4FDWA

Crystal structure of a putative cell surface protein (bacova_01565) from bacteroides ovatus atcc 8483 at 2.05 a resolution
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
381
structure length
381
Chain Sequence
ASLEDFSIEQLPAKTIYALGENIDLTGLNVTGKYDDGKQRPVKVTSEQISGFSSSVPVDKQEVTITIEGKQKSFSVHISPVRVENGVLTEILKGYNEIILPNSVKSIPKDAFRNSQIAKVVLNEGLKSIGDMAFFNSTVQEIVFPSTLEQLKEDIFYYCYNLKKADLSKTKITKLPASTFVYAGIEEVLLPVTLKEIGSQAFLKTSQLKTIEIPENVSTIGQEAFRESGITTVKLPNGVTNIASRAFYYCPELAEVTTYGSTFNDDPEAMIHPYCLEGCPKLARFEIPESIRILGQGLLGGNRKVTQLTIPANVTQINFSAFNNTGIKEVKVEGTTPPQVFEKVWYGFPDDITVIRVPAESVEKYKNANGWRDFTNKITTF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Structural genomics, unknown function
molecule keywords leucine rich hypothetical protein
publication title Crystal structure of a leucine rich hypothetical protein (BACOVA_01565) from Bacteroides ovatus ATCC 8483 at 2.05 A resolution
rcsb
source organism Bacteroides ovatus
total genus 118
structure length 381
sequence length 381
ec nomenclature
pdb deposition date 2012-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07523 Big_3 Bacterial Ig-like domain (group 3)
A PF13306 LRR_5 BspA type Leucine rich repeat region (6 copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.3630 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4fdwA01
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 4fdwA02
4R6GA 4R07A 1U0ND 2XOTA 3A79B 5A5CA 4Z8GA 4PQ8A 4PERA 1XEUA 4FMZA 3RW7A 4WYKA 2XWTC 4R6AA 1Z7XW 4NKGA 4RWTC 4FHOA 3RFSA 4FCGA 1SQ0B 3M19A 2OMVA 3W3JA 3UL7A 3OGKB 1FT8A 4OQTA 5IJCA 1OTOA 5GS2B 4CC4A 4L3FA 5AWAA 1WWLA 5AWCA 3G04C 1W8AA 1QYYA 3FXIA 1KOOA 4LXSA 3E6JA 4NKHA 2ASSB 4AW4A 4UFRA 4BSRA 1FQVA 4R5DA 1KOHA 4ECOA 4U09A 4WP6A 3WPIA 4Z94G 2RR6A 3W3NA 3RJ0A 3WPBA 1P8TA 4R09A 3RFJA 4R58A 3E3ZA 1ZIWA 4V2CA 1H6TA 1M9SA 2WFHA 2OMXA 2OMTA 4M7EA 3OJAB 1DS9A 4Z64C 3JB9j 4BSSA 5GMFA 5IJBA 4Q3IA 2CA6A 4R6JA 2UZXA 5GMGA 2Z64A 3E2JA 3RFEA 1H6UA 3ZYJA 1M10B 3C6NB 4J4LA 4Q3GA 3ULAA 4M7EC 4KXFB 3ULVA 4LI1A 4AY9X 3RGZA 2Z7XA 2WQUA 2OMYA 2A0ZA 3W3KA 4C2AB 1JL5A 2V70A 4KT1A 4GLPA 3RGXA 4LXRA 1XCDA 3C6PB 3TSRE 4U7LA 1FS2A 1DCEA 1K5GC 1FO1A 5HDHA 2R9UA 5AWBA 5AZ5A 5CMNA 4Q62A 4BSUA 4Y61B 1O6SA 3C6OB 5FTTB 2O6RA 4LSCA 2BNHA 4HQ1A 2Z65A 4Z79A 3VQ1A 1DFJI 4LSXA 5GMHA 2Z63A 3RW6A 1G9UA 1PGVA 1OZNA 2Z81A 4L3AA 3GOZA 3UN9A 3ULUA 4FD0A 2Z66A 5B0NA 3CIGA 3E4GA 1A9NA 4R0AA 2ASTB 4LSXC 4LI2A 4QXEA 2JE1A 1YRGA 3G3AA 4ARRA 4Z61C 1GWBA 5IYXC 5IJDA 2BEXA 3G3BA 4EZGA 3WPHA 1O6VA 1OOKG 1A4YA 3OGMB 1XECA 4XOSA 2ID5A 4K17A 2ELLA 2Z62A 2JQDA 2O6QA 4PSJA 2OMWA 3WPCA 2Z7XB 3CVRA 4FS7A 2OMUA 5CMPA 3RIZA 2IFGA 2P1NB 3W3MA 1M0ZA 2P1MB 4LSAA 4P8SA 4GT6A 4XSQA 2RA8A 2UZYA 3M18A 3WPFA 4R6FA 3WPEA 3KJ4A 3ZYIA 4MQWX 2Y5QA 4G8AA 1IO0A 1D0BA 5LFNA 5D3IA 1XWDC 3O53A 3PMHG 3W3GA 3G06A 2P1QB 2WQWA 3OGLB 4U06A 1P9AG 1M9LA 2WQVA 3P72A 4C2BB 4ECNA 3DZEA 3W3LA 1OGQA 4V2EA 2V9TB 2P1OB 5B4PA 3CIYA 3G39A 2V9SA 5GS0A 4IM6A 3WN4A 2OMZA 4CILA 4CC4C 4V2DA 3VQ2A 2Z82A 4XGOA 4RCWA 5GQRK 4CNMA 4R08A 1XKUA 4FDWA 4QBZA 4PEQB 4BV4R 4RCAB 1K5DC 2Q4GW 4YEBB 4R5CA 3BZ5A 3WPDA 4PKIG 4H09A 4ARNA 1O6TA 4U08A 4B8CD 3UL9A 3UL8A 3ZYOA 2JE0A 4KNGA 4TZHA 3REZA 3SB4A 4CP6A 4I6JB 3O6NA 4QC0A 2P1PB 1P8VA 1LTXA 1OTNA 2O6SA 3ZYNA 4MN8B 1OTMA 3OJAA 2FT3A 5B0TA 2WQXA 4J0MA 5AWDA 4CNCA 3WPGA 4P91A 5HZLB
chains in the Genus database with same CATH superfamily
1WBYA 1GGTA 2DKUA 3FUJA 4YFLF 1ZEAH 1L5GB 3BO8B 4YBLC 4HJTA 4JY5H 3RTQC 2CZNA 1A7RL 3H53A 1NH6A 3KYAA 4GO9A 4XTRC 3ARGA 5JIDA 3GT6A 1U3HD 1I3RB 1MI5A 3VFSB 5ABZA 1PYWA 4XO4A 3QXDB 1ODAA 4GAJL 4HIIA 3WBDA 1W72L 4FQXB 3EKCA 3STLA 5EOTA 1AGFA 3LKNA 3RW7A 1KV7A 3D9AH 2W95A 3KWWA 4JUSA 2BVOA 1XGPB 3PP3H 3NYKA 2HZHA 2Y22A 1KBKA 4X98A 5KYYA 1J0HA 3SQRA 3WIHH 1OT2A 5IBTH 3QR0A 1RURH 4DQAA 4DTGH 2ZPKL 3P3UA 5D96B 5IW3A 4RSYA 3U46B 4ZXBB 4UT6L 5IZ7A 1Q9LA 4PGDB 2NY3B 3HN5A 3MLYH 4Y2DC 3SJVE 4QXUH 3O45A 1R33A 1D3CA 3VXOB 4YSAA 3QEUB 3V0JA 2X6AA 4X6CE 3VRLF 3C6SA 4A2FA 3ZKQD 5F7DB 3C9NA 3D4ZA 4PREA 5CS7A 1UOKA 2OCCB 2OSXA 5DJYA 2XPZA 2FIKA 4MXQC 2AKRB 4GB9A 1RP9A 2EYSB 4Y1AA 3EOAA 2BDNL 1HXKA 4AQOA 4NQDD 3O3BB 2CJTA 4I13B 5D1XD 1XB6A 1CURA 4MQ7A 3L3DB 4N6RA 3PHOA 4HWZB 2R2CA 2HN7A 3ZBMA 4NC1E 2O61A 5AAWC 3X12A 1JN6A 1S7XB 1ZE3C 3DOSA 3E6JA 5JHDE 3ZQXA 2FGWL 3QDJE 5KSAB 3CK0L 3NH7H 4JG0L 1WCBB 5DRZB 3QH3B 4QRRB 4AT6A 4XPFL 3CVCA 3WUZA 4TLUA 1MFEL 4R3SA 3L3HA 5ISZB 1AC6A 1EK3A 4KMTH 1NUDA 3P0VL 5EC1B 2BP8B 4NC1C 4JX0A 3O81A 4Y16D 2QQNH 2ZICA 3SN6N 2OXHA 2IO5A 3FB5A 4JG1L 3ZE2E 3HS0C 1EJ6A 3WIHA 5ID1A 3QZWA 3U48A 4PLJC 1G9NC 3QUXD 4JO1L 1W6WA 4OJEH 3FFCE 1KJMA 4HVBA 5B4MD 3JT0A 1YEEH 5KVDH 4FFWC 3VI3B 4PW9A 4ZG1A 5DUBB 2VDPL 2ITDA 3CH1A 2GSGB 5F3BB 1QWNA 1CFQA 2FK9A 3HCVB 3ZHLA 4DHLA 2QV2A 5C0BB 2GW5A 1BQRA 4Z76A 2VQTA 1MF2L 3QHZL 3ABKB 1QR4A 5FW7A 1NOFA 3U6XS 4XCYA 3QNYB 1IU1A 1MAML 4ETQA 3E3ZA 5HI4D 4UQDA 2ICWB 4XP1L 4GPVA 1KTBA 2ZXAA 3WS3A 1NCWL 3NCXA 1W0YT 1E5AA 4TSAH 3RURA 1DSFL 3KPSD 3VDCA 1SY6H 1UZ8A 1E9PA 3A4DA 4W6XB 4NWTL 3FFOA 1FSKC 4X0KB 2VB5A 1NIEA 1AS6A 4XGZB 2R8SL 2PYEE 4PJBF 2RCSL 5F7EL 4CW1A 3P2DA 4FRWA 2LU4A 1WUNT 3ZKSD 4Q3IA 3C6EA 3UAJC 1YVLA 5C0AE 2C9SA 5KEZA 4PJ8D 2NXZB 4U1JA 3H3PH 2FJHB 3QFDB 1SYSB 1YEGL 3CXHJ 3T3MF 3ULAB 3PL6D 1WBYB 4DUVA 1ZS8A 2IC2A 2EDJA 1BVOA 4A7QA 4GRMB 1KJ2B 3MOBH 1LO4L 2OX5B 4M61B 4U3HA 3KAAA 1PJ9A 4WEUD 3RGBA 2VXSH 2JJSC 4N26A 1PYWB 1AS8A 5DD6A 5I5IA 1OSZA 4XNUH 2CD0A 5EOTB 3LKNB 5KTEH 2A0ZA 3EBGA 4HJJH 3A3YB 5IWLC 1RIVH 5JW3H 2ZCHL 4WSKA 5LXGH 3MLVL 4BUHA 1FIEA 3OJMB 2G9KA 4X98B 2DLFL 4C56A 3RUGE 4GLPA 1RZFH 4F33B 3S36X 4BINA 1BQLH 4M5SA 5EEVA 3H55A 3G5ZA 3K6FA 1Q9LB 2FL5B 1UWEH 2XPYA 2R4RL 3O45B 4WAFA 3ZLQC 3QIWC 2YQBA 3G04A 5F3FA 4AVKA 4K4KA 1SY6A 2A9NH 2CGZA 2DLTA 3C6SB 1CD9B 4UQAA 2CBOA 1D6VL 3VD7A 1JCKA 3C9NB 1JIBA 3U82B 4FZEH 4Q6IB 2MNJB 5DJYB 4G8IA 1OARH 1R46A 2FIKB 3C5ZA 3MA9H 4BZYA 4Y1AB 2QADB 3EOAB 3QHTC 3JYBA 3UP1A 1MHHA 5AZ5A 2F7OA 2X88A 3HZMA 4FXGC 4U4IA 3AM8A 2X4RA 2XNAB 4JREB 3FUEA 4MQ7B 4KRNA 4PMFA 5C7ZA 2DMCA 2HN7B 4ZUWA 3RHWF 1QPXA 5L2KE 3NSXA 4EO5A 2H2SD 4FQJL 3X12B 1PX4A 3DOSB 3GSRB 1A7QL 3BXNB 4PJAE 3GBMH 3MOAL 3LRMA 4NUJA 3NA4A 3Q1SL 2DQFA 3IJSA 3BD3A 3FCGA 4B9PA 4AT6B 4ZFOA 3GI9H 1CLYH 2O1AA 3F2LA 2IWGA 3NFNA 1LWHA 1S78D 4RRPA 5B38A 4XXCC 25C8H 2NY1C 1EX0A 3L3HB 4QAMB 4ZDHA 5C08B 3CCHA 1GS8A 3OQRA 2HMID 4JANA 4Y8AA 1KCVH 4NM4L 3BSGA 4ES8A 2Z66A 5ID1B 2EDKA 2YRLA 4YOKA 1KJMB 2DWDA 4M5TA 3MRCA 4XB8A 4PGEA 3BDYL 4N2DA 1H0DA 2AANA 1RHHA 1VCAA 2AITA 2DICA 3WXWH 1A21A 1TJHH 2ITDB 3CH1B 3VH8G 4APQC 3PPEA 2IAMC 2X9ZA 1IAOA 1FJ1B 5C0CE 4ARRA 5F2FA 3CFKB 3NEOA 5I71C 2J2ZA 4GXUM 2CO1A 1NDMA 3DUSB 2PR9A 3WS3B 3HE6A 2ITCA 5IVNA 3MV8B 5JORB 1M53A 4OQTL 1YEHL 5LXVA 1EO7A 1S3RA 4JB9L 2CDEB 3H8NA 1D5IL 2BNRA 2R56H 5E0FA 2ZWKA 1PAMA 3U6XA 2WB7A 1AYOA 3SSGA 3V9EA 5BZXA 2ARJA 5CU5A 3UYOD 3V55A 3BSHA 1AD0A 2CK0L 3JWOL 3VVVA 2Z92B 2M2DA 5HDLA 1YMHB 3QDHA 4MNGA 3WDIA 3LDBC 1GAFH 3OBAA 1KB3A 4CW1B 3EYSH 3O11A 4NKMB 4GRWF 3HAEH 1RULL 3OKOA 4U1JB 3ZYZA 1IKFH 1JI1A 3BKYL 1J1XL 1RP8A 3NTCL 1ZTXH 4MJID 4GBXC 5EC2A 2NW3A 1QWHA 2PF6A 2B59A 2WM0A 1ZS8B 2Z6FA 1SBBA 5LGHL 4HSCX 1VRSA 1F11A 4JLRA 3SGKC 1ZT1A 2EQDA 4HS6A 4ZUSA 1DUZA 2C9AA 1YNLL 4HAKA 1E5ZA 1AQDA 1IBFA 1BCIA 3SE6A 5IIEA 4KGLA 5JLZA 3BH9A 3SE8L 4LSQH 1AR2A 1WZ1H 5BMFH 3EOBA 2O6DA 3ZZLA 1QR1A 4B60A 1A25A 3HMWL 1NAKH 5IVXB 2NSMA 4LEEA 4YE0A 4YN3A 1D7BA 2NY5C 4HK0A 4XP4L 1OAUH 4C56B 1AZZC 1GY1A 1XGYL 4DK6A 3IMWA 1BOGB 1KCSL 4R4ND 5CSGA 1TCMA 3G5ZB 1QNIA 1PKQE 3N2JA 2VLRB 5L0QB 4YWGL 5DQ9A 4K07A 3HR6A 2QVKA 4UDUB 2W0KA 5CZXD 5A3IC 5HD8C 3IFNL 1OPOA 4FXKA 4OCWH 4O5LH 5ANHA 3FQUA 2JKJA 4G8IB 3GK8L 3C5ZB 5LAXB 1H5BB 4J12A 1MHHB 3MACL 3HZMB 3KCWA 4PV8B 3HAEA 4PWIA 1JNHA 2PXYD 3PABB 5HSFA 1XZWA 3O53A 5JDJA 4PIRF 3V6OE 2FQDA 3GRWH 3O41B 2Q3XA 5DXWA 4YDVA 4ZUWB 2DIEA 5C09E 3W1ZA 2H6UA 1GZHC 3SZKC 2COVD 3Q44A 2CDGA 3BI9X 2P46B 1Y1DA 4NUJB 5DD0L 1GL4B 1XL6A 3W39B 3LKQA 5D6DC 2BSDA 5J11B 1Z7JA 4WU7A 3QORA 1JZ3A 2K6WA 1P9AG 2IDFA 2WNXA 4IRSA 5J06A 3OVUB 1AHMA 3ECQA 4ZDHB 3V6OC 3VFOB 3CCHB 4IGBD 1LO0H 2BIOA 4FZ8L 5LHDA 1DL7H 3TOPA 1WWBX 4JANB 4MAZA 5AALA 2GITA 4IBZA 4XNAA 2X9YA 4WW2A 1T21B 1IX2A 1FUNA 1YY8A 5CN2A 3VJ6B 3WFCH 2DWDB 5AW6B 1YYLH 1CGXA 1OGAD 3ARDA 2GJPA 4YLBA 1ZHBB 1RHHB 3GMQA 4HJEA 1FNEA 1OT1A 3LB6D 4F24A 5A6LA 4HFWA 3UP6A 2Z1KA 1J0IA 1IAOB 1L0PA 4P9HH 1UD2A 4XC1H 4PJ5A 2EZ0D 4G1MA 4NRXA 4HJGB 1CD0A 4KJQD 4UQBA 2R69A 4MCZA 1UCBL 4OCSL 4CVXA 2Z82A 2J2ZB 4HWBL 4ODSH 1NDMB 1UVQA 4FDWA 4F7CA 3QDGA 2CM5A 4TQIA 3GRWA 5D70H 1FHGA 1FCCA 2J8OA 4PSPA 3NCYP 1YN7B 3CC1A 5HJ3A 3ZN6A 4MCMA 3LMJH 2I5YL 2BNRB 4NJ9L 1JD7A 1NGQL 4E9LA 3LVTA 1TKWA 1BZ9A 4FFZH 2X12A 1JDCA 3KPOA 4G7VL 4MNGB 5D1ZI 5AD0B 3WPDA 1W80A 1KPVB 3O11B 5TE6H 2FEEI 4PY8I 4FI8A 4GQ9H 3PGFH 5CJBA 4YR6A 5JPMC 4PKIG 5D5MB 3OKOB 3D25B 3QEQA 4O2FA 4F57L 1NFKA 1ID2A 5EC2B 4FG0A 2EIMB 1T2XA 4YSOA 5I18H 1B9ZA 2JJWA 1F11B 1JL8A 2DQHH 3ZYOA 1ZT1B 4ZUSB 1IUZA 1K4CA 1DUZB 1QBAA 3K1DA 1KC5H 3KPRD 4B53A 3POCA 2WXLA 1U42A 4MD0A 4P4RA 1AQDB 2NZIA 3O6NA 1UZ6E 5IIEB 2K70A 2VSCA 2HKFH 4PBWD 3OD3A 5BS0E 3BH9B 5FLVA 1HHKB 3FOLB 4OU3A 5DHDA 3QJVB 5ICYB 2P1PB 3LH2H 3TT1L 1ZK9A 2EXWC 1HI6A 3AFLA 3VXSD 1FFTB 2UY6A 3PWPD 4FNLH 4W6YB 4RBPH 3IM1A 2GJRA 2IPUK 2AXWA 1A4BA 1X4YA 2VJ8A 5GJSL 1YC7A 4KX9A 2ZD0A 2I26N 2MH4A 5LN4A 5AWDA 2WPGA 3T8MA 4GI8A 5DQ9B 1O7SA 2R0ZH 3QJHB 4JG9A 1M7IB 4QNPF 5C8JB 2QSVA 5GRXG 1HHGA 1LLAA 4FXKB 5DVOA 3VG9B 3EO9H 1QFUL 2WV3A 4FFZA 4N0UA 4UWQB 4CVZA 5J6HB 5DJCA 1TTAA 3HC3H 4LK4A 1U0ND 2VQ1B 3LHAA 2C7UA 5IJBC 4PJFE 3O2WL 4BKLA 3ZRSA 1F18A 3GSQA 4XXDA 1CB4A 3HAEB 1JNHB 3AS0A 3HFFA 3JBG7 3SIKA 4FFVD 5MP6L 4PERA 1E4HA 2Q8AL 3N42B 3INUL 5B39G 4QDGA 4C4UA 3D30A 4X5LA 4RISL 4OKVA 3RPIB 3QIUA 4Y9FA 1UXWA 3T2LA 2AHIA 4Z7AA 5K9JH 2I27N 3LKQB 3IDUA 4NXKA 5IREA 1PEWA 4UT9H 3UG4A 1CN4A 3BSZH 4WU7B 4YIQB 4MS8D 4POUB 3T77A 4NFDA 5EBMA 4LASH 4DNLA 4L3EA 3B2XA 4IRSB 4JR9L 5A1AA 2DKSA 1MW3A 1WBZB 5DURB 1FAIL 2FWOA 1FT8A 2AQSA 5HBBA 1TO4A 2RJMA 3Q2VA 2DLHA 4J3SA 1BFOB 3H3KA 4WW2B 1TIUA 4KUCD 2VWEE 2MCG1 1YY8B 2B1AH 4PY8J 1ZJAA 5D7JD 2X5PA 2WWOA 4FS0A 5AWAA 1RZ7H 4RNRA 1T2JA 2BP5M 4QTHB 5CGBA 3D3VA 5A40E 1FNEB 3D7PA 1L9SA 5CP7A 1J5DA 3IU4H 4HFWB 1J8HB 1FL3B 2XQ0A 3LRGA 5GZND 2CCLA 3RIFF 4GRLC 4G1MB 4L4JA 4NRXB 3VRJA 3BPLB 3E38A 1I8AA 4BEIA 2WXPA 1QLFA 3FT3A 1UVQB 4WW1B 3T0WA 4BZ2L 5HHOE 4F7CB 4WWID 1K3ZA 4HWEH 1S7QA 1YY9C 5HJ3B 5GSVA 1TNMA 2PWHA 3CVHH 1RZKC 2CIKB 1EEQA 1IM3A 1QPKA 1TKWB 2MNWA 4WP6A 1BZ9B 5FA4A 1AP2A 1MRDH 3GPEA 4E41A 4UT9A 3R18A 5HY9A 2HG5A 5HJBA 4JFZH 1PZ5A 4Z7QE 1OAKH 3GXNA 5FYJD 3I2CL 3QEQB 3D85D 4O2FB 3SE9H 4G8GD 1P5VA 5B1BB 2O26U 3DMMC 5ADPL 1FG2A 4R09A 3S5YA 1K4CB 2V8LA 1OK0A 2YPLE 3Q5YA 3WEAA 5KS9E 3LQZA 3E6FA 4Z7NB 1V3JA 4MD0B 4J2XA 2FX7H 4R58A 3QUYD 3OGCA 4IRJA 4A2HA 1U6AL 4TSBL 4KK6C 3ML8A 2ZWYA 5CILL 2UY6B 3MC0A 2QR0A 3FOMB 4L9LC 1RUML 4G2AA 5TPWH 3TH4T 2NY7H 2YS4A 1O9ZA 2CU9A 2OMTA 3MROA 3OLGA 2A1WH 5CGYC 2P44B 5SWZD 1ZHNA 2E56A 5IK3B 3ZMRA 4K8RH 1HAUA 4KH2A 1N9PA 2G60L 1IC4L 2EDTA 1V3LA 2E75C 4IQHA 3CVHA 4UTAA 5A2CA 5GMGA 3QO0B 4OI8A 3T0BA 1HHGB 3KYKH 5DJDB 5CP3H 3CHQA 5SX5H 1J9SA 4H13C 2W65A 5TF1L 4CVZB 4XVJL 4LARH 1OGTA 2Y06H 3U4EB 3KR3H 2YMXH 1U8OA 2DYPA 3GSQB 4XXDB 2OS7A 1GIGH 3MZGB 4KQ0A 3TVMC 1ZT7A 2OSLA 2NT0A 3A6OA 2E7BA 4P0DA 4OKVB 2EIBA 4X80L 5DFVC 5DJ8A 1QYGH 1VFAA 1PZAA 1DR9A 2WN3A 5JMOC 4K3GA 2AK4D 2GABA 4J3OD 4NNXA 2AK1H 3REVB 5EBMB 1TZHB 5DT1L 1XCDA 4UNTA 1JCVA 4JRXE 3ZY7A 4WUKL 5CLXA 1FS2A 2XFGB 5LLIC 1DQML 1MFAL 1K5GC 4KDTA 1B4JH 1OIOA 1ORSA 1PVHA 4LQFL 4KVCH 4GAYB 2YD6A 3GHBL 3FN9A 4HYTB 1IT9L 4JM2D 1F3JB 3ECUA 2GPZA 4LOEA 8PAZA 1CFNA 1XXDC 1OAJA 1FH5H 1WFOA 5CNHA 2F53A 3K5SA 4G6KL 3SDYH 1YUKB 5CP3A 4R0LA 1KENH 4NIYE 3VGAC 5BQ7B 2EUWA 4RWYH 1ZV9A 2WBJD 3ZZQA 3FH8A 4H0GA 1QP1A 4L1HA 5LCVH 4JKWA 1INEL 1MLCB 4LT7A 2OP4L 2H45A 3UG3A 1QLFB 1A5FL 4UOQA 1NLBL 5IJKC 4Y2LA 1DZBA 5GSVB 4BZ1H 1UASA 5F1NA 2ROYA 2RMNA 2ENJA 3CXDH 2D7QA 2DJSA 1IM3B 1AOHA 1AP2B 1S7UB 3AVEA 5HDQH 1T83A 1BHGA 4E41B 4BK4A 2JKWA 2KERA 5CO1A 1QI4A 3D33A 2VLMD 1HESA 4MJ4A 4PJCE 5CEZE 3L9EA 3SGJC 3MRQA 1PZ2A 3QAZB 2J8UE 4S10A 3VSVA 1AMYA 1MH5B 2X4SA 4JZNA 2JLPA 1FYHB 2XPGB 1P5VB 1DEEA 4HUXA 3VM5A 4JHAH 4ONFH 5FYLD 5HPMA 4TQEH 5PAZA 5IGXL 1JTPA 1FG2B 1ULVA 4Q97A 4Z78B 2XBDA 1SMOA 5FYKD 2ED7A 4GW1A 4M4PA 5AVVB 3LQZB 1RVFH 3P30H 2YQGA 3OGCB 4TUOA 5TDNB 3EO0B 4JNXA 4PD4J 4R97B 2CJUH 2PCXA 2P4AB 5ALBL 5I74B 3N0AA 2IADB 2KC0A 2LLLA 1IQWH 1U8CA 2PW2B 3D69A 3DKHA 5CCGE 4MD4A 3NDYE 2QR0B 4I8DA 1SMAA 1ZA3B 2OI9C 2FO4A 4H20L 5LCVA 3MROB 1TT6A 1X4ZA 4P3DA 1WT5C 1SHSA 1ZHNB 4Z0BL 4ZMAT 1FZJA 5EU4A 4OZFG 2OW7A 4XOSA 1Z2KA 3BN3B 4H8PA 3QS3A 2JKXA 4BZ1A 5L6YH 4ELMB 3VI4E 2KPNA 4TVSa 4K17A 2MTPA 4P9ML 1J9CT 5FB8B 1N4XL 4GSXA 1UD8A 5IQOA 4N28A 4P4KB 3B2UD 3HE7D 4AMKL 3MTXA 2R2BA 3ZGHA 1P4LA 1FO0H 1FH2A 1CFTA 5H35A 4M6ML 2H2PD 4LSVL 4PCYA 1U8OB 5TE7L 1MJ7L 4LZKA 5HI5D 1BIHA 1IBBA 3UDWC 1THCA 1LK3H 3KWXA 4WENB 3ZE0E 1ROWA 2VDML 2C8NA 1DANT 1ZT7B 3LV3A 1WBXB 2OSLB 4OLWH 4Y88A 4U49A 4XVUD 2P1NB 4JKMA 1VFAB 3DGGB 2C9QA 5FLUA 4L0ZA 3QJRB 2NNRA 4M48H 5BXFB 3RZCC 5DFAA 4HF5H 3PHAA 3FULA 4I7ZC 5FGCE 1IBHA 4I3SL 2RA8A 4IIQA 4OZHB 2N7BA 3AQYA 2FR4A 1IGML 4N87A 3WIIH 3FFDB 4K71B 1S3KH 4EI0A 1J11A 4ERSH 2FSEA 4FNPA 2XCMC 2VZ1A 5DVKA 2OL3L 1AG0A 3HI6L 3Q13A 2J4WH 3TN0B 1OTSD 3CD4A 3QDMA 4E9RA 4I9XA 5GS1A 3FT4A 2VDKH 2BZCA 2K9UA 3G5VA 1ND0A 3LPPA 1WV7T 1WJ3A 4C83A 3HG1D 2F53B 3BAJA 4LCWE 4NZRL 3NRFA 4PRIE 4PQXA 2AFNA 4R0LB 3FAXA 5EMYA 1A7RH 1BQSA 2EO1A 4Z95H 3S36L 3ILPB 5C6TL 5SWQB 1FO0A 3R4RA 3TWCL 1MCQA 1CR9H 3FONA 2JKNA 4GYBA 2UWEA 4I77L 1JWUB 2F54E 1VERA 4UQIM 2MPAH 1XF1A 1BD2D 1CF1A 4LP4A 1SBSH 2YGOA 1T0PB 3NIGE 1ZV2A 2CHWA 2WQVA 1A4AA 4WTZA 4WV1B 5F1NB 3WFEL 4C2BB 3V0EA 4Y5XC 2PP7A 3DXAE 2MEJB 3KXFD 3T0DA 3PP4H 4RGMC 2VXQA 2ZPKH 3FQXB 4L5FE 2ZOKB 4DP2X 3T1WA 4UT6H 2AJVL 1S9KC 1BJMA 1R1CA 5AOMA 2VDRL 3MRQB 4NC2B 4JZNB 3AQZA 4ABUA 5DZVA 3ZR6A 4HUXB 5HPMB 3IDMA 3R19A 2BDNH 1MCHA 2ADIB 3DPBA 2WTOA 4U4BA 1X9UA 4WU5A 5GIRA 4GW1B 1EXGA 4K0OA 4JFVA 5IUCA 4NUPA 1HYSD 4CILA 5EN2B 2NR6D 3D2TA 3VXRA 4AKOA 3EGDA 4TUOB 4R83A 1CXIA 4HKJB 4RCAB 3PREA 4MD4B 2FGWH 3A67L 4YQXH 3OR7A 4KHTL 4Z7WF 5H8DA 4ZTEA 5CCHE 4F58H 1F6LL 3QXVA 1NGYB 2FO4B 4C59B 3LKSA 1PFCA 1B3IA 4P3DB 1RZ8B 1W72A 4PJGF 5J12B 2CLRA 1F13A 1FZJB 1IFGA 2V5RA 2XTJC 2YSSA 3L3KB 4AQZA 5I9QB 3P0VH 2D4DA 2KBGA 3L4XA 4Z7VA 5FXCH 1SQMA 4YHZL 5AB0A 1BPLB 2PP8A 4U08A 2A9MH 3QZLA 2F7IA 2JJVA 2JCCE 1ZWIA 1FBIL 2LT9A 3V4LA 5CBEB 2W07A 1HL5A 2R2BB 3EJSA 1P4LB 2CNYA 2LVCA 3OHMB 4UT6A 5FO7A 1HXMA 4IU2A 5F7FA 5H35B 4DT2A 3VFRB 2GKIA 4BXSV 4E42A 3L3OA 3PNRB 4TZHA 3ESUF 4I6JB 3D0VA 2VDPH 3KPTA 5BJTA 1NANH 4NZUL 1ORQA 4PRNA 4M5YH 2GTQA 4J6RL 3QHZH 4UOZA 2APSA 3FCSA 5C3IA 1OHQA 1UGNA 5F0MB 4KK9C 1AIZA 3B34A 1SM3L 3BVUA 1UA6L 4IIQB 1T6BX 2Z31C 1JF5A 1YSOA 3I6GA 5AVTB 4PG2A 2FR4B 4FQLL 4JFFD 1LEKA 2BWIA 4PR5A 4NWTH 2DQDL 2Z3FA 3KVQA 1I3UA 3VTTA 2FSEB 4KROC 3DV4A 3QISA 1CICA 4Y9EA 3IE9A 2R8SH 2RCSH 5F7EH 3O4LA 1O7VA 2BOCB 3QDMB 3RTQD 3AS1A 4XTRD 5GS1B 3AREC 1A2YA 4XT1C 4DP9X 9CGTA 5DMJB 3FB8B 1YEGH 3O6FB 5AW0B 3MLUL 1ND0B 3DIVA 2XI9A 3OZKA 4GAAA 4IOFC 4C83B 3L8QA 3IPEA 4FHBD 4C8XA 1JZ4A 5AOKA 1YEKL 4CSZA 4XVSH 4JFEB 4WWKB 3FONB 5FO8A 5EF1A 2UWEB 3IS0X 3B5HA 4O58L 1L4IA 3ULVC 4AVHA 2NTFA 2P8PA 4X0NA 4GP5B 4HCGA 4HBCL 4R90H 1V7ML 4CMMA 2QSQA 1ZVHA 2ZCHH 1Z5LB 2R1WA 4WWNA 1KGJA 4Y2DD 3QWOA 3RVTC 4MWFB 4M5ZL 4WSJA 3MCKB 4D9QD 2W59A 3P0YH 3ROLA 2A0LC 3BHBA 1QFWM 3QYMA 3S48A 4GG6B 5EU5B 3M8OL 3QJXA 4MXQD 3SDCC 2R4RH 4RVBA 3RHWK 2WZ6A 4LVOC 4RZKA 1RFDL 4L3FA 5MENA 1AVAA 3GHEL 5E8OA 3IDMB 3D07A 2JFCA 4YNYA 5K1JA 1JVOA 1NM4A 1RIHL 2O72A 2OR9L 2WLHA 3DPBB 4H26A 4FQPA 3ULUF 3FXIA 4P46C 1KCRL 4Y19D 2CBTA 4UM8B 3AWFA 4GW4B 1JV5A 2EDRA 3V6FA 3L1OH 4ORZC 4W9HC 1CGSH 1A0QL 1HOCA 2WY3B 4EI5A 3KWUA 5C7XH 4WO4A 4QO1B 1SFDA 3MOAH 5D55A 4BK5C 3AWGA 1KLUA 3Q1SH 1AMXA 1I9IL 1EAPA 4BFGA 4DZBA 2IANE 2C4XA 4V1DA 3T1FA 4A6YL 1F3DH 4NPJA 4QWWC 3QUMH 5D7IF 1JFQH 3QDJD 2CLRB 1Q8MA 3DX4A 4OFQA 2VRKA 3N1MC 2IF7A 1BYOA 2HRPL 3PF2A 2WWMD 3UPRA 4KI5D 3W3NA 4Z7VB 2YD5A 5FEBA 4NBXB 4P2RB 2X4NA 4AJWA 3NACH 1QBBA 4NM4H 4FFWD 3QCVH 4WRLA 4MA1B 2AGJL 5GISH 1A6UL 2HTLC 3Q7JA 2W07B 1U8KA 1HC1A 3NJFA 2BCMA 2PP9A 4MA8L 2HJKA 3K2UH 5FO7B 3BDYH 2QVTA 4NZTM 2NY4B 2AABH 5EUOA 1ZD6A 4JHZA 3HC4L 1VB9A 1FZMA 2ZNWA 3D0VB 1G4MA 4XPGH 2X40A 1QFWI 1CGVA 2R1YA 3FFCD 4AUJA 4U1KB 5BJTB 5HYFA 1ZIWA 1WWWX 4TOYL 1TITA 3MV7A 3TM6A 1X5MA 1XR9B 2K0RA 4MDIA 1TETL 3C5SB 2OSWA 3FF8A 1KB5L 4PWFA 3PV6A 4L8BA 4N2MA 3ENEA 3ZHNA 1EFXA 2ZP9A 5CFAA 3TZVB 3OHXC 5E4OA 4WZ9A 3IFLL 3U2IA 3UEQA 1YEHH 2XRAL 2VOTA 1BF5A 4JB9H 1M1XA 1RUKH 3I6GB 4KTEL 4F37F 2EVJA 4KX8A 2CR6A 3LZFH 3LZRA 1NJ9A 4XNZB 3S96A 3UAJD 2B1HH 4PR5B 2CK0H 4JPVL 3VE0A 2VLKB 3L7EA 1YEDA 3DV4B 3PIQA 3OKYA 4OIAA 2Y3NA 5CINL 3QUMA 4PRPE 3EJYC 1S5IL 5FWRA 2A99A 3SGEH 2ATKA 1MFUA 1BBDL 3BKYH 2BS71 3NTCH 5M7QA 4EN3D 2Q7NA 5IROC 2VE6A 5LGHH 4P23C 3RWCA 4GG8A 2CM6A 2J5LB 5C0AD 1E5UI 4KKNA 2E9JA 3KD4A 2G0LA 4PN6A 1COBA 4F7EA 1YNLH 4I2XA 1TQCC 5B7FA 2Z64C 5DHXB 1ZTMA 4QGYA 5BZWA 2MCMA 3OZ9L 4J3TA 4EOWH 1FVEA 1I1FA 1R3LB 2NCEA 2P8PB 2OW6A 2VDPB 3JVFC 2X4TA 2ZX5A 4CMMB 4KTYA 3O6MH 2A9CA 4JFDB 3D39E 1KTJA 3L1GA 3BHBB 1XGYH 3PJLA 3FQRA 3CN1A 2WCPA 4FLOA 3IMBA 3DJSA 2XQBL 4HPYL 4WFHE 2UYLA 1N3NB 3VFUA 4LESA 3UO1L 1HCYA 3JV6A 2N56A 5MENB 1PLGL 3QFJA 4XB7A 4ZUVA 2C7FA 2VL4A 1NWPA 4H26B 3C6OB 2FT6A 2YQ3A 1T5XB 4IJ3C 3BPCA 4FQCH 3GSNL 2VN7A 5CM1A 5HHMD 2Q6WA 3BYTA 1IE5A 4Y4HA 4JFWA 4GXVL 3EDKA 3IN0A 3PFQA 4QPEA 3TESA 1HOCB 5H2BA 4EI5B 2NY1D 2R0LH 5EBWA 4LDEB 3NN8B 2EIEA 5DD0H 2R2HA 4QYOB 1KLUB 1DLFL 2EILB 2GTZA 5IHZB 1G9UA 1FHNA 1A3RH 1GS7A 4RIRA 2HLAA 4DZBB 5DVNA 3P0GB 4V1DB 3T1FB 4L3AA 4X9BA 1E5YA 2RACA 1OM9A 4I9WD 5FM8A 1VCBC 3LNHA 4LGSB 2DWEB 2H0JA 3LZPA 3MV9D 1A9NA 1GHFH 3TBTA 4QHUA 3FUKA 4FFYH 1KBBA 3KHQA 2FRGP 1ACXA 1FAKT 1Q9OB 2IJ0C 3OKMA 2WO2B 4FKKA 1BSIA 5I0ZA 2AAVA 1U8KB 3ESVF 4B9JA 4PI0A 4OGQC 4YDMA 2NLJA 1MCLA 4KY2A 3QZPA 3TV3L 1OQOA 1UUSA 4G9FE 2B08A 3GBNL 4OUOA 4RMRA 5EUOB 1FZMB 3HI5L 1JPEA 4MGXA 3X11A 2YLHA 5AL0A 2R1YB 1DSYA 2DTSA 4PBXA 5DRWB 1U95A 2BEXA 4Z7UA 1L9RA 4OH2A 3MV7B 1ODUA 1E2ZA 4MDIB 2NY6B 3FN0L 1NCNA 1K3IA 1YPZF 4LDLB 5EG6C 3SDDA 1I7TA 3GXUB 4OCSH 2LOEA 1X7QA 4L4TE 3PV6B 4L8BB 1EFXB 1J87A 2OV0A 4M56A 3QQXA 1FFRA 4E0RA 2HPTA 5AENA 2DWYA 1NSNH 2F8IA 4NJ9H 3V6ZA 1YCSA 4LFHG 4N8VG 4AZ8B 3VE0B 1H15A 5LBSL 1DP0A 5E2UL 4G7VH 3UO8B 1CF8L 2W80C 3L81A 3MLRH 4M3KB 3DO3A 3QUMB 3TIEA 1J5IA 1BZOA 1UWFA 5GGRY 5B3NA 2ATKB 3NFPB 3ARZA 1QZNA 3OC8A 4NGHH 4P99A 3MN8A 3TO2A 4FFYA 3ARBA 2VE6B 5FYJL 4F80A 3AGVA 3GEWB 3RWCB 4YSEA 1G7HA 3QWRA 4LCIL 5DC0A 5GGTH 3TF4A 5KW9H 1M0ZA 5BZWB 5DU7A 3ZTJG 4DP6X 3SODB 4KXBA 1T1WB 2H0EA 4ZUTB 3U7AA 3O0RL 4LCCC 1FVEB 5IM7B 3TT1H 1I1FB 3H56A 4ZQKB 3S34L 4GMTH 2X4TB 4AZUA 3WGVB 2FZ3A 3EJPA 2VH5L 4K94H 3HJ0A 4K2UH 4BFBD 2FX9L 1AGEA 2COQA 4TV3A 2FJFB 4R26H 5A3ID 5ADOH 3T3PB 3QCTL 4HWBA 3FQRB 2AP2A 1NGXA 1TQTA 1KTCA 1FFPA 1YEIH 3DGDA 1WDAA 5FX3A 1GPOH 4NXSA 2UYLB 2V5MA 4BYHA 3VFUB 5LFNA 3GSVA 3QPQC 2R0WL 2CRMA 3VWKB 1I8LC 1M2VB 2YAOA 4TRPL 5LVEA 4UMSA 1A3QA 2E7MA 3KBPA 4KNUA 1QSEA 3NESA 2BLFA 4S1SL 1AZNA 4ZUVB 1R0AH 3PMHG 4HZAA 4LLVB 5I1EL 4RMSA 1REIA 4H7VA 2WXMA 2YGPA 3GS7A 2P5EA 4FTVA 2VLJD 3BPCB 5JHAA 2MWCA 4ZYKA 4I85A 2O5YL 2MNUA 1UXSB 3O9WC 4OM1H 4GMSL 4Y4HB 2P1QB 1LDPH 1JPTL 3Q9QA 4RISH 5BRZA 4B96A 4KZ0A 5EBWB 5L2JB 2R2HB 2GTZB 4HFUL 5GGTA 3VWJB 5C09D 2HLAB 2H32A 1FNGB 4U1SA 4K7PY 1T20A 2E76C 3VFGH 2VDLL 2X0UA 4RDQF 3U30B 1BEYL 4F9PC 1OTUD 4HUWA 2NTSP 3H1ZA 4L0YA 1PS3A 3C08H 4I0PC 1PZDA 2E7DA 3TBTB 1FAIH 4QHUB 3DYPA 4HKBB 5GGVH 2X2HA 4IOSD 2VR5A 4C58B 5HVHB 5D7KE 2DQTL 3OKMB 1OANA 2J44A 4KQ3L 1S7RB 3C5XA 2BY3A 4NUGH 4EKXA 4D0DA 4PHXA 4D3CL 4WF7A 3VM7A 3X11B 1U91A 3NDZE 2B20A 4PAZA 1KLGB 4XGOA 4ZNEA 3FMGH 5GS2D 4H8WL 3H2WA 1L7TH 3EGXA 4QBZA 2AJ3A 2D3NA 1RY7B 3IRPX 4HXAH 1TLKA 3PXHA 5D4HA 2DJMA 1TJMA 2IV8A 3FT0A 4AYGA 4YEBB 1A1NA 4HAGA 4I18C 2F5AH 1OB1B 4WUUD 4BZ2H 2WLKA 3UTTE 1J1PL 4Z7UF 2BZ7A 2L04A 2QVIA 4H8UA 3VXRB 1MCEA 1VZGA 5FGBC 4O2EB 3NZSA 2BOBA 4WJKB 5MI0C 2E8YA 2DI8A 1T7VA 4ZX6A 4G43A 1O6TA 3MYZA 4OCYH 3BH4A 4YEEA 4JO2H 3Q1EA 4NAQA 3IXTB 5JYMA 4UOJA 3KE0A 5GRJL 3TIEB 1UOLA 2QQLL 4L18A 1E9QA 1NL0L 3I2CH 4IBVA 1K85A 4MVBC 3QA3A 1U8QB 1SEQL 3JVGA 4PJHA 4M7ZB 2J88H 2B3IA 2MOGA 4H8QA 1B2YA 1E6JH 2R29H 1HL8A 4NB7A 3OSKA 1LTXA 1ZHLB 1JUFA 3DRTB 1HWHB 4N0CD 3ISWA 5FYKL 3JTBA 1A7PH 3HNTH 1HXYB 1U6AH 2M1KA 1UC6A 3QR1A 4HCIA 1EH9A 1SOKA 1UWXH 1UWYA 3GXDA 1OTMA 4LSSH 5J1TC 3BLPX 1XH2A 5HYSG 2D3JA 1AR1D 4AEIL 4PRAA 1RUMH 4HMCA 4MAYA 1KFAL 1AGEB 2KKQA 4FMVA 5EEUA 3RNKA 4FGMA 3S4SA 2BXZA 4RDQG 2LTQB 1XGUB 2XWTA 4ALAC 3AB0B 4BZ2A 4OLUH 4EXPX 4O2CB 2A4CA 5E2VH 1FFPB 3B9KC 1DQLL 2HFFA 2G60H 1X5GA 2VISB 3C09B 1M42A 3TFBA 4RGNE 1F8TH 4DVBA 1TUPA 4BA8A 3W0WE 4PQ8A 5TF1H 2D31A 2VAAA 2DL2A 3B37A 1S4IA 1MRFH 2P5EB 1QLRB 1MFBL 4L37A 3QIBA 2EIZA 5D7LD 2L7JA 5LGJA 3ZGIA 4FHOA 3U4AA 2E6QA 1EEZA 1SJEA 5BRZB 4N2HA 3SYAA 4RGNC 3LH9A 2NXYD 1B0WA 3L2NA 3EXJA 4L4VA 5BVPH 1IAMA 1DVTA 3G6DL 1MFVA 1EVTC 5KJ4A 1P9MC 5I73B 1EZVY 4GUPA 4PP1D 2O6PA 1PX8A 3AG4B 4U1SB 1CDUA 1V55B 4RBPK 5DMGC 1T20B 3LEVH 4WSGA 3L4UA 3P9LA 3RVUD 4WUKH 5T1KA 1AKPA 4UM9D 1DQMH 1UURA 3H4HA 3RRQA 5AW4B 3WEXA 3X1FA 1Z5HA 2FWUA 2QHLA 1WWLA 3H54A 4WIQA 5I8KH 3LY6A 3MTRA 1BF2A 2FBJL 4PY7B 4OCNC 1VIWA 2QVMA 1OQXA 5F70A 5C3LD 1IT9H 2DJUA 3BT2L 2XLLA 3ELAT 5IJCC 3ETSA 4AUUA 2Y24A 1YJDC 1DQJA 1MRCH 4Z8FL 1CXEA 2AJ3B 3D05A 1AXTL 5K9QG 3G7TA 1CLZL 1KACB 4AXWA 3ZE2B 2BIMA 1Y6NR 1A1NB 4FQ2L 3HNVL 4PJIA 1TQBB 1LDSA 3SKUD 3M7FB 1VENA 3PNWB 3ZL4H 5BW7C 4X7FC 5AVSB 1XL4A 1Q90A 1KYUA 2BOBB 4F8PA 2ZUUA 4BH7A 5EZJA 1Y6KR 4Y7OC 5CMAA 5T5NF 2OQJA 2LR4A 3DMMD 4M1GL 4C54A 3DVNA 3CZEA 2ARWA 4U0RB 4P2QD 2FATL 4YUEL 1IFHL 2V7HB 3SCMC 1R4XA 2BNQD 2Y5TA 1WCQA 1IGYA 4L8SA 1D5ZA 4JG5A 3OB8A 5T1LB 1J7VR 5IGXH 4UTCA 1CXKA 3CFIC 4RMWA 1KJ3L 3OJDB 3AY4A 3R06B 4Q56A 5E8DH 5DGRA 1HINL 1IGJA 4XMKL 1QFPA 5A2KH 1J1OH 3BP6A 2CJSA 4RFOL 1HH6B 1B0GB 4PJHF 2WYIA 4HGWA 2E7CA 2YPLD 1LYQA 4JKPL 4DKEH 2AS5M 3DRQA 3VAEA 2X4QB 1UENA 2WKGA 3ZDZB 6PAZA 5E70A 3RNKB 3S4SB 5BO0D 1CYWA 1U3HA 1WS8A 1MVYA 3RKDC 3UTSD 4Z0BH 2XWTB 3GMLB 3L3IA 2A5UA 3H3BC 4OLZH 4OB5H 2H6PB 3D87B 3K2KA 3S5ZA 1MIML 4OFDA 5F6HI 4UMGA 3IGFA 1N4XH 5EU7E 3AW5A 4DVBB 5H4ZA 4KXFB 4JY4A 1PAZA 4AMKH 4EAEA 4GIAA 2D31B 5EIIA 2P8LB 3MJWA 1XCTA 1QKZL 4M6MH 5L4FA 4L37B 5TE7H 3QIBB 1MJ7H 3US1A 5DFVD 2BS8A 2OMYA 2A4EA 1ZV5A 3EHBC 4P5MA 2VDMH 3BVNA 4Y2OA 1QRND 4MMZA 1KB9K 2EIJB 4GSDL 4S1RL 1PIFA 3V5DB 3T4YA 3TSRE 5KYWA 1ETJA 2N59A 4GUPB 4MHHI 2GCYA 4NQDA 1PKOA 5D1XA 5GS0H 3EOTL 2B77A 4D94A 1SN2A 1RAMA 2VXVL 3QHFL 3P9LB 3H9SE 5FK9A 1DJHA 3IVKA 1A4JA 3CLWA 1J88A 5E9DE 3WEXB 4D9LH 3LXCA 4GKNA 4KKLC 3UTPD 3HI6H 1BM3L 4S2SB 1FL6B 4WFGE 5F0JB 3ZE1F 5L2KB 3MBED 4JM4H 4M03A 5EH1A 3CDGB 1R5VA 2QTEA 4FYTA 4X4XA 5IQ9B 5TQ0L 5SX5K 1WD9A 3QSKB 4NP4L 1MPAH 2VW6A 4QXTA 5JOPE 3TF7C 2KZKA 1QVOA 3SDAD 4Y16A 4DEPB 1QI5A 2IDCA 1CG9B 2YARA 3S36H 2IPKA 5B1JC 3TWCH 3FHEA 3QUXA 4HLZH 4PTUA 4I77H 2XY2A 3N9GL 3ARUA 3SBPA 1IL1B 2QPDB 3ABZA 3E1ZA 5FW6A 3CSPA 3NP3A 3MLXL 4FEIA 3GTNA 4H44C 5D93C 5J3HC 4DP7X 5T3XE 1MIEL 2KUTA 3I9AA 3NJVA 5AUMA 3FO9A 3F6JA 5SWSE 3MUZ1 4MNHA 4QGTA 4BH7B 2VMFA 3ZO0A 2ASTB 2A4ZA 5EZJB 1I75A 3L6FB 3WSQH 5CMAB 4L0PB 4PJIF 5AVRB 2OQJB 2P48B 3HPLB 2AJVH 1EGJL 1NBVL 3K4AA 4O02H 4HJ0C 5DFWH 4QXEA 2VDRH 5IT2H 2GJZA 4OI9A 4HGKC 5KVFL 5F6HJ 1ZVSA 2HCZX 1IGYB 4L8SB 1D5ZB 3KPSA 5CEZD 4F27A 2OL3A 3GSWB 4FQHA 5IYXC 1AZRA 2OTWA 4MSWA 3QXUA 3V0WH 3UBXI 4AGOA 1S7TB 4PI2A 3TH3T 3BP6B 2VDOL 4PJ8A 4AYEC 3TU6A 4HGWB 3WJJC 3X3GH 1PQZA 2IALA 1YEJH 2GJ6E 3A67H 3DRQB 1E3FA 3PL6A 4JZOA 2HJLA 3OGMB 1XAKA 4UOW0 2ID5A 3MODL 4PB0L 2EUXA 4CADB 1BVLA 4P57A 2FO8A 1E5CA 1BQHA 4POZD 3I6LE 2GIXA 5F7UA 1HDMA 2KDGA 3L3IB 1ZXQA 1NCBL 1RERA 2ED6A 2WYHA 1G9NL 5I19H 3IETA 4XMWA 2DQCL 3BISA 1CXLA 4QR7A 3JWDC 4L3CB 1FBIH 1N67A 1C5BL 3NA9L 3CPLA 4UILH 5CHNB 5JIHA 1XCTB 2PWEA 1F4XL 5CJXC 5C07B 3TGXA 1XEDA 4O02A 3UYPB 2VXUL 4QTIH 2OMYB 3MPCA 2JI1A 2IQAA 5SX4I 3WKPA 4NZUH 3RZCD 3BVNB 4Y2OB 4MMZB 5ESAB 4AYSA 4J6RH 4NSKA 2OXGB 3BQUD 3P11L 2DRUA 2XWRA 5IMOA 5DLLA 3NABL 4DFHA 1RK1A 3DLQR 2WLJA 3LD8C 4HIQA 4EF3A 1D5RA 4QHLB 2GCYB 3CSGA 4NQDB 4UCFA 5D2NB 1G6VK 1CDGA 3DSFH 5FKPA 1V3MA 1SM3H 3P2BA 3IAGC 1JGLL 4G80B 3CJJA 4NBZB 2DB8A 2JELL 2VABA 2HKHH 4OD2B 4OKDA 1T03L 3IVKB 5IOPA 2DQDH 2YJLA 4U1GC 1D0BA 2BZDA 4GKNB 1NLDL 4EPSA 1PEZA 4YEFA 3GS4A 5DJ2A 2QPUA 1Z32X 1EMTL 3WNIA 2GAZA 2WVSA 2GSMB 3WTYA 5EDSA 1SPDA 4X4XB 5CWSB 3MLTB 1EXUB 4QXTB 3D08A 3JV5A 4MQXC 1S9YA 3RYMA 1RJZA 3LKOA 2CH8A 4Y16B 1DBML 4WEMB 1DYZA 2IPKB 3AAZA 5I5JA 4PS4L 3DUHA 4PTUB 4FEMA 1R3IL 3D2UD 4G7SB 4HUUB 1NFDF 4ZBJA 2W91A 4PTTA 1NDGB 3HG0A 5JR1L 4F7TA 4HBCH 1V7MH 4FQXC 3KWVA 5F8RC 1BQKA 3NAAL 5G4NA 4FHJA 3ABLB 1S2EA 5AUMB 4M1DL 3HRPA 2F54D 3S3BB 3FO9B 1TTFA 2YUZA 3RPKA 1E40A 2XZAH 4N20A 4J4PD 1T7XA 4LCYB 4MNHB 3WY3A 2G2NA 3VX0A 4DGIL 4U0QB 1IGFH 5D96C 4ZXBC 2GJZB 1XGRA 5C71A 5LXGL 2J25A 2NY3C 4XMLL 5IF0A 3MRPA 3STZA 1ZVSB 3V0HA 1TJGH 2C26A 3I9IA 3WN4A 3I75A 3HMXL 3IXAA 3GHEH 4NRZB 4JHVA 2WUCH 3X13B 4CC4C 4DERA 4YSQA 2XHNA 1CU4L 5HHNA 1RIHH 2OR9H 5GQRK 2VDQL 4MSWB 4X5WB 1D9KB 1MELA 4QRRE 2O5NA 2Z7WA 1KCRH 4XBGA 4GUOA 2JXMA 3Q8FA 3UABA 1F97A 1LEGA 5ISZE 4PJ8B 1PQZB 2XWXA 4LU5H 4MJIA 4K5MA 1LNUA 1MN4A 2XTJD 4JZJA 3R4DA 2HJLB 4BQ6A 3SYQA 1MHEA 1I9IH 2EYTA 2YA0A 2ZP0T 5KSAC 3HAEG 3LJ3A 1TVHA 3VYPA 4ZOAA 1BVLB 2HX8A 1GYWA 3U83A 3PYCA 4ARNA 3BP5B 2GQHA 3BP4A 1HDMB 3D4CA 3OX8A 4WK2B 4QRSA 1M3IA 3OAWA 4PPTA 1KNOB 3AJ7A 2Z8RA 3VI3E 1NCJA 4ZOBA 1MQ8A 2GB2A 1DHKA 3F7QA 3IETB 4RLDA 4GSQA 5C0BE 2AGJH 1A6UH 3EYFA 4NRYB 3WN6A 4MA8H 4AM0Q 4JN1H 1FG9C 2IPTH 1AS7A 4O02B 1I82A 3MRLA 1G7JA 1KBVA 3CU1A 2IQAB 3G5YA 4BQ8A 1AXSB 5KVEL 3HE6D 4KK9D 3BZEA 4NSKB 3UBHA 3JV4B 1IMHC 2Z31D 4D7BA 2I9LA 1KB5H 1JZHA 3LSOA 4EE2A 1FC2D 5C1MB 4MLIA 2V2XB 3COOA 4FQ1L 1A3ZA 1TG8A 4KROD 2PXYA 1W2KT 1FVCA 1MZZA 5I1KL 4UQCA 2EH8L 3KPMA 4KTEH 1VACA 3MRIB 2YAEA 4PJFB 5TD4A 2GK2A 4LLWA 2VYRE 3QEGH 3ARED 5E2TL 3KPLA 3ZKMD 4A6YA 2JCWA 2DTML 4KTDL 5F1OB 4IOFD 5DJ2B 4XI5D 1JI2A 2OZNA 4XHJC 1E4KA 2GAZB 2XN9D 1KBWA 3EBAA 1BBDH 4W9FC 1X6LA 2FLBT 2NXZC 3GMNB 2OR8A 4M6OL 4R6AA 4IGBA 4J8RA 1Z7XW 1II4E 4OIIL 4NKGA 5EU6D 1BGXL 1S9YB 5TDOA 3WKNA 4ONHA 3ULVD 4PLOB 5FECA 2X4OA 5AWNH 1OKEA 4XZUA 2H5UA 3QG6A 2DMGA 4IMKA 3BUIA 3ZIMA 3IJYB 5LNDA 3OZ9H 5C0RH 4GRLB 3O2VL 3UBXB 3A4FA 4PTTB 1OGAA 5F1SA 3RAJL 5IB3A 4QLRA 4NT6A 1N70A 2B2XH 3IDGB 3UAFA 1GKOA 4JO8A 3OG6B 5C86A 1IBGL 1RJLB 2R9HC 5KBDA 4NAJA 1PDKB 2VO8A 2Z91B 2FLRT 2F8XC 1KB5A 2O5XL 4IDJL 1IAIM 3T2QA 4Y1AE 4JEGB 1BZ7B 3EFDL 1U2YA 2KLSA 2YGQA 4HPYH 4XODA 3U9WA 3P3RA 5D1QD 1KFGA 15C8L 3RVWC 2VNCA 1GYAA 1XGRB 4ZMPA 5IF0B 1JNNL 3STZB 3SD5A 1J12A 3EF7A 3I75B 3M7OA 1PLGH 5I1CH 3ZKXB 3LNFA 3VXUD 4Q6IC 2QADC 2Q76B 1O9VA 2EDFA 2DJ4A 3NIDF 2NDFA 4OJDH 1DE4A 3FCUB 1RU9L 1Q94A 4A7VA 5ACMA 1U93B 4QWWD 4ZNCD 4NM8L 4KKCD 1VPOH 4RFEA 1BVNT 1U36A 1BFTA 2NUTB 4JZJB 1X5YA 1WGOA 4AGQA 1J0YA 2GUYA 1DLFH 2APBA 2EYTB 4LIQL 4XWGH 3I85A 3RQ3A 5CUSL 3R7QA 5I75B 1TVHB 4JRYD 2N1TE 3KPRA 5EOCL 1HHJB 3BP4B 3OX8B 4ZFZB 4QRSB 4PJDA 2HTLD 5HGGS 5KS9B 5CKGA 4M93B 2IAND 1IGIH 3CSTA 4PJXA 5CXPA 3VXSA 3EDFA 3PWPA 3TO4A 2FJSA 5CLWA 5FA3B 4XNBA 1E90A 2QFRA 5BOPA 1KIRB 2HT2C 4NN7B 3EYFB 3L5IA 4XMPH 4ZI8A 3RFZB 1WAEA 4LEBA 2CKBB 1IB5A 3SDXA 5D9SB 4ZMYA 1H6TA 4PJ6A 4U1MB 3IPBA 4CBZA 1HIML 1IAII 1W0WA 4OZIF 1CFBA 2NSQA 2AVGA 4KAQL 5FR3A 3FN0H 4HAFA 4YSUA 2Y72A 2I9LB 3GSNA 3RX8A 3IDNB 2E7HA 4P59L 3CFNA 3AT0A 1XB3A 3UTZA 5T33L 4Y5YA 3KYOA 2HG0A 2B16A 4J23A 1VACB 1YUHA 2HVKA 2CIIB 3EJYD 5KSUA 1MCSA 1EJ8A 4R7VA 1SJHB 2TRYA 5JTWA 1E4XI 5FKAA 5LBSH 4HXBH 1CI5A 1G94A 2VN5A 3T6XA 1MLBA 3VD3A 1OALA 1YDPA 1N59A 2BC4B 4WHTA 1FRGH 1MVUB 2GSIA 4XMTA 5GRWA 1KN2H 5KVDE 3N1QC 1P53A 4Y4KD 1IAIH 4PU2A 5FYJH 4IGBB 4J8RB 4C2AB 1JZFA 4XN4A 5TDOB 1KYOJ 3OKEA 5IVXE 1P4IL 2XWJA 3KPPA 1PMYA 3G6JA 4C56E 3Q01A 4OCMC 35C8H 3NZ8A 4XMUA 5A2LH 4LXRA 3C6PB 1WVZA 3D18A 3QQ3B 2YRZA 5D7JA 3O0RH 3MU3A 3N1FC 2DLEA 3EFFB 1OGAB 5IB3B 4NT6B 1BLNA 3I6KA 4TULL 1BOYA 3RBGA 5C3TA 4AYDC 4ZFFB 2H26B 1JZ6A 1MAJA 3UMTA 4CKQA 2DI9A 2UX7A 1KB5B 2BXYA 3FBQA 4ODBD 5GZNA 3QCTH 2ZCLL 5BRPA 4QYAA 3KH3A 4U1IA 2MQGA 4DP5X 1HKFA 1X5KA 4BSUA 1TJIL 5EF2A 2WXHA 2RFXA 3D39D 3FT2A 1AGCA 1O6SA 5L0QC 2UV3A 4FKEA 4TRPH 4G8AC 3PY9A 1JHLH 4PBVC 2CE6A 1TMCB 5LBSA 1WEJL 2ED8A 1F4WL 4OIFA 3V5KA 2HT4D 3QJFA 3BH8A 2VO5A 2YEVB 3HG3A 4XVOA 4PMEA 3C5ZC 4BSWB 3ME0A 1H5BC 2JMRA 5JXEC 3GSXB 2BP3A 3MLWH 2Z63A 2ZOUA 2FBOJ 4QOKB 5TK2A 3MJ9H 4GMSH 3M46A 2NUPB 1DE4B 2HRHA 2YAPA 1Q94B 1CCZA 3AM8C 4YXLL 1J5OL 1PGVA 3SQBB 3D85A 2OSYA 3MR9B 4YDKH 3UN9A 4G8GA 1G1YA 2Z8VC 5EORL 4KZCA 5L88L 2C9RA 4BJLA 4HFUH 3MFGB 3UTOA 4Q9RL 2A83B 3LPWA 2XG5A 4X99A 1L9NA 5J11C 2ADGB 3QUYA 3VW3L 4J3OH 1BEYH 1U8JA 3CHXA 4PJDB 2WAHA 1GJWA 4LL4A 4PJXB 1C16A 1SLXA 5EZIH 4M3JA 3VXSB 4U3SA 2DQTH 2FJGA 5E2WL 2AJXL 1EUUA 1OCWH 4EQ3A 5DRXA 5LNEA 1BG1A 32C2A 2OK0H 2E8ZA 1ZSHA 2FNBA 3FCTA 5SWZA 4JAMA 4PRHD 4EZGA 1WRFA 4D3CH 4RAUA 4PRBA 2AJYL 1OP5H 4NKOA 2WUBH 4H8WH 2BM3A 2BNRE 4ZMTA 4YX2L 3PQYD 1IKNC 4WI2A 2OYKA 3SDXF 4MNGE 3B2VL 3F7RA 2VSDA 4J2QA 2Y36L 1RZKL 4PLKC 5E6ZA 4UU9A 4MZIA 5D5ME 3UTZB 2BINA 1IEAB 1DQKA 3IN2A 4WFEE 4Y5YB 3EBHA 1YUHB 5DUPL 1V54B 4G42A 2D03L 2OMWA 3K7UA 4AV4A 3NGBB 2KYIA 5ACZB 5KYNA 3GMPA 2GSIB 4FABL 5GRJH 2AK4A 4EZMA 5JQIB 1NL0H 1I7UA 2XC8A 1ML0A 1Z9NA 3PWNB 1T1YA 4NPYA 1H3PH 3CPUA 3NOIA 3B7TA 4LSAA 2EE6A 3EUDA 1T22A 4P8SA 3OKEB 5FYLH 4QNPE 4FQIL 2GBUA 2XWJB 3N3EA 4IBTA 5L9DL 5ESVA 3G6JB 2LU7A 5E6UB 1NPJA 3EYUL 5FYKH 2O93L 3NZ8B 2OCFD 1VEPA 1UH2A 3KJ4B 2F58L 1CDHA 5D7JB 5DZAA 2V8MA 4YZFE 3VFVB 4JM2A 3WO4B 3FRUB 4HQQH 4F5CA 3I6KB 1JPGA 3FHQA 4HHWA 4AEIH 3WTXA 3PDGA 1KFAH 1Q1PA 3G6JF 1G7MA 2X9XA 2I85A 3JYCA 5DCCA 3O8XD 2WBJA 3QPQD 3QUZB 1DJGA 4U1IB 2WLLB 3WHE0 3CN4A 1RUQL 4Y4FD 1DQLH 2RD0A 5C0EB 1Q72H 5HYJD 1U9KA 2WJ7A 4NN6B 2ZONA 1ZTXE 4HHGA 5C6PB 2C9VA 1XT5A 2K7PA 5ABAA 2BRRH 4PB9H 5FDWA 4N2EA 4FXKC 3NIGB 3O9WD 4AIOA 3WY2A 3VG9C 2WCSA 3CFJA 4XAKE 1GZPB 1J8RA 4CJ0A 1TU2B 4OJFL 4X7DC 1A3LL 3ULSA 1X6NA 2WK2A 3PWUB 3SBWC 3VXMB 1UT2A 4YDLB 1MFDL 2HH0L 2HWZH 2ENPA 3D85B 1F90L 1P1ZB 1R5WA 2YHGA 3CMOH 1DQQA 3MUUA 2BX5A 4GQZA 3I84A 3SYOA 3G6DH 2WD0A 4I0PD 5FV1L 3NZUA 1F3RB 4PV1C 2VZTA 2ZUQB 3WUWA 2XG5B 4X99B 2OBGA 5EB9A 4TVUA 5ITBL 2A38A 1U8JB 4HKZA 4XP6L 3WLWD 5KSBA 2EC9T 4IRSC 2V9SA 1C16B 2V2WB 3WFBL 2ATPA 4W4OA 3E8VA 4XNMA 4IM6A 3U2SB 2QPFA 5DRXB 4AYBA 1HZKA 3ZZ1A 4PJ5E 4CC1A 2FBJH 32C2B 5JUEL 4WW2C 5SWZB 4C4KT 3BT2H 5IR1B 5H37G 4Y2NA 1XIWD 5DO2D 3QDGE 5AG8A 4TLTA 1ZOXA 4XH2A 3P4OB 2WQAA 3MRDA 4NKOB 5DK2B 4EDWL 4KK8D 3V5HB 5BV7H 1BBJA 3JV0A 1VHPA 4JKNA 1ZT4A 3MX0A 3QQ9D 5E2JA 5ACLA 5KVGH 1AXTH 2IQ9H 4WNSA 5HHQA 4N2KA 1MFCL 3HE7A 1PY0A 2P42B 5FIEA 4WI4A 5ID0A 1CLZH 3JTSA 2DBLL 2R0KH 1RMFL 3B2MA 2AV1B 3HNVH 4FQ2H 3ILQC 3BPLC 5DA0B 5ALCL 5JW4M 3ZDXF 2XKNA 1EUTA 1JNLL 5HHPA 1JYWA 3IPFA 1S9WA 3QEQE 4IOIA 2BIPA 2VM3A 4W9LC 4G42B 1KYDA 1G7IA 2OMWB 4NYLB 5E8NA 1NIFA 1I31A 2GK0A 2IH1A 1T1XA 4R5VA 3WKQA 3UL8A 3MLZH 3TA3B 3BGAA 1S7SA 3BYYA 1NKRA 4M1GH 3GMPB 4Z7NE 1DQVA 1IM9D 2AK4B 5C0JA 1BVNP 1Z0NA 4WTZG 2GIYA 4FI6A 4FYRA 1FPTL 1MCIA 5E00A 1R6VA 4JCLA 1T1YB 3GSOA 1N0XL 3W81A 4F7PB 3C8KA 3IS1X 3NK4A 1KJ3H 1XAUA 3N06B 5HGAB 1DFXA 3ETBJ 5HJDA 5CEZL 4JK0D 3Q6FA 4XC3L 3D6GA 3C6LD 1FV1B 5ESVB 1HINH 4XNDA 4XMKH 2DQ6A 2FIRT 3ZXAC 1PD6A 4RFOH 1KPRB 2CCWA 2B14A 2H7WA 4M9PA 4TPRL 5E08L 2HFEB 4BM7A 4CNCA 5CD3A 4JKPH 1TTCA 2ZXQA 4OGXL 5F9JB 1WZKA 3A4AA 3KNBA 4LVHB 2IEPA 2V3FA 3QQNA 4F8QA 1JK8B 1UKQA 3HG1A 1U8HB 4HUMB 2EDYA 3D4GA 4LPXA 4N2BA 3GQFA 4R4FL 1FYTD 4P9HC 3FQ1A 2WBJB 4IBWA 2V17L 1JF1A 2Z93A 4JM2F 1KOAA 4DH2A 4OLVH 2DYSB 3BIKA 5C9KA 3GI8L 1BD2A 4W9IC 2Q7YB 4BFNA 5AFAA 5K59F 4G59C 3U6RB 1HJCA 3FQWA 5CEYA 4KU1A 3TYFA 1WC7B 3DO4A 3HUJA 5C0DA 1DSWA 3IFPA 2EP6A 5FDWB 1A1OB 4TTDD 3QZBA 1WA1X 4RDBA 1EQWA 4KHXH 4FOMA 1T80A 1QD0A 1HSAA 3KXFA 1JWSA 4M7LH 4DEWA 1N8ZB 2MPVA 2ZX9A 4G6FB 1XF2A 1F2QA 4YVUA 3W3JA 3ULSB 4L3EE 4P46B 1KJVB 2AXGA 5DMGD 3OGKB 1XZ0B 2MJWA 4S1RH 4EEEA 1R5WB 2YAHA 1URIA 1DQQB 4N2LA 4AENA 3OB0H 4NO3B 2VXTL 1E6OH 5DMKB 4PBDA 1UWXK 4XCFL 4JVWA 3BCFA 4HIEA 4CC0A 3FO2A 3EOTH 3WUWB 2NMSA 2NR6A 2HTKC 2VXVH 2ORBL 3QHFH 5KSBB 4HKZB 3AUVA 1Z9OA 3Q6GL 5MEOA 3NZHH 3I3EA 3DBSA 4AQ8A 5GRVL 3WL9B 5L8JB 4QF1A 4XNMB 4OJYA 4L1DA 4AQAA 5HHXL 3RB7A 1KYFA 4BKTC 5EZLB 1F58L 3ARWA 5KSBF 2PPEA 1MCWM 4MD5B 4N25A 3VCLB 3THML 3MBXH 2J6EH 2VL5A 2K4AA 4NP4H 3DO7A 3MRDB 2FQEA 1WTGT 3MFFB 3PAVA 4CN4A 5CKAA 3CFEA 3W9EB 4AGMA 4KH9A 3FTGB 1WP6A 1F0LA 3JTSB 3WNMA 4E41E 2Q86A 2QPEB 1NC4B 4KWUA 3B1UA 1OF0A 2Y07H 2XKNB 1QFHA 4O51A 5HHPB 4ZMQA 3T65B 1IGCL 3WTVA 5JOEA 1FNFA 1MIEH 3DK0A 3TFKC 2ETWA 2IBGA 2EDLA 4IOIB 1QQDB 3OXSA 3ULUD 1K6QH 3UYRH 3SCMD 5E8NB 1A6WL 5HDWA 3AG3B 2FHFA 2AEOA 5JHBA 1PZCA 2Z0BA 4XCCL 2BP0B 1X7SA 5DJZA 3M1BB 3ARFB 1NBVH 2QQKL 3E9TA 3QULA 4Z1PA 3RJQB 4LHUG 5C0JB 4GI9A 3MRRA 1XF3A 5KVFH 1OW0A 5EBLA 5A2IH 2XUWA 1XCWA 3QAZC 1P5UB 3F8UB 1J9RA 2JVUA 4JFFA 3FU7A 4FC3E 3W5NA 2E7LA 1NZRA 1OO2A 2F8OA 3U36B 3Q6FB 4NNPH 5J1AB 3N91A 2UZXB 3L5WA 2IDUA 4XN9A 2Q7AA 3RTQA 1NCIA 2H41A 2VDOH 2H3XC 3PHQA 2FQFA 5DMIL 1RK0A 2FQGA 4W6WB 5IHWA 5AOIA 5CD3B 3DVGA 4NI3A 3RKDD 4ZMXA 2BSED 4R97C 3BRGC 1GYVA 1A7OH 3KNBB 4ELME 5I74C 3OKDB 5BV7B 5G55A 3F7YA 4G8FA 3ZUCA 4PLNC 1L9PA 3RFEA 2F7PA 5DJAA 1CDJA 2F1BA 3FH5A 1H6UA 3MODH 3UJJH 3EYVA 5BUPA 4KPHH 2DQIH 2WZ0A 3HOGA 3I6SA 4N22A 1UA3A 3BFWA 2HA1A 3BIKB 1THAA 2ZSVB 1BD2B 1CD1B 4Z3GA 1DVFB 3ZRCC 3FQWB 2DQCH 4U05A 5CEYB 1CZ8L 4KKBC 1MEXL 3BMWA 3DIFA 4IRZL 5C0DB 4N9GA 1OEZW 4Y2DA 3IFPB 3U0TA 3NA9H 5C6WH 1KELL 3B7YA 1F4XH 1HSAB 3GRBA 3KXFB 3Q5OA 1JWSB 2GYSA 5CJOL 1L6ZA 2VXUH 1MHPL 4G3YL 4LGPB 4JFTA 2JJUA 5IQMA 3HUJF 43C9A 4OZHE 4E9WA 3D09A 3FN3A 4KV5F 1SYVA 4FFTA 1OM3L 1LP9A 4TNWF 4F7MA 5HDHA 4OD1L 2P7TB 2XXGA 1E30A 4OFKA 1LWRA 5AOLA 4X6CA 1ETA1 1NMBL 3MSPA 4PJ9B 4KKLD 4XP5L 4UQ9A 3RX7A 3GZQA 4Y19A 2C1PA 2FWLB 3IMRA 2BJML 2C4FU 1S9XB 4OGAC 4BFJA 4UV7L 2H1PL 5MEOB 1T03H 5DD3L 2ZNXA 4MS6A 3CFBA 2F53E 1NLDH 4K71C 4WI8A 4AQAB 3H9SD 4Q7DA 4KDTC 3EO1A 2IV9A 1QEWA 1NC2B 3A6BH 3TN0C 2ZKYA 3HS0A 3QDJA 2VL5B 3DO7B 4GQPH 4LFHD 3CFQA 1XGTA 3CFDA 2PW1B 2L7QA 5J3HD 4R0LC 5D71L 3ULVL 2WW8A 5HGBB 2E9IA 2Q86B 4ABVA 1AQ8A 5JR1H 3VDAA 3LRSB 5LQBH 4FXLA 3H42L 3MGAA 3NAAH 3KLSA 4KFMA 1UYWH 1DO5A 3FFCA 4M1DH 4EIGB 4HJ0D 4OV6F 1KULA 3TJHD 4WV1C 2X1PA 2YBRA 3Q2WA 4ZX5A 1JHTA 4H5SB 3VXQB 4ES9A 5F6IB 5HPOA 2C9XA 5T5FL 5T3XD 1GR7A 1INDH 5DJZB 4BUQA 3LVEA 4BH8A 5SWSD 1QTPA 3DSNA 4LOFA 4LSDA 3MRRB 1AJ7H 1XF3B 2AJUL 2YAFA 2V7NB 1KGWA 2YD4A 4XMLH 4EUPG 1WLHA 4ZO6A 4ADGA 3G3BA 3HI1A 1V05A 4TUUA 2NNCA 3UAJA 3X1BA 4YSSA 4HS3A 1QW9A 2NPLX 2K9FB 4X6DA 2VDQH 3HHRB 3X3FH 1RXLA 1TEGA 5L7XH 1K9TA 1YHPA 2NRDA 2ZOLA 2X9WA 1JDAA 1BIIA 5TDPB 3L5WB 3WYRA 2G9HA 4NKIL 4O9HL 3PHQB 1OTTC 4OIBA 1RK0B 1N5AA 1U3NA 5FHAL 2JJSA 4EN3A 3HR5B 3C12A 3FO1A 3RP1A 4MAUL 2NY0D 5HDOA 2JQDA 2O6QA 5C0AA 4A2MA 3FNKA 3VD0A 3FQNA 1RPKA 4EDXB 5IWLA 4QAWA 1YEWA 3MGTA 5JNYB 1NFIA 3M45A 4NO0B 2LHAA 4WTXA 4ZJ9A 3MRHA 3JUZA 3CC5B 5J12C 1J18A 1D6EB 4JO3H 2YK1L 5I9QC 4FS7A 3GIVA 1IKOP 4N9GB 4MA3A 3FHAA 4P2OB 5CCKH 4Q4IA 1WF5A 3QIWA 5ETUA 2PN5A 2FNWA 4MX7B 3BZ4A 4NENA 2FD6L 3K91A 3WLBB 1GXEA 2EEAA 4W81A 3M17A 1YMMD 3CFMA 2R15A 1KTDA 2J21A 2UZYA 3HG2A 3HMXA 4UIKL 1S6NA 3MLSH 43C9B 1SYVB 5KVEH 4FXGA 1OP4A 5L8KB 1LP9B 1SEBA 3KHOA 3OXRA 1YNKH 4DIXA 1TDQA 4F7MB 2ZAHA 2QKSA 1UJ3A 3GO1L 3WENA 3OAZH 4L1LA 1KCUH 2RAMA 5IFAL 1AQKH 1JXGA 4FQ1H 5I1IL 3IJEA 4YXKH 3QDME 1XO8A 3FJTA 2YKLL 5I1KH 4EIZC 1MCJA 3CLFL 2WQ8A 4MJ6A 1GVIA 1XGZA 1RKRA 4IIQC 1ZDQA 1XWDC 1VA9A 3CFBB 2V9QA 5DS8A 5I6LA 3SOTA 3OJVC 4I1PA 2G4EA 1J48A 4BBWA 1R5IA 1E43A 3N85L 4X6CF 3W2DH 2F0CA 1XD0A 4LKXB 1N8OE 1SDAB 4YBQD 2OJEA 2UWEE 3BRFA 2APWA 3T2NL 4N2NA 3MJGX 3BVWA 1INQA 2WXKA 4PJAA 4W93A 5GS1C 4U06A 1ET5A 3A24A 1KV3A 3MV9A 4OIIH 2BNUA 1BGXH 2XETA 1OV8A 1FI8C 3CFDB 5ENWA 3WEBA 5F8QC 1E27A 1MCDA 4FQXD 4YZWA 4S1DC 1FL5B 5DHEA 3BQVA 3CDZA 2OMNA 4WKZB 3TYGL 4WWKC 3O2VH 5SV3A 4ODUA 3X17A 5DZ9A 4MCNA 2F7QA 3RAJH 4UT7H 5B4PA 2V9TA 3MGOA 1RZIA 1HFUA 1I1YB 2X0WA 4MXVE 2IBZY 3HZYB 5DHVB 3W11D 2D7TL 1IQDA 3Q5TA 5DVMA 3VTMA 1J8SA 3F85A 3ESNA 1GC1H 3NBNA 4ZXBD 3AQXA 2YSTA 2BCKA 5CJQL 2O5XH 4IDJH 4QY8A 3L1EA 5IMLB 4HJSA 2VZ3A 4UUJB 3EFDH 5A6MA 1UTDA 1UUNA 2QDWA 4OV5B 3VXRE 3DSNB 4G6ML 3O6KH 5B1CA 1JNNH 4YFEA 3LHPL 4JHBA 4KNSA 4XZ4A 3EH1A 3WNOA 5CR1A 1C1EL 2EIKB 4YO0B 2CHDA 1R19A 4HS3B 4K7FA 2LVEA 1QX1A 4X6DB 1YNTA 1KLFA 1SRDA 4V11A 4R2GB 3DA0A 2ZOLB 3LEYL 5J89A 3GLAA 1BIIB 3CHPA 1XCQA 3K72A 3M6DA 2H0PA 3P40A 5ITFB 2G9HB 2BRQA 3DJZA 2J72A 5KSAD 3SGKA 1RU9H 4LSPL 4QRRD 2CG9X 4NM8H 4BWWA 1EV2E 4Z7VE 4EN3B 3D1MC 2IH3A 4P2RE 3FO1B 5KWYC 4FJZA 1HKLL 4N90D 3SZ6A 5CUSH 1E8YA 1CDIA 5FCUL 3U9PL 4BCYA 5KUKA 3RU8H 3LKPA 1B4LA 1NFIB 1RZGA 3AQDA 1QSFD 2PPCA 3REZA 3SB4A 4HD5A 4CP6A 1W0VB 1I9RL 4XNYL 4Z7IA 3GIVB 3KL0A 3LPOA 3RWEA 4JY6A 1DQDL 4L05A 1XBRA 2R4SL 2EE3A 5DI8B 5AVWB 2J1ZA 4HW6A 4Z9KB 1OTNA 5ETUB 1XWVA 4MA1C 4JGUA 2X6MA 4W4NA 3L95B 3BZ4B 3B56A 3U2JA 4NENB 1A7BA 3C60D 4PJEA 3AROA 5I76B 1AD9A 5KBLA 2GT9B 4X7SH 1HIMH 1P4UA 1XBDA 2NY4C 3K4DA 4J0MA 3BPOC 2YZ1A 5IBUB 3TC9A 3ZZSA 4KAQH 1SEBB 3RDJA 1LO5B 1ETZA 2VDQB 1VGEL 3LN5B 2VLKE 1XH3A 4WO0A 3NCFB 1UJ3B 3GBEA 4E9QA 4BFEA 4P91A 4RGNB 2X53A 1NCDL 4AH2A 2EE2A 2VLJA 4P59H 5GGRB 1E2WA 3HZ3A 3O4LE 1MCBA 1HH9A 2YWYA 3MRBB 3IJEB 3W0WB 1P84J 3BKCL 3N1GC 3RUGF 4DAGH 5T33H 4OTXH 3TZVC 4WVRA 2BWQA 3WAKA 3HKFA 1GYUA 4MJ6B 1A1MB 1K5NA 2ILLA 4I4WA 4URKA 4KRPD 1ZLWH 1HQ4A 4I3GA 4XHJD 1Z6JT 3WE6A 5DS8B 2AV7A 4PG2C 4ISVA 1OP9A 4XNZC 3TCLA 4N8CL 3KCPA 2ICEA 1T5WA 2FAUA 5I0XA 2JK5B 4UTBL 5C09A 2ZUSA 1JE6A 4YLCA 4TYUA 3S7GA 1INQB 1YECH 2Q3AA 1G7QB 4LLQB 1AKJB 1MUJA 3UTQA 5MHSE 1OD9A 1BG9A 3MV9B 1OLZA 2BNUB 3CZUB 2N01B 4I0CC 4IOSA 5ENWB 1RUAH 1E27B 2J5LC 2EKJA 4NWUL 2R9HD 3CDZB 1K4DB 4PJAF 3SOBL 1NEZB 1Q0EA 1KY6A 4O4YH 4ZAKD 3O3AB 3PCYA 4NQED 4QXGH 1RZIB 2YFOA 4TL4A 1A8JH 1XHHA 1ICTA 1IQDB 5DUML 4G7QB 2BVQA 2W60A 3GMMB 4GQRA 2H0FA 5MENE 3WN5A 1PX3A 3GLDA 4JPKL 2BCKB 2XBTA 3UXFA 4AGPA 4QY8B 2ZCLH 3K46A 3KLAA 3GINA 4Q14A 3ZMNA 2Z0UA 5GHWL 1LO3L 1W8AA 4YSPA 2H9GA 4TQ8A 4GKOA 3K6DA 4FCAA 5A2FA 1TJIH 1KOOA 3MRMA 4WUUA 3SYPA 2P5WB 5LO7A 4P5KB 4FERA 4YHOL 1NQBA 3ROOB 3IGKA 4LL9A 3ESOA 3RVXD 1TZOA 2DDQL 4HALA 5BOZG 4QRTA 4N0YH 1WEJH 4WWPA 3IJHA 4M29A 1H8SA 1XF5A 3DX1A 3JTTB 1YNTB 1KLFB 3KZ8A 5DJ0A 4AEHL 1UATA 4V1DE 1RHFA 3ZDYF 1GKEA 3WPIA 3K72B 1L9TA 4AC4A 3QRGL 4Z94G 1G7PA 3FQYA 3OKKB 3FXIC 1DBJL 1KCBA 1ASPA 1JOIA 3P54A 2NY2B 4YXLH 4QUOA 4ENEC 2QSTA 4ZS6C 5CCJA 2IH3B 4BUGA 5IKCA 3TEZA 5L88H 4EI5C 4ZMLA 1N64H 2J57A 4R8WL 1CE6B 4HUCA 5C08D 4MQSB 3LRLA 4JFHE 4W70A 3QFGA 3VW3H 2F1EA 2J1WA 2ZG3A 3RFJA 5EUOE 1RJYA 3HTLX 1R3JA 3TBYA 1GA2A 1DN0B 3ZO9A 3NP4A 1DBAH 2I24N 2DKMA 3MKKA 4JY6B 2H8PA 2AJXH 4LSRH 5DTFA 5E2WH 3MV7E 5E94A 1GTNA 2A6KB 2G5BB 3P73B 1HNYA 3FT1A 1K5WA 3WXVL 3LNDA 1A4KB 3E8UL 4H1LG 1RV6X 2IMNA 1UWGL 4PJEB 2X6BA 4B9YA 4DETA 5A43C 2QT6A 3T04D 4JPWL 4POYA 3SPGA 5E51A 2MCPH 2VMJA 2HVJB 5IJBA 3HLKA 3SO5A 1E28A 3JSSA 4HBQA 4YX2H 4JDVA 2VITA 3QUKB 4OT1L 1ETZB 2IGFL 3BAWA 5E5RB 5C0ND 3MV8D 4AK2A 3FC8A 2NY6C 3B2VH 4PJ7A 4YK4B 4AH2B 2VLJB 3S3PA 1RZKH 1EHLL 5DD1H 4BSVA 2I60L 5D7LA 1WE5A 2E4FA 4OCXL 2X1QA 1T89C 1JZIA 1OAQH 1K5NB 5DUPH 3OWEA 4YHPA 3VFPA 1HQ4B 3WE1A 3RGZA 3WE6B 2TRHA 4DGVL 2WWKO 4ISVB 3TCLB 5FO9A 2ICEB 4NNYA 3P2TA 1DBBL 2PKDA 1RCYA 3NJNA 4NO5B 2QZQA 5F96H 2IH9A 2XXFA 4LCUA 1JYNA 4QRBA 1NBCA 2N4IA 5FF6A 1MUJB 3UTQB 2W94A 4WI7A 1MCFA 4NQCD 1BPVA 4UM9A 4LLYA 1JVKA 2OKMA 2QFPA 4U7LA 3SE3A 4FNTA 3QNXA 4FQIH 1VFUA 1QG3A 1U8NA 3QGVA 5DJ6A 1IIIA 4K73A 2Y23A 3PG2A 3K0YA 4K5PA 5F44A 2F58H 1YN6B 1I53A 3CN0A 4IU3B 1BX2A 3SQOL 2K1MA 4N8UA 1ADQL 1CDYA 1NKOA 5TK4A 5K9KB 1JYXA 2A9BA 1MOEA 5D7SL 3RWDB 3WN5B 3QFJE 5E0QA 2O5ZL 2CBMA 2VLRD 4OJCA 5C2UB 2X4UB 3KLAB 5T1MA 4NLHA 4JCMA 1MCOL 3ESPA 3WKYA 3K74B 4WY7H 1BXXA 1RUQH 1JV2A 2H9GB 1JRHI 3BMVA 3NMEA 4CMHB 2Q8BL 5IMKB 3KM1A 5DK3A 1Q0XH 4WUUB 2Z65A 2F9BT 5F7HA 5KSVA 4U6VL 1FCGA 3MRKA 5JXED 5CLZA 4AMWA 4NN5B 2CGRH 2BW4A 3VWKC 5I8EB 3IJHB 3A22A 2GTWA 4FG4A 1QO3B 5DZJA 4YPJA 2JI3A 3EYOA 1C7SA 2A3TA 3WD5L 3PAZA 3IJ7A 3WTUA 3DMMA 4OJFH 3RIAF 1A3LH 4NQVA 1G7PB 2K3HA 3MYJA 4P2QA 5B1KA 4ZW6A 4JW3A 2HH0H 2BNQA 1DBKL 2FECI 4ZO9A 4MMXA 4Y4HC 5T1JA 4HOZA 5IKCB 2NX5D 4GAGL 2CNZA 4XX1E 4M7KL 4W9EC 7PAZA 3VWJC 4JHWL 5IVZB 1ES0A 3CZJA 1CTMA 4LLMA 1LK2A 1USQA 5GGVY 3VGFA 1AOZA 4U2YA 4HHAA 4LLAA 3U30C 4V2BA 3WFBH 3TBYB 5CFHA 4B3VA 4BDVB 2YPLA 2A6IA 3PAYA 4RMTA 1HT6A 1GW0A 2IGLA 4D9RD 1HEZB 2BVUA 1AR1B 2H8PB 5DTFB 1Q38A 1U92A 5IVOA 5HVHC 4QRUA 1Q1JH 5JUEH 4KK5D 4PGBA 4HH9A 4G5ZL 4UIMA 3UTSA 1G1CA 1YJDL 3U4BL 3VYNA 5AVQB 5FUOH 2O6CA 1M1SA 4EDWH 4XNQA 4E9VA 4YHLL 1UZ6F 4QHPA 2FCBA 1SXZA 4PLKD 1CLOH 1E28B 5C2BH 4JDVB 2VITB 3O4OB 2ELLA 1MFCH 1SXAA 1CMOA 3TVMA 1N2RA 4PJ7B 4ZW7A 1RMFH 3QC6X 2PO6D 1MNNA 2XIDA 4K15A 5T3ZH 2DWSA 4MCYA 5K5YA 3VD1A 2G5UA 1HZHH 1Q0YH 2Z1PA 2FYYA 3CDYA 1UACH 3L7FA 1H6FA 1QRNA 1WIPA 3CSYA 2IDTA 4PJBA 3HN3A 4ZMOA 2ZWLT 5E9AA 3DHMA 4AG4L 2HLFC 1UD6A 2NXYB 1TTBA 3UZQB 5I2IB 1OSPH 3ZIYA 5FO9B 3ULUL 1VFOA 4BIKA 4UB0H 2ITFA 2JKLA 3L4VA 5JO5A 3BJLA 3V4UL 3S3DB 3HC2A 4LCUB 3MCLL 4KRLB 5FF6B 3MLPA 5EO0A 4XSQA 3VH8A 4N1CA 1N0XH 1UOWA 2KHAA 5DQDL 4LLYB 4UM9B 2Y6SC 3FQ2A 4MQTB 4M7ZC 3QNXB 4JBSA 1U8NB 4WK4B