 3IK2A 3HS0B 1UM5L 1F13A 2C3XA 4GIAA 1ADQL 2WWNA 4L4TB 4OF7A 3I50H 2BIPA 1AIFB 4WSKA 4XN8A 5AW0B 1T5WA 1XZ0A 3FCUB 4WEUD 1FNGA 2CKBL 4AYGA 2XHNA 3H54A 1OQXA 3LQMA 4XP6H 5FYJD 2XUWA 4WFEE 2NY4D 3TT3L 4WI3A 3WLWD 3NCBB 2KYIA 3CCHA 3MLUH 3W3JA 3VTMA 1SY6L 3BIAX 2ARJB 2CO6A 5F7HA 4IGBA 2WNWA 3MV8E 2MTPA 3MXVL 1RHFA 2JV6A 4N2KA 2D7PA 3AY4A 4UT7H 1OOAA 1NLBL 3BUBA 43CAB 3E80A 2XQ0A 5B1JC 3TPUB 2BNRD 2ESVD 4G8FA 3VQ1A 5CMAA 1YN7A 5B1CA 2C26A 3PRZA 2UY7B 3D85B 3KR3L 2BHUA 2PPDA 5AW9B 3ARDD 3SDYH 3D3VE 5HYSA 2AITA 4RAVA 3D30A 3P77B 2DLGA 2Q3AA 2XN2A 2YFOA 3ZY7A 1PZDA 2OMYB 1B2YA 4OAWB 1H9DA 3NJMA 3JUYA 5ANHA 5EBWA 1SEBA 5EH1A 4MKMA 3ZQ9A 2R69L 4K3JH 2PPAA 3VFSB 5IJDA 1OAUL 2BZDA 1GTFA 3FT3A 2K8QA 3MREB 4LCWD 2VDRH 1HYSC 2GJ6A 5J6SA 4QBZA 5DFAA 3FQRA 5IW6A 5AUMB 1EBPA 2CHDA 2E59A 1J5OL 3VW3L 3N44F 2NZ1A 1AR2A 4LPVA 4F7TA 2OJEB 4YLQT 5GRUH 1XCWA 2WKOF 1BJ1J 4TQIA 3FOLB 5TF0A 3M17B 3OC8A 3DDGA 2JI1A 4XRCA 3S2AA 5ESQB 2B59B 2QKIA 3EYQD 4P9HL 1VRSA 3VNYA 2AQRA 3VU2A 3L3GA 2NY3D 3LRKA 5KVGH 4AX3A 4Y4KD 2I7SA 2NW3B 2D8KA 4PY8J 5KVGE 2VN7A 4V11A 5FOJA 4BCYA 5GS0D 2WJ5A 3K0WA 5SWZB 1QSFA 4JKWA 4NI3A 3RY6A 1RY7B 3BUIA 3UTSD 5KSAC 1AG0A 2FX9L 2XFXB 5HGDB 3UAJD 3FPYA 4YGVB 4DESA 2W07B 4MMZA 3WEOA 3KPRA 4HKXB 4AH2A 2HCZX 1IZJA 4WIQA 2VLJB 4RCAB 2BSED 1P7QB 3F3HA 4DN3L 5A6IA 1U2YA 5DRWB 4P2CG 3IDXH 2R1XA 4KXDA 1AZVA 1HI6A 1WFMA 2A2QT 3HE7B 4NBZB 1B0WA 1Z9SA 4P8SA 2P5WB 4JKLA 4LEBA 3C5XA 1IAIL 4AVKA 1KIRA 1CG9B 1IKFH 2P1OB 4JFEE 4BSUA 1RFDH 3ZR6A 4Q62A 3TO2A 1I8MB 2XFGB 1NGPL 1A3RH 1ZVHA 2HT4D 1K5GC 1RIHH 2XRAL 2O26U 3VFGL 4L8SC 5J89A 3FN3A 2ADIA 3HRZC 4BZ1H 3HMWH 4IDLA 3MA9H 4KTEL 1VPOH 4IRSC 2W65B 2MQCA 4QYOB 2V6HA 4KKLC 1P84K 1BOGB 3CC5A 4R8WL 3NSFA 4BFOA 1MG3C 3IWVA 1OW0A 2NZ9C 3MNZA 4BH7A 5GJTH 2I24N 1SOSA 1ZWIA 4YNYB 1OE3A 4EE2A 3WG7B 4J4LA 2WQ8A 4X83A 4K7FA 2NR6A 2OR7A 1E3XA 5J11B 3ZGIA 4JO3H 4OFYA 3ZQWA 3MRQB 1EZVY 2CM5A 4FKHA 5SWQA 1AKJB 3VXOA 1FNHA 3W0WE 4WW2B 1P7BA 4GKZA 3ME0B 1HXKA 3QJXA 5D1QB 4MQ7A 5DD5H 1T3FA 1U8CA 3BP6B 3HB3C 3QFJB 5BRZA 5IM7A 2DQEL 1NBZB 5CJOH 2FJHA 1OAKH 4NO5B 3WSQH 2APBA 5ERWB 3RWCA 3FRPA 3CX5K 1BWWA 1F42A 1M7XA 4OZHB 3ZZ1A 1RZ7H 4F7CA 5I9QC 3EGXB 1MCWW 2A73B 5EEYA 4WO0A 2IANB 2P80A 1M57B 5DD1H 1EEZB 3RIKA 3JYCA 1FLRH 1D6EB 4NQVB 2IBGA 2IH3B 1TIUA 2RGSA 1BM7A 4LCUB 3M8OL 5A6LA 2FYYB 1YEKL 2VRAA 2FLRT 4Z7NB 1OEZW 1QABA 3CPLB 2G4EA 5T1KD 4P5TA 1XO8A 4AQ1C 3H9SD 5ITFB 1IBFA 4LRIC 4XMLL 4PJGE 5IVZA 3WFDH 4JHWL 2MEJB 3GSWB 4PJ9B 2WZ6A 1WBZA 2IIJA 3S5YA 1AHWC 3N43F 4P46C 3CMOH 3TBTB 5A6MA 3IKKA 3GHEH 2E0PA 3HNVL 1YPZE 4R6JA 3GXUB 1KXVC 1RIUL 2XICA 5JZ7C 1BYPA 1JVKA 1K3IA 3CFMA 3CDGB 4YFDB 3DX0A 2C4FU 5FDWB 4AEEA 4DK3A 4LU5H 2GCYA 1DN0A 1BLNA 5GGSB 2OMXA 2VC2L 3O2WL 2ZZUT 3HZKA 3RFZB 3IJEA 4G9FE 1NCGA 1GJUA 3P3RA 5ILTH 3GRWH 3VFWA 3JTSA 1ADWA 3ZE1F 4F7MA 3CHPA 3LNGA 3O53A 2ZYIA 1EZSA 1YNLL 2Y5TB 1S9VA 2P44B 3SBWC 4XCEA 3MOQA 5ACZB 3DTDA 2BY3A 3SJVA 3A6OA 1OE1A 1GYWA 1S9YA 4PJ8C 5DFTA 1E2ZA 4ELMB 1RZIB 1CZ8H 2CDGB 2QTVA 4A6YB 5EF2A 4Q6KA 1J0IA 3SPCA 1JHLH 4XO3A 3QWOA 4H20H 4PV8B 3BPLC 1KDJA 3K5SA 5D8JL 5DEZA 2ZPKL 1X7QA 4HXAL 5E5UB 3ESOA 5KSBF 2RB8A 4U0QB 1ACYH 1MY5A 2W59A 3VFPA 4K94C 1K8DA 5CF3A 1MIEH 2AKRB 3VXPA 4R26L 5KYUB 4GW1A 3T0ED 3ARFA 4IRJD 4G9DB 1CN4A 1X5ZA 1UVQA 2WZPD 4MA8L 4N85A 4XP5H 3UZVB 4WWID 1ZOXA 1D5XB 3D69B 4OIIH 5GHWH 1ASQA 1IM3D 2XNAB 4R0LA 3F6IA 2JMRA 3OQRA 1WDAA 1W91A 4RDQF 2OFQA 4XNXL 2H6PB 1SDYA 4GT0A 5F3HA 2PYFA 4TSBH 1VF5C 4YBHA 1ZHLB 3N50A 3V7MA 4AENA 2HH0H 1LWHA 4ZFOL 1JHKL 2WVTA 2BWIA 5F7MC 2CMRL 4XC1H 3T0WA 4MS6A 3K6SA 3D2UB 1AS6A 4AG4L 3UG4A 3LH2L 5DS8A 4ETQB 4HX1B 5GZOA 5BRQA 5C0AE 3WPFA 4GBXC 1CFTA 4JR9L 2CR0A 4RQQB 4LHJB 4M1CD 1CICB 2DH2A 4JG0L 5FHBL 5E56A 4PJ5A 3EH4B 5FM4A 3OAWA 4U05A 4MVBC 4DTGL 3HPJA 2A9AA 4JN1L 1U58B 1UOLA 4N0UB 1MREH 4FQ1H 4J1UB 4GXFA 2YGQA 3GJFK 3SOBL 5LFNA 1A7OH 1DO6A 2X4QB 5JW4Q 1OPGL 3IS0X 3O6KL 3CIGA 3VXMB 4HHAB 3NEEA 2F53A 4PRPA 2VCOA 1DN2A 1P2CB 1NPJA 4WF7A 4RGNE 5KYWB 3W11C 4MQSB 5F88A 1LK3L 1QLFB 4I18A 5J3HC 5JIDA 5HVWA 3NDZE 3DOSA 4TZHA 1JDCA 3S8FB 2GEEA 3P72A 4HJJH 1QTSA 3F8UB 3INUL 1GOHA 4DGWC 2DWTA 3FO0L 5L4FA 1JGVL 4P4RB 4X6DA 1FZMB 3LSOA 1RULH 5KTEL 3C5ZD 3L3KA 1DVTA 1A6UH 4UDTA 5LAXB 3QIBD 1A0QL 4Z95L 4NGHL 2E4TA 3RJDA 1XGYH 3AMKA 4FNQA 5T1LB 3STLB 5C2UB 3ARGC 5CLZA 2ODHA 3STZB 3A4EA 4JM2C 1UENA 4DCQB 5TH2B 4MAZA 5J4MA 4JHAH 5ES4B 1ULVA 1PYWA 1CR9L 3BGFB 5KYYB 4HJ1A 1IILE 1SVCP 1R3KB 1TU2B 5IB5A 3UMNA 3UO8B 1CDHA 3FO1A 2Z8SA 5JLZA 3RZCB 2DMGA 4FCGA 3O3BA 4R4BA 5JNYA 3T2NL 1NDMB 5CCJA 1ORSB 3B8SA 1HEJC 4NUQA 3ULUH 4JFWA 5FB8A 2ZXEB 1Y6MR 1MFCL 4MNQD 5CP7A 5D4JA 3ZYZA 3ULUE 4YSTA 2AI0L 3GBEA 3O81A 5H2BA 3VD3A 3JWOC 1OZTG 4Y8AA 3C6PB 4P06A 5IFHL 3CN4A 2XXFA 4JPKL 4YPGB 1ADQA 2DWDA 2K1MA 4F5CA 4JZNB 5HHVL 4GI6A 3ESPA 1AD0A 3T4YB 4Z7VF 1Q0XL 1DVFC 3E1F1 4G7VH 3J7HA 1BJMA 2WHVA 1UXLA 2W91A 5IQLA 5K59E 2XV0A 1U8OA 2VLRB 4KAQH 4XT1C 2BOLA 3V4LA 2JJSA 5HJ3B 1CE1H 4JFHD 5EDXA 4QGTA 2CDFB 4MYWB 4OD2B 1O9WA 3LZQA 5EO1A 4B9IA 3VI3E 3D4YA 1SY6A 4HIQA 4WFHE 3VGAC 1DS9A 3FKUS 1JTPA 6FABH 1FNEA 5DHYA 3CIYA 4J3XA 5D93B 4MS8D 4E5XA 1THCA 3QRLA 1T2QH 4ZW3A 1JCKA 3PHAA 2VE6A 1FG2A 4Z3IA 5C0RL 2IOOA 2IC2A 1BF2A 4HSQA 4I2XA 4W93A 2UX6A 2A9CA 3CJJA 3KBHE 1N3NB 1E9OB 4AYDC 2XA3A 3EYUH 4JQVC 4TNVK 1IEBB 3UO1H 4CVXB 5LO7A 2R23B 1RV6X 2R69A 2A74A 4JHVA 1WK0A 1OV8A 3X2QB 1QLRB 1WF5A 4LSRH 1R1CA 3C12A 5IBLC 5IESL 3N42B 4M5YL 3LNHA 1SUHA 5C08B 1KNOB 4UDUB 5DTFB 5AWCA 1QW8A 4JUTA 4M5ZH 4FQQB 2O6SA 4G8IA 1R3JB 2BC4B 4NAQA 4U1IB 3OKEA 3EG9B 4TQHA 4C58B 5KS9B 1MI5B 3PP3K 4TVPH 1FH5L 1MQKH 4ONFH 2H1PH 4CRPA 2DYSB 1E67A 5FM5M 4AGMA 1J9CT 4MDIB 2A6KB 2V9UA 5EU7E 3PQYD 3WFHA 1YY9C 2Y3AA 2E9WA 4JM0A 4AQ8C 5HVHB 1RZJH 3CDFA 4NLHA 3TGXA 3DX8A 3ILPB 3INOA 1UUSA 2P47B 1L9SA 2WIIB 1E8XA 3AY2A 3MRPB 2ZTBA 3JV4A 3JTBA 2YSSB 4RMTA 4JKPL 1P5UC 2VH5L 5DMYA 4N0RA 2SEBB 4XXCA 1G9HA 4RGNC 3IMSA 1LDPL 4JQIA 4X6EB 2GC4C 3VM5A 3K3QA 4J3TA 3FTGA 2BIHA 5AAWA 3LV3B 2WMPB 1DBAL 4OLEA 2MPVA 3L48A 3NCWA 1TFPA 4JFZL 1FFRA 2BSDA 3JT2A 4PJDE 5E2WL 1MFEL 1ZVNA 1Z3GH 2AV1A 2ZUQC 5D1ZI 2Q86A 2HX7A 3BZDA 3BCFA 1LEGA 2UYLB 5AQ0A 3NH7L 1NBCA 3IJHA 5F7KC 2HFFB 1INEL 3QA3A 3ETBJ 1DDHB 4AV5A 4OI9A 2ZX8A 4ZUSA 3VRLE 4JFOA 3RGVA 2JLPA 2FT7A 2YXFA 3N1MC 4KJPC 4L0YA 5SX5H 4Z9KB 4TULH 4EIZC 4K7PX 4JBSA 4OZHF 1OE2A 4QRPA 3K6DA 1C16A 1WAAF 4FG6C 1JGDA 1WA1X 3RWDB 4L4TD 3HBPA 5I28A 4DWHA 3WFCH 3AU1B 2X70B 3DX3A 3UXFA 4Z7NF 7PCYA 4TQEH 3VWJB 3VG9B 2KC0A 2F54E 3EJRA 3H9HB 1DSFH 2R2BB 1YLBB 5GS3A 4G6AD 2ZKYA 4WJKB 3QXUA 3ULUC 3AACA 4EUPA 3DIVA 3P4NB 5IW1B 4JDZA 2ADGA 3HI6L 1JZ5A 2Y1AA 1SJHA 2BXZA 5L4JA 5HPOA 1FZKB 4G6JL 4PJCE 3GKWH 3IJYB 1G7PB 1SN0A 4PIRF 3TBYB 3TVMA 1ZT1A 2OXGA 3GSRA 4XHJD 3MRKB 4GFXA 3HI1B 2WAHA 1HZHH 2QR0B 2QSTA 2LW3A 3D85D 3GSQB 4NQDE 4ZMOA 2EZ0C 4YDVA 3TZVB 5I6OA 1NIFA 2F5AH 1M1XB 5EUOA 4OCYL 5AWNH 3T3PF 3PU7A 5FDYA 3OKNA 1LYQA 4M8VA 1QBML 1X4XA 4A7GA 2P43B 1RK0B 4PJEB 5TTRA 3QHFH 4WZ9A 1S9WB 1XMWA 4ZXBC 2MWCA 5L6YH 4BQCA 1FC1A 4K3EL 2AJZA 3MSPA 3PFUA 4I88A 4X5LA 1J1OL 2JB5L 1LJMA 4BRVA 4XPGL 4IHOA 4G5AA 5T3ZL 2EXWD 1W6LA 3QUMB 4E9XA 3QXDB 4J28A 1A6ZA 1RJYA 3L1OH 1KEMH 4WV1B 4NQTA 5BQ7A 4HLEA 2NPLX 4ELMF 3WTWA 2Q7NA 3AW5A 1A4JA 1MCLA 5CJBA 3HBQA 3NJLA 5T33H 4Y2DB 1FL5B 3SZKC 3BMVA 4F92B 1I85A 4KO7A 1HS6A 4U6VL 3RWFA 2Z62A 3D39E 4LF3A 5FYKD 4IKIA 4NEHB 3SDDC 3C6NB 2VWEE 2VL5A 4N86A 5SWZD 2V5TA 3S8GB 1MQ8A 4XNQA 2HJKA 1AGDA 2OL3L 2BNQE 3ARTA 2X6UA 2DRUA 3D12B 3GF8A 3PWLB 2BSBA 3LXCA 4X0KB 5CGYC 2XPYA 3PGFH 1A8JH 1K4CB 1VIWA 3QPQC 4BFIB 1XTLA 2VLJD 1P7QD 2DQIL 3QNZA 4YXLH 5C1MB 4E9LA 3ISRA 4LCCC 4UT9H 4ZUWA 3TBSB 4OLWL 4AWJC 4D8OA 1RP8A 2XKSA 4HV8B 3FNKA 5EOCJ 3HE7D 1ED3A 3FXIC 1K5DC 1NZRA 4Q9RL 5EU7C 4L8CB 3FULA 2YRPA 4PRAB 4HUVB 4XPBH 2WQVA 2ZXDA 3L95B 3RWEA 1J1PL 4P57A 5DGRA 1RZJC 3HMXA 3FQYA 1I1CA 3RVUC 3BAYA 2F8VA 5D1ZB 3MR9A 2G3MA 2JI2A 4N90D 2DLHA 4JFYB 2VN4A 5C6PB 4XXDB 4ERSL 2Y22A 1QRNA 3P30H 2AXFA 3TIEA 5CU5A 4ELDA 5A2KH 3BP5A 4PWFA 4LAQH 4YUEH 1RIVL 1J8SA 2AANA 2X87A 1KGXA 2QQKH 5IHUH 5T5FH 3DX6A 4MJIA 4I48A 2V8MA 1I3RA 2QZ5A 1USQA 4HJUA 4NPJA 5IMOB 1E7UA 3WNKA 4OF5A 3N0PB 3SDAB 2XX0A 1KIQB 4WFFD 5JHDB 2ADFL 2GT9A 3AJ7A 2OX5A 1H15A 3SCMA 3BSZH 1SZNA 1NA8A 2IPKB 1X4ZA 1JHTB 1M2VA 2P28B 5K9KB 4QKTA 2QFRA 4ZFOA 4FQXC 5CSGA 1JWMB 3W39A 4X7CC 1UXWB 1AKJD 1C08B 1YEJH 3U9PL 1S9XB 4NQSA 2YA2A 4FHKA 5FYLH 3O45A 4NZDA 2NNCA 5D1QD 1P84J 2FBJL 2YUZA 1PZ5A 2PTUA 4KK6C 2NX5A 5FYLE 3AWEA 2K4WA 4ACPA 4ZMVA 3MUJA 4GMSL 1D2PA 2R1WA 3SO5A 3FB5A 2Z8WC 2R0WL 3N55A 1QHPA 2A9BA 2YPLE 2UV3A 1NEZA 4L5FH 4XNYL 2IAND 3ARBB 1O7SA 1IGYB 3IDNB 1KGYE 4L5FE 4ENED 3EO0B 2WTPA 1EERB 2WYHA 3U4AA 2FQEA 3NJJA 3ULSB 2H3KA 2CM6A 1RJLB 2GBVA 3GTVA 4H8QA 3WJMB 4PJXB 5MHSE 2FQGA 5GRJL 1FJ1A 2DMKA 2J6EH 1J8HD 2AJXL 5LUMA 4OZIB 3T0BA 5DZAA 5EBLB 3C60C 4JFDB 1HX0A 4PR5B 4G80A 4NUJB 1I9RL 1JPFA 4F7EB 3CX5J 4JLRA 3FHAA 2VERA 4JRYA 2ZXAA 4PJ9D 1A4YA 2QVIA 3WIAA 4JMNA 1PVHA 3MFGB 1KB5B 3S3PA 3UPAA 2J8UA 2BEXA 4R7NB 3VU1A 4X99B 4EAEA 3O6NA 3L3JB 5JYMA 4ZBJA 2QSCL 4ZUUB 5HGHA 3RFJA 2ORBL 4U1MB 4PSRA 3OX8A 3KJ4B 3VJ6A 2DQCH 5PCYA 3FUJA 3NJIA 4FNTA 1OIOA 3WPHA 4ZS7L 5DHVA 5D70H 2CRYA 5B21A 1CYWA 1F2XK 3CFIC 2UXVA 3U9WA 4B8CD 3A6CH 4NZRM 2EDBA 1A1NA 1U42A 3QDGA 1NWOA 3C2AH 3M7FB 1DBKL 2DQUH 1SOQA 1VZIA 2GPZA 4OCXH 5I19L 2YBGA 3CSYB 4M6OL 5JO5B 2H47C 5FTTB 3UTZA 3VYPA 3ZKXB 4Z7WE 4XC3H 1B9ZA 1BG9A 2LVCA 2WWKT 4M6ML 4NXSA 4XNZC 2VWEC 4HJGA 4MA7H 1EUUA 2MCAA 4GMTL 4NJ9H 4WUUA 3AVEA 4YAQA 4WWPA 2AK4A 3L5WB 3HZ3A 2R0LH 3MBEC 2VXTL 1FFNB 1LO3H 4N6QA 1PIGA 1JZ7A 4U1JA 1ETZB 4OKDA 4JO2L 2YD8A 2MCPL 4PSJA 3UTQB 3VACA 2ERJB 1KCUH 3Q9PA 4YSAA 5GRWA 2BVQA 1UKTA 1CUOA 3V4PL 4Z78B 2C7FA 1OSZA 2HT3C 4X6FB 2YAPA 4S0SD 3DROA 2BCKB 3NCMA 2WBJD 3IF1B 2Y7OA 4JY6A 4NDMB 1TQVA 4DP1X 2PCXA 3IGLA 3B6SB 1JZ2A 1H0DA 2Z91B 3MJ8A 3LPPA 2WNKA 1DQLH 3D2UD 4KU1A 2P26A 3FTSA 1TJIH 3SQBA 5IIEB 3ATEA 4PRIE 4LSAA 2HLFD 2XVLA 4U1HA 3NIGE 2O5ZH 2ZUSA 1Z5YD 1N7ML 2HUHA 1CICD 5HYJE 4X7EC 3MGTA 1A6PA 1MVYA 1MAMH 2LFGA 3GMNA 5T5NF 1A1OA 4Q0XL 1KJ2B 1TCRB 5DD3L 1JXFA 1MN4A 4N1EA 4UINL 1BM3H 5HHQA 1BQUA 4L23A 5IV2B 1T6WA 4L8DA 4BWUA 5MP6L 2UVEA 4OCRL 1CC3A 1M6OB 2B9AA 1CD0A 2ICEC 3AITA 3VXMD 3DBXA 4LOVA 4G8EB 2P45B 2Q76B 3KBFA 2EEBA 5DR5H 2Z0BA 3L1GA 3WXVH 5CJXA 2C3VA 3N04A 3MRJA 2JQMA 2PP7A 3FOMA 2V17H 1A5FH 4NZTH 5HDOA 4WKZB 3OSVA 1DEEB 2P5EE 4N87A 4U6HB 2YKLH 5AYUL 5T1MB 4GG8A 2HRGA 3O8XC 3VD9A 4K7PH 1DCLA 2COVD 3Q2NA 4KKCC 4YHKL 3D25B 5B4PA 1JBJA 2JIXA 5C9KA 1UACL 4LKXA 4X6DF 3U1SH 4PERA 2K3HA 5DVMA 3S8WA 1HHGB 5H94B 5HJDA 3TF7C 1DLHB 4BIKA 4N9GA 1V7MH 5TQ0L 3PDOB 4NHCH 5JDJA 3WPDA 5IQNA 4LFHD 3HG1A 3WFZA 5T1LD 3HR6A 4EXPX 5AVWB 5I5MA 2NY2B 4G7QB 5D9SB 4PLKC 4RWTC 1SLXA 4QRRA 2QPUA 2YJQA 5C09B 1V8HA 3W38A 1NWPA 1KIPB 4ZT1A 3TBVA 3DK0A 3MRIB 3RZCD 2WSDA 4NCC1 2KS0A 1GGYA 3UTOA 3V0WL 1KC5H 1EANA 1BXAA 1MAKA 5C9JB 5D7SH 5D7EA 2GSGB 25C8H 4HU8A 2G2RA 1T2XA 3EH2A 4HS3B 1A02N 1QUPA 2XWTC 2H32B 1GAFL 5DRNA 2AJ3B 3FQXB 2FO4A 3MLWL 3DXAB 3FT0A 1B88A 1KCVH 4M6NH 5FK9A 4HKZA 5FGCE 3DHPA 3ELAT 3B34A 1Y6NR 3RX5A 2R8SH 3P11H 4FCAA 4C54A 4OCSH 2OYMA 2PKDA 2VLRD 2ZG3A 4WFGD 2VABB 4ELKB 1XGQA 3AS0A 1HKFA 4GIPD 1AO7B 2QJDA 4FQJL 3Q6FA 4QLWA 1LHZA 2VXUH 2IDCA 1AQ8A 2YD0A 3KWUA 3ZRSA 5FYJH 2AEPH 3WFEH 2VDMH 2D7NA 4X4KA 2FSEB 1AY1H 3MRFA 3MCLL 2Z4QA 1QTYT 2BS9A 5FYJE 1IMHC 4AY9X 3QDMB 2VXQH 1CXLA 1E3FA 5IJCC 4MJ6B 4Y5XB 3II1A 4AJ0A 4NIYE 1EEYB 4UTBH 3X3GH 8CGTA 4S1RH 1KJMB 2HXAA 4NUGH 4BE5A 3LIZL 4PI2A 4JVUA 1VFAB 3WLBA 3KGRA 1YEDA 4GI9A 4X42A 1HL8A 3V8OA 4I0CC 1ZVSA 2Z34A 4ANKA 1WBYA 2NXYB 3DTXB 3LEXB 2DQGL 4OFQA 4PB0H 2DQMA 3GLAA 3R06A 4RBPH 3Q44A 5C08D 1GHFL 5TGBA 5DO2D 1T5KA 1X6NA 1Z5LB 4AE0A 4KKBC 3WI9A 3VQ2A 4J3OD 4TMPA 3VFNB 3OR7A 2YK1L 4M4RA 2DLFH 3QIUC 4LCWE 1ZLVK 2VLLA 1TCMA 3CZUB 4U7LA 1MI5D 2J5WA 1S7VA 4IOFD 3MO1B 5F0PB 1U3ZA 5BW7C 3ZE0B 5L9DH 1G7LB 2DN7A 3ZKSD 4WKXA 2OMWA 1HNFA 2R27A 5D5MA 5ALCL 3T4AC 5A3ID 1QFUL 4G7YH 1OCRB 1RLWA 4FE9A 4L8BB 7FABH 2VSKB 2A6JB 3B1UA 5EU4B 3LB6C 4BCZA 2YMTA 3BAXA 2OL3A 2V33A 4PRNA 1MVUB 3G08A 1SDDA 5TE4L 5GS0H 2AC0A 2QQQA 5G2NA 3ZE2B 2OJZL 3KD4A 3QUYA 1G7QA 3UTSE 1ZJBA 1AR1B 5F7BA 3NRQA 5I1GL 3REWB 4PG2C 3CFCL 4XO8A 1M9SA 2CPCA 1DQMH 3TH2T 3QEQB 4ZMAT 4KK9C 4IU2A 5GSRB 1GPOL 4JFPA 1TF4A 1SEQH 5J13C 4XBGB 1MFBH 2C9VA 3GM0A 4DOHE 1MCOH 2NUTA 3GMLA 4NKIL 1H19A 3GMOA 3IGAA 1R5VB 2HJLA 4HUMB 4MD5A 5J12C 3RG1C 4MZ2A 3CZGA 2ITDB 1KELL 4NN7C 3VWKB 4HOZA 2H8PA 1IAOB 4JY5L 3CN0A 1T66D 3HUJE 5DFWH 3UCQA 5KZCB 4F2FA 2C1PA 2ZYSA 3KPPA 5D71L 1TZIB 3MUGA 1TZHB 2FNWA 3QORB 1Q0YH 5CILL 1M10B 2FJUB 4BFGA 4G1MA 5E1AA 3V5KA 4M43H 5MERA 4YC2B 2DQFB 1B3JA 3RHWF 3ZTJH 4HWEH 4AYBA 3CIQA 5I1EH 4KJYB 4H7VA 3VWJD 2UZPA 3E3QC 2OR9L 4XN9A 4P07A 5CZXC 4AXWB 1S7SB 1H3UA 4LKCA 2EQDA 4U1NA 1F1DA 2E8YA 2AMGA 1B2WL 1RSFA 4TPRH 3M7OA 2N7AA 2FEDD 4YHLL 1E8YA 4KI5F 3FCSA 1ZSDA 3ZT6A 1CU4H 5FOBA 3UTTA 3P9WB 4F1ZA 2Z8RA 4L3AA 2HTLD 3VH8A 1BFVL 4K15A 1LO0H 3OHXB 4LSTH 4QXWA 3K8MA 2Y7QA 5H37H 1P4UA 4UIKH 4XCNB 4XPTL 4CMMB 2EIKB 3TZVD 3ZO0A 4D94A 1LILA 3V0IA 3NZHH 5IJBC 1VACA 1JPSL 5EUOF 3GGWA 3TV3H 4A7GF 1A66A 5HDBF 3CZKA 3RL2B 1KLFA 1J10A 5IMMA 5GGUA 3S3DB 3PWPB 2NY4C 2GC7C 3LKQB 4HSAC 3AT8A 3DO3A 4UM8B 1JYWA 1J0KA 1UCBH 3FH7A 2BP8A 3QWRD 3P40A 5GGTL 2P7TB 1OZUA 4X7SL 5D96C 2X4TA 2Q2EB 5IB1B 3OZ9H 1L9RA 2AVGA 1F2QA 5EOTB 1T0OA 4KRMB 5DHDA 2JNZA 4Y5YC 3MODL 4XVUD 3GBLA 3BEWA 5BMFL 3ARDC 3FB7A 4LP8A 3IDMB 5FHAH 5EZJA 4BKTC 2HN7A 3V4UH 3P73A 1WT5C 5BV7B 3QJSB 4KY1H 4CN4A 1N9PA 3O3AB 5EBGA 1QYYA 5C0JB 3EF4A 2OQJA 4DNLA 3G5WA 1ZRUA 4HIEA 4YBLB 2ZUTA 1HJBC 1RU9L 2H4EA 2Q5BA 2AGJH 4QRTA 4B0MB 3NCXA 3QCTL 3MTRA 4ADIA 2FB4L 5I6PA 2N3JA 1U8NA 3H4HA 2G5UA 2CO3A 5SV3A 4KKNA 1FFTB 1FGVL 5LNEA 4H5SA 3IWUA 4M02A 4BSVA 3UBXI 2I07A 2XV6B 1MCKA 2HVBA 5D6DA 5AZEH 4PJ6A 2CLRA 3EYQC 4F57L 2XZAL 4Y5VB 1G4RA 1WUNT 1S8DB 2CAKA 3GNML 2F7RA 2F7QA 5D1ZD 4NFDA 3G7TA 4JJ5A 1SF5A 5CZVL 2BXYA 4NNYB 3U0TA 43C9A 3VE0A 3UDWC 2FAUA 4JFVA 3AFLA 2QL1A 3SYOA 5H8DA 1KOHA 1TDQA 2YRLA 4LEXL 3L1FA 3ISWA 1IL1A 4CGTA 1FO0B 3V4PA 4P5SA 4TTGA 1NIDA 2MPAL 1V3KA 2RFXA 4WUKL 2Z31B 3GSNB 5CEXB 4E42A 2IV8A 1UB6A 1S7WB 3T0EE 4XP6L 2V5YA 1PCSA 3MV7E 1AE6H 1ZD6A 1KGWA 3SKJH 1NPUA 2VQ1B 3DKHA 1DQJB 1Z9OA 4LSQL 3BYYA 3V5DA 4PGDA 4DUWA 5E1GA 4UM9A 2HT4C 3VTAA 2QHRH 4F2EA 1WVZA 3QEHA 1A65A 2H45A 4FXGB 4MX7A 3QZWA 4G7SB 4AT6A 3HC3L 4KFMA 2Q4GW 1VKXB 3DPBA 4YZFF 4EPSA 1QO3B 3BUQA 2XV2A 3T2LA 5A2BA 2J8HA 2AV7B 3A67H 4EN3C 2VDKB 4Z0XA 3ARBD 4NRXA 3TBBA 4FFVD 3COOA 3BC9A 5E70A 1EHKB 2G0KA 4ZFZA 1DQTA 2VZ1A 1J1XL 3CFEB 2VDRL 1H5BA 5DJCB 1F45A 3L81A 1NAMB 1VADA 4OD3L 3H9ZA 2XZQH 3GS7A 3WD5L 1J05A 3DSFL 4JFDD 4QOKA 1D7DA 1I8IB 3DYOA 3BXNA 3KLDA 4IU3A 2VDPH 1F4HA 3TWCH 5JR1L 2PN5A 3ABMB 5EOCH 5E24E 1P5VA 4WU7A 3Q6GL 4QRQB 3ZTJG 1FIGH 4UQCA 4H2CA 4WJG3 5ICUA 1WJ3A 1MHCB 3GMQB 3EO1A 1CLYH 4LOUC 1NMCC 3KEDA 4JDEB 4QXEA 3AREB 1XFPA 1SXAA 4JRWA 4Z3HA 2EYTA 2YPVA 2O6RA 1FORH 1U93B 3V4VL 3WIHL 4Z1PA 2KZWA 3O4OC 4R97B 1PLGH 4U6XA 4H8WH 5EU5A 3BI9X 4RFEA 4Z76A 4RZCB 2G2NA 1BV8A 3WJLC 1QTPA 3ZDXB 3O2DL 4HWBA 4Q6IC 5IVOA 2MCG1 3TCTA 2FSDA 2Y6TE 2R0KL 2GI7A 3L9RA 4X9FA 5D2NA 1JN6A 4Z7OE 1DJYA 2RALA 1UJ3A 1BYNA 1IFGA 5BCAA 3KPNB 4KJQD 5FXCH 1OB0A 4Y2LA 4F9LC 3K8KA 3OKMB 1YNKL 3RVTC 4EIGB 2KL6A 1JNHB 4LVOB 3CH1A 3CX2A 3NA9L 1HCVA 1FNSL 4YHIA 3OLGA 2HWZL 5IYXC 2W0FA 4A55A 1LP9E 2IDSA 4B27A 4I0PA 4UNUA 1AZRA 5F7DA 2KLRA 3V6FA 2DQTH 1VESA 4PD4K 2FLBT 1ID2A 1IKNA 4N5UA 4ETYA 5ESVB 1IC4H 3WNNA 2ZX5A 1ZHNA 5B38B 2W9EH 4XNAA 1TQTA 2CA4A 4MAYA 2PCPB 5E00B 3OF6A 5D72H 3RY5A 4ACTA 2NXZC 3T8MA 1CBVL 4RSYA 1FFOA 3AB0B 4ORGB 3MJ7B 1RQ5A 2O4EA 4JFHE 3ZE0F 1MKFA 3W9EA 1JF1B 2XU9A 4R4FL 4G72B 4PJHE 2ZOKB 4NRYB 1K8IB 2WYTA 4N8VG 1I8KA 5TJWK 1D7BA 3W81A 1FT8A 1TJGL 4U09A 2ELLA 3QK0A 2D0FA 1RZ7L 4NQED 3RTQB 1KIUA 5ID1A 1NMAH 3T0EC 1QFPA 2QV2A 4IRJC 4HULB 4POZD 3RPKA 1QLEB 1HQ4A 4H8UA 3C8KA 3ZE2F 1R3HB 1HTYA 2R0ZL 5ICXB 4FI6A 1MRDL 2XTJB 5E7BA 1S78D 3AAZA 5DUPH 4Z64C 1IM9D 3RPIB 5C0BB 3OKYA 1JRHL 5DMGD 1DANT 1ERNA 3K6NA 1TR7A 1RURH 4NB7A 2HFGH 2HVJA 2VAAB 2FJGB 5CBAB 1S9KC 4HVBA 4ZDHB 4FMKA 3E9UA 4HLZG 3EFDL 5L4IA 2DICA 3CZJA 2W9DL 4LBEA 2OYKA 4LB8A 2OBGA 4FFYL 2F6AA 3CMOL 3EOBB 3EYSL 4YHMH 1AANA 5GZND 3ZSTA 5B8CC 4WW1A 4HGWB 4XNMA 3S48A 2GTWA 1DLFL 5HHNA 3NN8A 5KOMC 4M1CC 2XN9A 1K85A 4FZEL 5D7IE 3LS5L 3NZUA 3H7BB 1OCZB 2OSWA 2DQJH 1QEWA 1DUZA 3PQYE 1ZPLA 1BG1A 1VLXA 2W92A 1RUML 4PP2B 3UMTA 2Z7YA 4AL8L 4B9JA 1MW0A 3LN9A 3FRUA 3HHSB 3RYMA 2GFBB 2NY2D 4L4JA 1N5YH 4OJDH 3CVHL 3KWTA 2Z92A 3F7PC 2Z7XA 3IN2A 5E8OA 3E8VA 5TFSH 4HEME 5C09D 2CJ3A 3WELA 5D7JB 3NPSC 1MFDL 1G9NH 2ED9A 3TURA 4F8NA 5EZLA 3SDXA 5KANG 1D5ZB 4U7MA 4G43B 3FFDB 4ADJA 3F6LA 4TNWF 4FERA 3NCYP 4KK8C 4ZG1A 3OD3A 3WO4C 5IFJB 1JHLL 1BQHG 4W9FC 1XAUA 2UXGA 3MCKA 3M19A 2FGWH 3RWHA 4XPAL 2N7SA 2CPUA 2EDLA 3C5ZC 4H8WC 2GAZB 4K5PA 1DZ0A 4XVSH 1HAWA 3QIBC 1NCBH 3LTVA 2YBRB 3FQTB 4FL4C 3DXAD 2Q10A 4X7TA 2HRPH 1JNLH 2DIEA 3HE6B 1CXEA 4RAHA 2NTFA 4XP4L 4HIHA 4DERA 2EUVA 2A0LD 1COBA 3KPOB 1SYSB 4N28A 5DI8B 3IJSA 3D5OF 4NM8L 4PVMA 4HJIA 3GOZA 3L5HA 4FHBD 2X5PA 2DQHL 4L4TE 4ZFGH 3FFCE 4K3DL 4XVTL 5F6HI 2A38A 1DBBH 2DQDH 1AO7D 1PQZB 5IR1B 2BZ7A 3WMPA 4MBOA 3WIIH 3WU1A 1HSAA 1H3XA 1QYGL 2X1WL 2E9JA 4BA8A 3DV6B 2AQNA 5A40E 4URKA 1H8NA 2XN0A 3QDMD 3SE6A 2WUCH 2CBPA 3FB8A 2R15A 3VXRA 3MRRA 2D9QB 2FQFA 2UZXB 3OXSB 2CALA 5I0XA 4AIZB 3GXIA 3V6BR 1TVBB 3IRZA 2UZIL 3OGLB 5TE6H 4DO4A 3EO9H 1NUGA 3OXRA 4BQ8A 3IBEA 5KSAA 2G5BA 1SBSL 3ALPA 1DQDH 4JZJA 5KW9L 5MENA 3K46A 2NXYD 5IEKB 2OCJA 3IKCA 3S35X 1QSEA 3VRJB 4PKIG 4H25A 4ABUA 4GI8A 5SWSA 3I3BA 4GUCA 1EO7A 4WO4A 4UQ3B 5GGTA 1A3LH 2PETA 3QQ4A 1D9KA 1N64L 4DF9A 4LDCA 2QSVA 3SE9L 2CK0L 1FAIH 3UP6A 2N59A 4MS8C 1CT8A 4HC1L 5DDHA 3LXAA 4XBPB 4R7XA 1FCCA 2FD6H 4LGSB 2X1OA 4PREB 1QI4A 2OXHB 3CN2A 1CTOA 3KJ6L 4KTYA 4L8SA 4OTXL 5IB3A 4L1DA 5D5MF 5JTWA 4CVWA 1Z3RA 3TBCA 4I9WD 2AQ1A 5HDWA 3ECUA 5FYKH 4L0ZA 1XGYL 3B7UX 4IRSA 5AVSB 2Z7WA 4DW2L 5HGBA 5F6IB 1F6AA 4UOZA 5FYKE 5CLYA 3MX0B 1OLZA 2PPFA 4BK4A 1PKOA 1OGQA 1F4AA 4J6RH 4GKSB 1I9JH 4DH2A 5IMLA 2OMNA 1BWMA 1WFUA 4TRPL 3CFTA 4ZO9A 5IGXL 2JCCA 5JW5B 4R83A 2WUBL 3QEQD 3LZLA 2VLJE 1OM3H 3DUSA 3O6LL 3WNIA 4AJWA 2CRZA 3V8CA 3AM8C 1BW8A 4OZFH 1QHOA 3MGOA 3HA0A 3QUZC 2GTZA 2HB0A 3OPUA 2AHIA 1MEXL 1YECH 4PJFA 3BFOA 2M83A 5JPNB 3GZPA 4C59B 3ZGHA 3LNDA 5DK0B 2XWCA 2NYYC 2AERT 1U8PB 2ASSB 2BH0A 1FZJB 3G5VA 4P99A 3V0AC 2NYZA 5BO1H 3IPBA 4N90E 4RDQG 4OH2A 5EN2B 3QORD 2CRIA 5I1DA 3FSAA 3MA7B 5JXED 2HLAA 2DLIA 1MW3A 4JRXB 3CG8A 4ZMNA 2O72A 3CFKB 2EIEA 1G9NC 4K73A 4KAQL 1T21A 5I0ZA 3VSVA 4YOKA 2ATAA 1CE1L 3O6FC 5KYXA 4XCCH 3MOAH 4DO5A 5C2BL 3LOWA 4I7ZC 4J8RB 2BSTA 2NQ3A 2W9LA 1ZS8A 1LLAA 1MJ8H 4A04A 4MNGE 4K9EH 2JQZA 5JQIB 4P8QA 4QXUH 1MCIA 4LRIA 4JJHA 4PVNA 2HX8A 4UTAL 3D3VA 3HC0A 1T2QL 4TLUA 2X4RB 1JJUA 3NCCB 4IRZL 1AHWA 2MFNA 1LL1A 1SUJA 3HNSL 3RNQB 3JWDH 5DT1L 4XO9A 1PNCA 3D9AH 3FQWB 5D1QE 2BWQA 3ZTNL 3EYUL 4KVPA 5C0CA 3UO1L 4MLSA 1KXVA 1IFHH 2FBRA 2KPWA 2VLKE 2O6FA 4FKKA 1BQLH 4RMWA 4LP5A 5KVFH 2HG5B 1U2CA 4DETA 2AFNA 3SE4C 3X1NA 4GG6B 1RL1A 2ZCLH 3GSOB 5KVFE 5F9OL 3ZL4L 5DEGA 1BPLB 3FTYA 4ONHB 3BH9A 3KYOB 3WPCA 3PWPD 3ZDXF 3HCVA 1VERA 1NUNB 2NY0C 2EXYC 3BQVA 4PBXA 3R0MA 5CZRA 3O41A 4AIEA 2A1WH 1O6TA 5IOPA 1XDTT 4HT1H 5DJYB 4ODWA 3I9GH 4G8GE 1ES0A 2VN3A 1GJWA 4FG4A 2BINA 1T83C 1J8HE 3O4LB 3T3MB 4NKDA 4PJ8A 5D7HA 4XHJC 3H2QA 3FT4B 4LCYB 4N8CL 1A21A 3QG6B 2Q7YA 4AZ8A 4MXQD 5I74C 5FLVA 1PD1A 3ZHNA 3WIHA 3AT9A 2B2XH 3GPSA 2Y6SC 4LLYA 4M3HA 4MJ5A 3RILA 3ABLB 2XIIA 5AOLA 2YLHA 4G1EA 4ZO6A 4IDJL 4ODUA 5EEVA 3EOYG 1T0NB 1WPCA 3F12A 3HC4H 5CFHA 3EW3B 1Q9WA 4JFEA 3LKOA 1EJ8A 3RIFF 5C6WH 2YN5A 3O2DA 4GO6B 2JXMB 3B2UD 1O5DT 1LD9B 2FWOA 4ZNEA 5CLXA 3Q06A 4UU9A 1JZEA 1XF5B 3D18B 3AQYA 1I53A 2PYEB 4BZ1A 3FT2B 1YMMB 4HHGA 3W3BA 3C5SB 2J2ZA 2VRQA 4MCNA 4J3BA 4TULL 1XR8A 4A6YH 4NOFA 4GBXA 1A6TB 3FQUA 1JXGA 3V79C 4XN1A 4DP4X 1BPVA 5IK3A 3HRZB 5I8EB 1DZBA 2IAMB 3IXTB 1JUFB 2VW4A 3BYTA 2DWEB 3VXQA 2Z31D 3FMGL 3HE7C 1XH3B 2NY7H 4R6FA 3CK0H 4K2UH 3ROOB 4G6ML 1Q72H 4ODBD 5J6GB 1F3JA 1E28B 4JVPA 3U6XS 3FYIB 3VFMA 2X0WA 2ZCHH 2AAAA 2GSMB 1T7ZA 4HKJB 3QO1A 4P05A 4U6YA 5DD0L 2AS5M 3GKWL 4RFOL 1EHXA 2BNHA 1S7XB 2PP8A 2Z65A 2WLMA 4OLUH 4YHOL 1WLHA 3DSNA 4P59L 4ZYKB 1G7IB 1E5ZA 3WNMA 3EGDA 4B9CA 4FQIH 1RUKH 1F11B 2A99A 5AVUB 2QVFB 2ICWJ 2BHZA 1LEIB 4HCRL 1WWLA 1CFNB 1MCPH 3QH3A 2WJ7A 3C8DA 1NC4B 4OKVA 3RA7H 4MLIA 3QHFL 2CO7A 1AHKA 4IEFB 1ZLSH 1JIBA 2EKSA 3BKCH 2KERA 4NQCD 5I8KH 5KG9B 4HIIA 2Q1EA 1RVFH 1ETJA 5HD8C 5I9QB 4PJGA 3QR1A 4LLQA 3I75B 2WXMA 4K9EC 2WC7A 5J11C 4QDGA 2IQAB 3QIWA 5KJ4A 3QC5X 5J1TC 2Y9RT 3FUDA 2RHEA 1LE9B 3GMMB 1N0XH 3PL6C 3QPXH 5IEHA 2LAAA 2H26A 2FT3A 3MV8B 2ROXA 2LU4A 1KPUB 2EYRB 4WW2C 2K6YA 5D1QC 3VXME 1BFOB 3NFNB 4CN6A 3PREA 1DVXA 2ZE0A 3JWDC 5D2LE 4KMLB 4AQ1B 4NQXA 5ADOH 3WENA 2BO0A 3JXAA 3TH3T 2A7BA 4GAJL 4MB4A 4RAUA 1FH2A 1E4WH 2DF3A 3V6OE 1G0XA 1WS8A 3A24A 5HDQH 4OM0H 5IVXB 4G9FA 4P46B 2VGLM 1IAII 3LEVL 2R2CA 2VNCA 3BWUF 3OJDB 3HZYA 4N0YH 3G5ZA 4ENEC 4PUBH 3ROLB 1KG0A 3GRWA 5J6HB 4UT9L 1OAQL 4ZD3L 3DIFA 2V3DA 4NZFA 1W72B 3A0OA 1DVFA 1SXZA 1TZGL 3GJFA 1ZLWH 4JFFB 4JN2A 2FX7H 2LLGA 1PX4A 3BWAA 4N24A 3BRGC 3ULVF 1J12A 1T1XB 2JJTA 4J4PA 4PGJA 2ARJQ 4HIJB 5GSVB 3UL7A 3Q2VA 2EDHA 4MQWX 2XN1A 1I1FB 2V7HA 2ZAIA 4WTXA 1IX2A 5KJ7E 1EDHA 5DRXB 2ZAHA 4DVRH 3SKMB 1IUZA 5CD5C 2Y36L 1M71B 2DEXX 2DIJA 2F19L 3ZMRA 3RW6A 1JPGA 5JQ6L 3TBWB 3PWUA 1I75A 5L7XL 3QDJD 4KK5D 4BWTA 1OTUC 5IHUL 2J72A 4KFZC 5B4MD 3NIFE 1NFDE 3M6DA 4NENB 2IWKA 4XCFH 1QP1A 4EIUA 1JZ8A 3NACH 2WOYA 4PS7A 3S35H 1MCJA 2LU7A 2Z35B 5JA8B 2CKBB 3E6FA 3O3EA 2CO1A 1RZ8A 1ZXQA 3VXUA 5FW8A 1KENH 4YIQA 1BZ7B 2YA1A 1WISA 5F1IA 4HXBL 3IXAA 3US9A 4Z5RB 2D03L 1ZE3H 3GXMA 5DMJB 5IHZB 4I89A 4FQLH 3WUZA 5I1CL 3V2AR 2VLRE 4WFGE 4OIBA 3MFFB 3VFTB 4E9SA 2UVFA 1L3WA 3ZO9A 3LQZA 4HDIA 1S2EA 1QI5A 3H3PH 3X14B 1NDTA 3MLRH 1SMOA 3WL9B 1TEFA 1CQYA 4O02B 1IFRA 4PJ5D 3I6KB 1BVKA 1NSNL 1P4IL 3EIFA 4P3CL 4Z3EA 2CHNA 5JIHA 1AI1L 3UJJH 4OIFA 4O2CB 4Z7UB 3LN4B 4WCYH 1PSKL 2XTJD 1KYDA 4NO3B 3WV0A 3QQ3A 4ZOCA 4DUVA 5LXGH 1Y07A 1L7IL 4NJAL 4QXTB 5H4YA 2WBJC 4XMKL 2KMWA 4OV5B 1KSRA 4K07A 3BDYL 4WWKC 4BZYA 2MOQA 4O58H 5IZ7A 3LZRA 1Y1UA 2E8ZA 1LQSR 4PS3A 2NMSA 3W0WB 4Q56A 2ZYRA 3Q43A 3L8QA 1TTBA 1UOVA 4J3OH 5CINL 1I7TB 4MA3B 1TQSA 3IEAA 4U0RC 4WTWA 2GHWB 4YHNA 5AVTB 5KOVC 5EO9B 1HXYB 3OZLA 5EULV 5KS9E 3BKMH 1NL0H 5EIQA 1UH4A 2C9AA 5EFIA 5GIRB 1A6AB 3D87B 4OLVH 1NGQH 5C0EB 5JIIA 1AJ7L 3I2CL 4LHUB 4H1LB 1D2OA 2N01B 4N2MA 2XWXA 4NO0A 1XF3B 4X4YB 3CUPB 3PAZA 3QUHA 1VA9A 3A6CL 2ATKB 1M7IB 1BZ8A 2ZF9A 2DYPB 4XX1E 4GOSA 1NGXB 5ALBH 1VGKA 4UV7H 3WIFA 1UM6L 4J0MA 3CFQA 5FWRA 3RL1A 2AJSH 2WOBA 3ARGB 1JGEB 5KYNA 1MRCH 5D7JD 3UC0H 2GB2A 2HG0A 3TJEH 4LGPB 3E6HB 4JM2B 3UYRH 3I02B 1U3HC 2X4SA 4UAHA 4MA7L 3V6OC 3WY4A 4GAGL 5I1KL 3GUTB 1BBDH 2R7EB 3APCA 4UT6L 3P0VH 4NLAA 4NFCA 3SDXF 1XH1A 1BSIA 4L3EB 3RNKA 3TA3A 5I76A 1A2YA 1FQVA 1YPZB 3S2CA 1MJJB 3SGDH 1G4MA 1TTFA 3WEXA 4CVUA 4R07A 1KGCD 4PRHB 4PTUA 4X8GA 3VA2C 3DX9A 1FVEA 5I17A 4Z7QE 1CLCA 2XPZA 2J88L 3HE6D 4TSAL 3DC0A 3S97C 3PAUA 4JO8A 3QJHB 3KDMA 5I82A 4RMRA 5LWYH 1V3LA 3IJ7A 2WWMD 3KHQA 3VTTA 1XD0A 2JTYA 5INCA 1AZCA 3ARVA 4F9PA 2G75A 3EJZD 3PGCB 2FJFA 2X4OA 4UF7C 4X50A 3ULVD 3HAEB 4WWOA 4JFSA 3RZCC 5IB4B 2YQ3A 2XX1A 5A2LH 1LVEA 5BZXA 4IGBD 4RVBA 1JGUL 4WDIB 3DV4B 4RMQA 3H42H 3TCLA 3ZRCC 3VFRB 1CLVA 4XVOA 3FL7A 2ZWSA 4UB0H 4IRZA 3RFRA 1A1MB 4LFHG 3VGAB 2YAFA 4QHNB 1M3JA 3KXFA 1DO5A 1NEPA 3NT0A 4LRNL 5FYJU 1T0MA 3U2SA 4NKHA 4D3CL 7TAAA 1WCBA 2ADJA 4X9HA 1Q9KA 5LBGA 1IAIM 1NC2B 3BZ4A 3O9WA 3T8XB 5KUKA 2YEVB 4YE4L 2CHWA 2F68X 1KBWA 12E8H 1BM3L 2J21A 1ODAA 3WY1A 3MYZA 4BUHA 5I5RA 1UWYA 1ZGLB 1OGTA 4M7ZC 2R56L 5DZLA 4F20A 3BPCB 4Y2OA 2EVFA 2ZD0A 2CNYA 5E23A 4LCCA 1A14L 1BHGA 3UL8A 5HYQA 2BW4A 1OTSD 1CL7L 4PJEE 2DH3A 3V5HB 3L3OC 3TFKD 1JZIA 2IWEA 2M26A 3U36B 3AMLA 4Z8GA 2APWA 2NT1A 3CLEH 2CO2A 4OR1A 2P8LA 1FFPA 3QUMH 1RUPL 5C0AB 1YAIA 4ISVA 3EH1A 4TL5A 3FAXA 1CGYA 4QHKJ 4YDIL 3NJGA 4HHWA 2WKLA 1CF8H 3U1SL 2Z64A 2GJZB 1T5XA 4TKWA 1O5PA 1CFVH 4RNRB 1A7PL 5CKAA 1MLBB 5FO9B 2VC2B 1WBXA 2XSKA 4O2EA 3VDAA 3KPRD 3GKZA 3AZUA 1HIML 2J5LC 1PZBA 2EE9A 2WGNB 2R2EB 4UYQA 2VZOA 3MLYL 1C12A 1P5UB 3PIQB 3TTSA 1MG2C 5EZIH 5DO2C 2EC9U 4M7KH 2CLZA 4BKLA 4LLVB 3LH9A 2V9TB 1NCDH 3RLSA 1HU8A 1D5BB 3L9BA 3CMGA 5TK2A 1D6VH 2BP0A 5I16B 2LU5A 4YQXL 2YLKA 3U7AA 4IOFC 1X5KA 1BZDA 2H0PA 4KV5F 1NIAA 3SKNB 5LNDA 4KTDL 2IH1B 4I87A 5DMKB 1KYOK 5BVJB 3BP7B 3DGCR 4ZQKA 4GAFB 4LVEA 4OCNC 4RRPM 3OWEA 4XPFL 2VIRB 5TDNB 5HVHC 4KMTH 2HRLA 1N6QH 1ZGLM 3NP4A 3MMEB 4HYTB 4PJFF 5F7EH 4F37F 2ENYA 4OJYA 4QAMB 5FUZL 3STBA 2E75C 1QBLH 4FQHA 1V7NL 5DJXA 3CLFH 4M6NL 5EWIL 2ZOOA 1ONQA 2F54A 3ETTA 4J3OG 4V2BA 5E7FA 1SM3L 4CSSA 2J8OA 1B9KA 1FFQA 3MNWB 1E2WA 4JRXD 2WLJA 5LN4A 5A16B 3UABA 2HKFL 2B14A 3ET9F 4PJBE 1RZFH 2F58H 1CD1B 4DGUA 4P91A 4QYAA 4OD1L 4RWHA 5BS0E 4A7TA 1EK3A 3QG7L 1IJ9A 4EI5B 5DJDB 5FKPA 4MWFA 3VXSB 1LMIA 2VDML 2ZG1A 1EHLH 1AQMA 1UB5B 4U1KB 1ZHKB 5F9JA 4CAGA 3VXNA 1D0BA 4WHYG 5BRZD 4NZRH 5T5NG 3GXDA 1PKQE 1GS6X 4ODHL 2OMUA 4FLSA 3V6ZB 1MCDA 2A9ML 1G7HA 1ZPUA 4ABQA 1HHJB 1T66C 4XGZA 2H7WA 3T04D 2XWZA 3GDCA 5E2TH 4JNXA 4GINA 3WJJA 3V7AE 1I7ZA 3Q3GA 4CUCA 3QDAA 4I1RA 4NUGL 4EI6B 4KO6A 4HCRA 4FKEA 2VR3A 3CTTA 3W3NA 1NM9A 2JKLA 4HPOH 5F72S 1V3MA 3ASOB 3JV6A 4R5VA 4L9LC 5HDRA 1ZEAL 1KEGL 1P4BH 3SGJC 1A4KB 3QNXA 3VWJC 2NQCA 2PNDA 4HFWB 3CBJB 3DRTB 2Z82A 4OM1H 2VW6A 3VI3B 4AW4A 4AYFA 5JOFA 2DLFL 4W9EC 1G87A 4ZXBB 1MCWM 4TTDC 4FFZH 4PHXA 2FEDC 1HYSD 5KBDA 3V0HA 1TT6A 3AG4B 4PJXE 1CFSB 1GVIA 5AAPA 1S7RB 3ZDWA 3L54A 3ZZQA 3D39A 5L9DL 4OZIE 3O4LD 1X9RA 3QI9C 1R3IL 3KYNB 3P0YH 2BVPB 3N06B 4MXVE 5LCVH 5E2UH 2BNQA 4KDTC 3PXLA 3TOPA 1J0YA 2JSFA 3TCXA 1DJXA 2N7BA 3G39A 1JI2A 4MCZB 4HOXA 3MBEA 3RIAF 5DUML 3JVGC 4QNPF 4Y89A 1JZGA 1IO4C 5IJKA 4PJIA 5GS0L 4GQRA 1Z1WA 3PABB 4L1SA 4C56A 3LEYL 1ZANH 1GC1H 2QLVB 2W60A 4XMXA 1FGNL 4KHTL 4ZO8A 5TQ2H 4DZBA 4NIKB 1MF2H 3NJVA 3VM7A 4UT9A 1VEOA 3QQXA 4QHUB 3SDDB 4Y1AB 5BOJA 1BFTA 3PMHG 1NGZB 5E4IA 3L3IA 3QAQA 4Q9QL 2VITB 3JWNH 2V2WA 2Q3ZA 2H0JA 1A7QH 1C5DB 4OI8A 2JK5A 1DQQB 1WZLA 4HZLB 3ZYNA 3GSXA 4OLXL 5FR3A 4HJSA 1QMUA 2YUWA 4JM4L 1MFBL 3DVNB 2C7UB 1GWBA 2DEWX 3GEWB 1Q1JL 1KGUA 1U8LB 4WEEA 3T0VA 3L4CA 1H3PH 2WVSA 2PYED 2RIKA 1D5MA 4AV4A 1YMMD 4XVUC 4GW5A 3OV6A 4LPWA 4BK5C 1F00I 2AEQH 3BAEH 2G4GA 2G30A 1G9MH 4CVZA 4BHUA 3BESR 4BZ2L 2QZQA 3MVSA 1FO1A 3O3DA 2IBZY 3ARFD 1Q0YL 4PU2A 4YFEA 1YSOA 2PW2A 3L7FA 4F7PB 4M43L 2IAMD 3MRNA 2JKNA 4NN6C 4ZSOA 5ISZA 3O0LA 4R3SB 3MRCA 3RHWK 4KKLD 2QEJA 1K2DA 5I1EL 3KH3A 4PJDB 4JDTH 1PX3A 3RWJA 4H13C 2ZSWB 5I18H 4MCMA 3I9AA 2ICEA 3L2MA 4TPRL 2B4CH 4EVNB 1N12A 1C1EH 3G3LA 4XCYB 4AYID 3TC9A 3KNBA 4HQQH 3OKDB 4OZGE 1CU4L 5CHNB 2PCYA 3UGUA 4N2HA 5D1ZC 5B1KA 1DSYA 3U1QA 5I1IH 3A4DA 3EOAB 3H85A 4FQXB 4UIKL 3UJIH 4YX2H 2L4OA 3ERXA 4DK5A 5IWLA 4AK1A 1LEKA 2WLIB 2EVJA 1X9QA 1B0RB 2A9NH 2WXQA 5FO7B 4Y4FB 2GITA 5HVGB 1JNJA 1HHIA 4GB9A 1MLCA 5E5MA 2WZ0A 3V0VB 3BZEA 2DD8L 3VQLA 4JG1L 3CPUA 5E9AA 1S7UB 4XAWL 3UZQA 1E3ZA 4ZAKA 3N41B 3NZ8A 5DJZA 1QVOB 3CDZA 4NQEE 1JV2A 1KJ2H 1YMHA 2JELL 1PU0A 3QQNA 2Y06H 2J6EA 4I0KA 1RK1A 1MJ7H 4HH9B 3NFPB 2VXVH 3QEGH 3O6MH 4WFED 1IO0A 1J9QA 1UCBL 4PJGF 4C83B 2C3VB 2NSXA 4GRLB 1M7DA 4JCWA 2XPGA 2MKLC 3MV8D 4L29B 2PO6C 4JFUA 4PJCB 4AEIH 1HNYA 4LVHC 2VZVA 4LCIL 3OZ9L 2J1ZA 3C60B 4PM1A 1L0QA 3HG3A 1MHEB 4MAUH 3L5IA 5JPMB 3W1ZA 1EAOA 2EVGA 4NQDB 5D1XA 2Q8BL 1ZTXH 3KGSA 1RZKC 1USZA 3M1BA 1ML0A 2PW1B 2W0PA 1REIA 2FIKA 4PY8I 3QCVH 1ZTXE 4P46D 4LNRB 2XWTA 1GYVA 1ZJAA 2MRYA 5ENWB 1OF2A 5BZZA 4HUWB 1N2RB 3CBKB 1MH5B 4F58L 4PWHA 5ESAB 1IIKA 4QY8A 3MRMB 1NMBL 2UY6A 4TUKH 4KI1A 4LQFH 1MJUL 3B3BA 3I84A 3ARQA 4JFFD 3DMMA 1WEJL 2P52A 3IU3B 4XB3A 5E9NA 1SXNA 1J8RA 4LMQE 5IY5B 1CXKA 2AK1L 4P3WA 5AZEL 2D31A 3RDTC 2EUZA 5CCKH 4X8CA 1M9LA 3CQQA 1R5WB 3CBRA 3QHTC 2KQNA 2HKAA 2ZICA 2V3EA 3DPDA 1PAMA 1HCFX 5AWAA 5ID0A 3HBZA 3LMJH 3VI4B 3MKKA 4I9XA 4QHLB 1GC1C 2CBQA 4ZOEA 5C0IA 4JL1A 1QX1A 1EZVX 3ZHLA 5DRNB 4M1DL 1FA4A 1CLZL 3CSPA 4Q2ZB 5L2KA 3GINA 3BCDA 5TD4A 3KBPA 1XIWC 2PR9A 2ZJSH 4HIXH 1MCCA 4J23A 3TONA 4ODVH 1J7VR 3LKSA 2CIKB 1CBJA 1B0GB 4HUXA 4ORZC 3S37L 2OCFD 3L3HA 3A4FA 3S36X 1LTXA 1FL6B 2L04A 2UWEA 3EBGA 3WKQA 1AFVL 2VISB 4EUPG 5KVEH 3DXAE 3GIVA 4L3CA 4GUPB 1F8TH 2VLMD 3TP4A 2MHAA 5CP3A 1XX9C 4CU7A 3NQIA 3E38A 3BKYH 1ACXA 1PX8A 3FTUA 2QHRL 4JDVB 1D5IH 4HLJA 1BJ8A 4J3UA 2OPCA 3JT0A 3LRHA 1MWAB 4UNVA 2BS8A 2V2XA 2F74A 3QIUA 3TNNB 3TYFB 3ARXA 1G9MC 4P4KC 4YWGH 3AQXA 3JWNG 5DU7A 1JPTL 2X1PA 1YJDH 2GJJA 3CZLA 1RZPA 1HAUA 2A77H 3PAYA 5E6IB 4NNXA 5BW7A 1T1WB 3FO9B 3AGWA 3LKRA 4M7LT 4PSPA 4UQ9A 4UWQB 4PRBA 5ABAA 3T4AA 4FADA 1EWHA 4PHZA 1RMFH 1D5RA 1WRFA 2R4RH 4QWWD 4PEQB 3W3KA 4ATWA 3U6RA 2VDOH 1GGBH 1NBQA 1G9EA 3D08A 3OGOE 1VGEH 4DQOH 3TM6A 1DVZA 3PWNA 2B4CC 4IS6B 2IADB 4XO5A 2Y1YA 4MVBD 1U8MA 4PJ7E 2Q6WB 3KPSB 3WTUA 4FXTA 4PG2A 2VDPL 2GSIA 2FIRT 1NICA 3HR5B 1XF4A 3MHZA 2CLVA 1KLUB 4DUXA 3GXFA 5JYLA 1BECA 1N59A 4GSUA 5ICYB 3B9KA 1WC7A 1L5GB 1IT9L 1NUFA 2XKNA 5J3HD 1IQWH 3ATAA 3S5ZA 3OG6B 2VJ8A 2YPLB 3MLTA 3P9MA 1B6UA 4ADGA 5LGYA 4N6RA 3W82A 4POUB 32C2A 1T22B 3O8XB 1KGIA 3D52A 4U1SA 1S78C 3NK3A 4ODXA 2YZ1A 4BQ6A 2DYPD 1DSWA 3K72B 1U8HA 2AQPA 4MB3A 2X2JA 3SGKA 5FFGA 2ALAA 1AIZA 1FBIL 4HUNB 2YQ2A 1OT4A 5CBEA 3UPRB 4JM2D 2J44A 3PJSA 3E2HC 4TS6A 3J07A 4XOAA 3FU8A 4R7DB 3UEQA 2HVKA 3LXUX 3S4SA 5GZNC 1JWUA 1MCSA 3BN3B 3QEQE 4GP5B 4WGKA 4L3ED 1YDPA 3O0RL 4RIRB 1AVAA 1H3GA 3ULUF 3PWVA 4X6CA 1OP3K 1CD8A 3OKKB 4OLZH 5HYEA 4X6BA 4EDWH 3BHBA 3RWGB 3KLHC 2Z93A 3G6JA 4PRHD 4U3SA 1P8VA 5DSCB 2A9DA 2EVIA 5I6XC 3U7WH 5J9PB 4FA7B 4YHZL 1KJ3L 5IJBA 1DJWA 2DQTL 1MXGA 5C07E 5K59F 2GVYA 4KQ3L 3QBTB 5ACLA 4P2QA 5DQDH 3BP4B 4XE5B 1IC4L 1JK8B 2OMZA 4V2CA 3FU5A 4G83A 5F9DC 4YBQD 1CGUA 4FXKC 3BDBA 3VI3F 4Z7WB 3TLRA 2AJUL 4WGVB 2WVUA 4M5TA 3MTXA 3R8BB 4KXBA 3V0JA 4EOWL 2VXQA 1SBBA 3MRGA 3LRSA 1CDBA 4EEEA 1CD9B 2X2IA 3TVMD 3KW8A 4YXHH 4P3DB 2XA8H 2YOAA 3QUXA 2O5XL 3VA6A 2BNRA 2ESVA 2LLLA 2H3NB 1L7TH 2HP4A 3TESA 2EE0A 1IGJA 1NC2D 1HOCA 2O6CA 3PWJB 1XKUA 3FQ4A 1BLIA 1URZA 3QFDB 2ZWLT 1S7TA 5CN1A 4HWZB 1KTLB 2H6OA 3PHQA 5KVDE 1NQBA 4KPHL 2A0LC 5DUPL 1JF6A 2Y2YA 4NM4L 1ZA3B 3OGCA 4NOBA 2IFFH 2VKWA 4PGEB 5AENA 2C8NA 2YD1A 4AVHA 2HFGL 1ORQA 4PVBA 5IBLD 5A2JH 2YUVA 3KWWB 4HUCA 1YJDC 2E6PA 2XQBH 4HBCL 4HK3N 2BJMH 5SV4A 1HWGB 4OGQC 3PWPE 2CUIA 3T2QA 1KPRA 4PRIB 5C0AD 5J57B 4Y5XC 3NIGB 4KKAC 2GUOB 3LHPL 4FMZA 1JG9A 1VAHA 2NRDA 5CSZB 5D6CA 5HY9B 5KSAB 2QTEA 3IFOB 4X8JB 3VGDA 4Y4KA 4C4KO 1AMXA 4F33A 5HYJB 5I8OH 4K17A 5GPRA 1FNLA 4P9ML 4B5EA 2H1XA 4HK0B 4AMKH 5GS0A 5FECA 3SD5A 4HFUL 1HL5A 3UTSA 2EILB 2LR4A 3IDIB 3E8UL 3UAJA 3E2JA 3H8NA 1AGFB 4AGOA 3ILEA 4ZFFB 5DURB 2BHFA 2V2TA 1G6RL 2BSEA 4KH2A 4KZ0A 1Y0LA 4PJDF 3MNVA 5FYKU 3F7QA 2CXKA 2Z4TA 4PH8A 2FWLB 4XN5A 2P49B 4GSDL 5IHHA 2C1OA 1EQWA 2YFNA 4Y19B 4TQ8A 5E08H 3CLWA 5LJYH 3UEZA 4JMXA 2LT9A 4M1GL 3F5WB 3QUGA 4P2RA 3RKDD 3MBWB 4TNWK 2P5EB 3VRLF 4DP6X 1C7SA 1R24A 2EDFA 4DSYA 2BOCA 2PCFB 3IDGB 4P5KA 4AKOA 1U8KA 3KYKL 3QULB 1WICA 3WE1A 4N9OB 3KS0J 1AGEA 1PIFA 3FHQA 2V3FA 3P69A 4FDWA 4DFHA 5K9OB 3MRHA 3FJTA 4BZ2A 5J12B 4Z3GA 2GABA 2IPUK 2ZUVA 4XH2A 5EUKA 1QPPA 2HPTA 4ABVA 4JZOA 1NFAA 3NFSL 4LSUH 1UQSB 2HRPL 5KSBE 5HVFB 4KJPD 2B1HL 1HH6A 1Q9LA 3QZBA 5AB9A 3HS9A 5EU3B 1OP4A 4QF1A 3MRLA 1FO0H 2VQTA 4E9QA 4FG6D 5HHXH 3PV6B 3C2SA 1DP0A 4PW4A 3GSNH 2DQDL 3CFBA 1SPDA 4JO1L 3CC1A 1RPKA 5DK3A 4EI5D 1JL8A 3Q8EA 4KMQA 2YD3A 3VXSD 3WIIL 2HFEB 4DP9X 4PJCF 4PV9B 1A7RL 2A3TA 3IJ8A 1RD6A 4JB9L 1BEYH 4M48H 1IC5H 2EDJA 2WUCL 4B97A 4RGOH 4L1TA 3CFNA 1A9EB 1QQDB 4MQTB 3N0AA 1MFNA 4NKOB 1W8OA 4X9BA 4D0CB 4NRZA 5FGBC 3SB3A 5I8CB 3VXTB 4BDVB 5E8EA 2VDLL 3C5JB 5GGQH 2YAMA 3L3DA 3LRLA 4RESB 3F7YB 2PXYC 3VMOA 3CDYA 3QORC 2A83B 1A9NA 4N2FA 1XSKA 3U0WH 3CFDA 4OLYL 2AEWA 1FE8H 1FYTE 1NLDH 4EXKA 5AWBA 2NW2B 1JZ4A 4YC2C 4NPYB 1WIOA 2EZ0D 1XCDA 2WTRB 1ZLEA 2VDKH 1FQ9C 3D4CA 2K7QA 3SKOA 3ZR5A 1UH2A 3WJLA 1GSKA 1QWNA 4IBVA 1TTGA 1NAMH 3CZFA 3BMWA 3H9SA 4NQCE 4ZXBD 1DCEA 4FQCH 3HZVB 2AABL 2NDFA 1MNUH 1UD6A 1W0WA 1AGBA 4FTVE 4D0DA 3Q7JA 2ZX6A 4P2OC 1J5HA 3QNFA 5HI3D 3ZDYE 1L6PA 3EYFB 1RXLA 1NBYB 5FO8A 5D96B 4K5MA 4F9LA 2ZXGA 4GKOA 4K3HA 2DIBA 5JHLL 3S98A 4OI7A 4AY0A 2MCMA 4OQ1A 4Y5YB 3THMH 4FS0A 4PJIF 3TO4B 1V54B 2MSPA 1ID5I 3DURB 3S36H 4OUUA 3AT0A 4Y1AD 3U4KA 4G5ZH 4BFNA 4N8VA 3SYAA 3MXWL 3N85L 4JGNA 2XY1A 5CGYD 1FDLH 3RWIA 2G3NA 3IFLH 4CSZA 4R5CA 1HILA 3QPQD 4S2SA 5AOKA 1J9SA 3UBHA 4LARH 4LCWB 4MDJB 3GHPA 3IETA 1GA2A 4PTTB 4LNVA 5D2NB 5JIKA 1YN6A 3SPHA 2IPUG 5IF0A 1ETA1 3PGDB 3EDKA 3L45A 9CGTA 5DK2B 4BCXA 4C4UA 4UIMA 2MQ3A 1YUHB 4AKQA 5C86A 5MEQA 4YSUA 1FS2A 1Z66A 2QQNL 3QEUB 4MXQC 5G5DA 1KFAH 3RVUD 5D3IA 1PY4A 4MTMA 1DVQA 3DYPA 1DDTA 1AZZC 4DGVL 3WCYA 4KITB 5LDUA 5EEXA 4U1GC 3I6LE 4UAOC 2AJVL 5I15L 4WEBL 3T65B 2EDDA 5LBSL 2X4PA 4JPIB 3QQDB 3QXAB 2WZPA 1W0VB 2IGFL 1GJIA 2P5PA 4OSUH 3QDJE 3L6FB 1IM3A 2ZUWA 5EG6C 3ZHFA 1ZIAA 2HMIC 1HZKA 3OPZH 2YAEA 3BVTA 4DOHB 1RUAL 4NZUL 3OG4B 3K6OA 1OAYL 1EFXB 3NRPA 4WSGA 5I26A 4FHJA 3OJMB 3T1FA 1CK0H 4E9RA 2Z6FA 3POCA 4K7PY 1I4FA 3B5GA 3BW9B 3S5LA 1OGAA 2J1YA 1QASA 1OARH 3ZL1A 5GGRB 3CVIL 4FQXD 3HUJB 4AUUA 1EAPB 4R96A 5B8CA 3T6WA 1LE5A 5DZ9A 4Y4FD 4KK6D 1R34A 2WW8A 4LEOA 4QTHB 5AKSA 1X5JA 3U4EB 3S0PA 1BQLL 1OB1A 3GRBA 4R7VA 1KYFA 4KGLA 3T8VA 2Z31C 2E9GA 1BQHA 3BPNC 3VFUB 3G04C 3CWGA 3APMA 4YO0B 5CZKA 1XB6A 1IGCH 1QLEH 4D7BA 4TSCL 4EN3B 2KZBA 1MSPA 4WHTB 4GIOA 4MD0B 3VFVB 5I66A 3X12B 5I1HL 1Z5HA 5GS1C 1Q8MA 4GRLD 2KPNA 5AAMA 5E94B 1MRFH 3HG0A 2XTJE 5L2JB 5IKCA 5AKTA 1LO4L 3I9GL 3WOVA 2YJLA 1J5DA 4A67A 2K7PA 2JE0A 2EADA 1ZIWA 2BVOA 3ILDA 3ZVVA 5EZOL 4N26A 5J1AB 4Z0BH 5BZWB 4CA4A 35C8H 2O61B 3EYOA 4KNUA 3WNPA 4YHYC 1HEHC 2XKUA 4L1HA 5K5YA 1IBZA 2JIXD 2B8OT 2RQ8A 2YZ8A 4TM9A 4YXKH 3BIKB 1QEXA 1PJ9A 1RKRA 2P4AB 2WO4A 1E4KA 2I69A 2FR4A 4FJYA 1BMGA 4R6AA 2Y2WA 5FWQA 4S11A 4X80L 1BAFH 1OXYA 4I3SH 3HG1D 3T77A 3QIBA 1NMCB 1RHHB 1AGCA 4Q6YA 3HC4L 4JFQA 1AQDB 1EFQA 2V9QA 3O4OB 2M1KA 1JWSA 1U92A 1EXUA 3L1EA 4W9GC 1KPVA 5T1KB 3W3LA 2OMVB 4S1QH 2ED8A 4XN2A 2CRMA 4TLKA 1GGTA 4ZNCD 3TN0B 3KPLB 4Q6IB 1UZ8B 3T6QC 1C5BL 4FA6A 4A6YL 1KBGL 1TJHH 2G9HB 4MNQA 2JVUA 3MRBA 5E5RB 2XYCA 4ZUVA 4MMXC 1PG7X 3D4ZA 4AKPA 3SPGA 1HH9B 4HKBB 3APDA 4LIQE 2LTQB 4KRPC 3UP1A 1K5NB 4G3YH 1E9QA 1HNGA 2NY7L 3QZNA 2X88A 3OZKA 5F3BB 1RK7A 1KZYA 3QJFA 4KQ4H 1FI8C 4FABL 4EBQH 2UWEF 5I75C 3K71A 4ONGH 4K71C 2HT3D 4FLHA 3WDIA 1N5AA 4NNPH 4L37B 4WTZG 4PJHA 1E27B 1ROWA 1NTDA 2LAGB 1S5IL 2WV3A 5IROA 4Z3FA 4I3RL 3IU4H 2HJFA 2NXZB 1MPAL 1YYMH 3BJLA 3GHBL 3NIGF 4M03A 4QCIA 1NGYA 2VUYA 1OD9A 5E6ID 1KCLA 1O7VA 2P24B 4FCHA 4NYLA 3BT2H 1LO5A 2P8PA 4KK5C 4I4WA 2PLTA 1R0AH 3UIZA 5B4MC 3BO8B 3NOIA 1E9PA 1GS7A 3RUGA 4NKQB 1ZLSL 6CGTA 5DYOA 3BKCL 3KPMA 1HK6A 3T0EB 4IRJB 3K2UL 3VUAA 1A7NH 3G6DH 3MV7B 4WSJA 5T3ZD 2OK0H 2BW5A 1N0LB 2PR4H 4HCFA 4OZ4A 5HHPB 2BY2A 3KPSD 3MV11 2P1QB 5AW3B 3PUUA 1CGSH 2JJVA 3MUUA 5HDHA 2V4LA 2Y07H 3D33A 2O6PA 5ADOL 1BZQK 5D7IA 3AM8A 2F7OA 5SX4I 3BDXA 4NO2A 3VRIB 5E99L 1IGML 2ATPA 1XR9A 5EC2B 4X5XB 3QS3A 4YDKH 1UA6H 5B3SB 1JK9A 5AG9A 1HXMB 2FHCA 2J25A 2HZHA 2YPLD 1KV3A 2XVBA 3GSUA 4XP9H 2BERA 1P69B 2Z9TA 1G43A 3JVFC 3RQ3A 5B38G 5C7XH 5LGJA 3ZX1A 3I3DA 3ZDZB 3O8XD 4QJ4B 2R2HA 4UNIA 2XTJC 3RGZA 5IMKA 4FYTA 3Q8BA 4TUJB 4OVVA 5MHSD 3ULAA 2A5UA 4KZCA 2WLLB 2K78A 5KSUA 3KPRE 3OGKB 5F8RC 3NAAL 4I5BB 1YZZA 4L2YA 4UUJA 4TVUA 1E7VA 4QTFA 3LIUA 2RD0A 3RVXD 4DT2A 3JTTB 3M86A 4TUUA 4KT1A 1FHNA 4F8QA 4YLCA 1EGJH 2IGTA 1LNUA 3BT0A 5FA3A 4UQEA 5AYQA 1YEFH 3EDFA 3MGAA 3U2IA 2VN5A 1WAEA 1Z9NA 3HPLA 4DVRL 3GI8L 5ANMA 1FL3A 2FECL 4GUQA 1YEIH 1AP2A 2BPBA 2FZ3B 4NHUA 4CKVX 3WO4B 4BD4A 4X6CF 4R90H 4F2MA 2X42A 1T4KA 3SBQA 5C6TH 4RSVA 3WEBA 4RMBA 5JUEH 3WXWL 4G6FB 5F97E 5C3LD 3HS0A 3QCUL 4KVNL 3C5ZB 4L4TA 3V0DA 5F1NB 4UILH 1H6UA 1AIFA 3A21A 3B9VA 4QR7A 1OY3B 1XD1A 3TL5A 4PRDB 4FZ8L 3U48A 3B2DC 2E27L 2EXSA 3FF7A 3R1GH 5D7JC 1SGKA 3X3FH 1GZPB 1A6WL 1ZLDA 3GM8A 3KVPA 1YA5A 4XMTA 3QNYB 5CCHE 1P0SE 2ARJA 4KWUA 1FPTH 1RERA 1BD2B 3MLRL 43CAA 3NQKA 3MV01 4Y16B 3TPUA 1S5HB 1E2VA 4CJ1A 3AUVA 1LP9B 2UY7A 3A6BL 1J9TA 3D85A 5BRZE 1ZAGA 2K3TA 3P77A 5KAQF 3WFBH 2OMYA 2BDNL 2IQ9L 4OAWA 5MEPB 3RX8A 4WCYL 5E2VL 2G60H 2QGDA 4KBPA 3VFSA 1F3DJ 3NABL 2WO2B 3D6GA 3MREA 5M7QA 1TQWA 3SDCB 3EJZC 5AUMA 4O2FB 4O58L 1EO8L 3B7YA 1O6SB 4AQOA 5J8OA 1U4FA 4FYSA 4XXWA 2GYSA 2YC1B 3EYVB 2NY5L 4IGBC 2OJEA 3FSVA 5I0VA 4KX9A 4MNHB 3AY4C 1BZEA 4F8OA 3FOLA 5IUSA 3M17A 3DGGB 4ZO7A 3E3ZA 5KJRH 4F91B 2I5YH 5ESQA 5HSFA 2B59A 3VQ1C 2HAZA 2XACC 3GXNA 3ML8A 5CUSH 5DUBB 1T03H 4TLTA 1NCCH 5HYJD 3V4VB 3U46B 2NW3A 4WY7H 4PB9H 5E6SB 1I8AA 4WRLA 4LSVL 4KUZL 4MCYB 4W9IC 5SWZA 3DO7B