4LI1A

Crystal structures of lgr4 and its complex with r-spondin1
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
424
structure length
424
Chain Sequence
PCPAPCACDLDGGADCSGKGLVTVPDGLSVFTHSLDLSMNNITKLPEGAFKGFPYLEELRLAGNDLSIIHPMALSGLKELKVLTLQNNQLKTVPSESLKGLVSLQSLRLDANHIVTVPEDSFEGLVQLRHLWLDDNSLTEVPIRPLSNLPSLQALTLALNKISHIPDYAFSNLSSLVVLHLHNNKIRTLGPHCFHGLDNLEALDLNYNNLIDFPDSIRSLPNLKELGFHSNSITIIPDGAFVKNPLLRTIHLYDNPLSFVGNSAFQNLSDLHFLIIRGASNVQWFPNLTGTNNLESLTLTGTKIRSIPIKFCQEQKMLRTLDLSYNEISALVGFEGCSSLEEVYLQNNQIQEVQNETFQGLAALRMLDLSRNRIHTIHKEAFVTLKALTNLDLSFNDLTAFPTAGLHGLNQLKLTGNPNFKETL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hormone receptor
molecule keywords Leucine-rich repeat-containing G-protein coupled receptor 4
publication title Crystal structures of lgr4 and its complex with R-spondin1.
pubmed doi rcsb
source organism Xenopus (silurana) tropicalis
total genus 120
structure length 424
sequence length 424
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13855 LRR_8 Leucine rich repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 4li1A01
3G04C 4CNCA 3E6JA 4FMZA 4R6JA 5CMPA 3OGLB 4FHOA 1K5DC 3OGMB 1XECA 3C6OB 4NKGA 4U08A 1H6UA 3G3BA 4KXFB 3UL8A 1GWBA 2ELLA 3E4GA 3ZYIA 2JE0A 1P8VA 4CC4C 4IM6A 4XSQA 1M0ZA 5AWBA 2OMZA 1Z7XW 4KNGA 5IJCA 3OJAB 2V9SA 4KT1A 4P91A 3M19A 2JQDA 4R6GA 4K17A 5HDHA 1OOKG 2WQWA 4L3FA 2OMVA 3WN4A 3REZA 4P8SA 2Z65A 2WQUA 2P1OB 1OTNA 2OMYA 4Q3GA 3GOZA 2Z7XA 4FD0A 3WPHA 4PSJA 5D3IA 5GS0A 4BSUA 1FQVA 4R0AA 4Z8GA 4GLPA 4R5CA 2XWTC 2WQVA 4LSAA 4AW4A 1WWLA 4R5DA 4Z94G 3WPCA 2OMUA 1O6TA 3RFSA 4PEQB 4C2BB 1XCDA 4PKIG 2OMTA 2O6QA 4CNMA 2Z66A 3G39A 2O6RA 2R9UA 4QBZA 2BNHA 4R6FA 2OMWA 3RGZA 4FCGA 3ULAA 2WFHA 1P8TA 2Z7XB 5AZ5A 4I6JB 4J0MA 3WPIA 4YEBB 4CILA 4QC0A 4LXSA 4RCAB 2XOTA 5IJDA 1QYYA 2O6SA 4LSXC 2FT3A 3RFJA 3W3NA 4ARRA 3W3KA 5AWAA 2CA6A 2V70A 3UN9A 2A0ZA 4HQ1A 1W8AA 4RCWA 4ARNA 4V2DA 4R6AA 1K5GC 3RW7A 2JE1A 2P1QB 2RR6A 1JL5A 4ECOA 1SQ0B 1YRGA 4NKHA 4M7EC 4CC4A 4R08A 3WPEA 4U06A 5B4PA 3ZYOA 1KOHA 5GMGA 4LSXA 5GS2B 3RW6A 4LSCA 4Q62A 4U09A 3P72A 3C6NB 4LI2A 1IO0A 3RJ0A 2IFGA 2ASSB 3VQ1A 3ULUA 4Z79A 3KJ4A 3G3AA 3VQ2A 3UL7A 1OZNA 4XGOA 4M7EA 1G9UA 3W3MA 4XOSA 4Q3IA 3WPDA 4RWTC 3RIZA 1KOOA 3W3GA 4QXEA 3E2JA 2OMXA 3TSRE 4UFRA 1LTXA 3RGXA 4G8AA 2Z64A 4WP6A 3WPGA 4PQ8A 5HZLB 2BEXA 4R58A 1O6SA 1A9NA 5GMFA 3O53A 4R09A 4BSSA 5B0NA 1DS9A 3O6NA 2ASTB 4BSRA 1OTMA 1DFJI 4LI1A 3W3LA 1H6TA 3SB4A 5IYXC 2UZXA 2WQXA 1O6VA 2UZYA 2Y5QA 5A5CA 3DZEA 4FDWA 1FT8A 2P1PB 4Z61C 1U0ND 3PMHG 3BZ5A 1D0BA 4R07A 4ECNA 4OQTA 1A4YA 2Q4GW 1FO1A 2P1MB 1XEUA 3UL9A 5IJBA 4PERA 2ID5A 3JB9j 1M9SA 5AWDA 1XKUA 4U7LA 4LXRA 4GT6A 1M10B 2Z81A 4V2EA 3C6PB 4Z64C 3M18A 4MN8B 3CVRA 3W3JA 5AWCA 3CIYA 5B0TA 3ZYJA 1XWDC 3FXIA 4V2CA 2Z63A 4BV4R 3WPBA 3ULVA 1M9LA 4B8CD 3E3ZA 4J4LA 5CMNA 4EZGA 4AY9X 4Y61B 3OJAA 3CIGA 4FS7A 5FTTB 3RFEA 4H09A 3WPFA 1OTOA 2Z82A 3OGKB 3ZYNA 2Z62A 5LFNA 1DCEA 3A79B 4MQWX 1PGVA 5GMHA 1ZIWA 4C2AB 4CP6A 4TZHA 1OGQA 2RA8A 4L3AA 2V9TB 3G06A 2P1NB 4WYKA 1FS2A 1P9AG 5GQRK
chains in the Genus database with same CATH superfamily
3G04C 4CNCA 3E6JA 4FMZA 4R6JA 5CMPA 3OGLB 4FHOA 1K5DC 3OGMB 1XECA 3C6OB 4NKGA 4U08A 1H6UA 3G3BA 4KXFB 3UL8A 1GWBA 2ELLA 3E4GA 3ZYIA 2JE0A 1P8VA 4CC4C 4IM6A 4XSQA 1M0ZA 5AWBA 2OMZA 1Z7XW 4KNGA 5IJCA 3OJAB 2V9SA 4KT1A 4P91A 3M19A 2JQDA 4R6GA 4K17A 5HDHA 1OOKG 2WQWA 4L3FA 2OMVA 3WN4A 3REZA 4P8SA 2Z65A 2WQUA 2P1OB 1OTNA 2OMYA 4Q3GA 3GOZA 2Z7XA 4FD0A 3WPHA 4PSJA 5D3IA 5GS0A 4BSUA 1FQVA 4NZTM 4R0AA 4Z8GA 4GLPA 4R5CA 2XWTC 2WQVA 4LSAA 4AW4A 1WWLA 4R5DA 4Z94G 3WPCA 2OMUA 1O6TA 3RFSA 4PEQB 4C2BB 1XCDA 4PKIG 2OMTA 2O6QA 4CNMA 2Z66A 3G39A 2O6RA 2R9UA 4QBZA 2BNHA 4R6FA 2OMWA 3RGZA 4FCGA 3ULAA 2WFHA 1P8TA 2Z7XB 5AZ5A 4I6JB 4J0MA 3WPIA 4YEBB 4CILA 4QC0A 4LXSA 4RCAB 2XOTA 5IJDA 1QYYA 2O6SA 4LSXC 2FT3A 3RFJA 3W3NA 4ARRA 3W3KA 5AWAA 2CA6A 2V70A 3UN9A 2A0ZA 4HQ1A 1W8AA 4RCWA 4ARNA 4V2DA 4R6AA 1K5GC 3RW7A 2JE1A 2P1QB 2RR6A 1JL5A 4ECOA 1SQ0B 1YRGA 4NKHA 4M7EC 4CC4A 4R08A 3WPEA 4U06A 5B4PA 3ZYOA 1KOHA 5GMGA 4LSXA 5GS2B 3RW6A 4LSCA 4Q62A 4U09A 3P72A 3C6NB 4LI2A 1IO0A 3RJ0A 2IFGA 2ASSB 3VQ1A 3ULUA 4Z79A 3KJ4A 3G3AA 3VQ2A 3UL7A 1OZNA 4XGOA 4M7EA 1G9UA 3W3MA 4XOSA 4Q3IA 3WPDA 4RWTC 3RIZA 1KOOA 3W3GA 4QXEA 3E2JA 2OMXA 3TSRE 4UFRA 1LTXA 3RGXA 4G8AA 2Z64A 4WP6A 3WPGA 4PQ8A 5HZLB 2BEXA 4R58A 1O6SA 1A9NA 5GMFA 3O53A 4R09A 4BSSA 5B0NA 1DS9A 3O6NA 2ASTB 4BSRA 1OTMA 1DFJI 4LI1A 3W3LA 1H6TA 3SB4A 5IYXC 2UZXA 2WQXA 1O6VA 2UZYA 2Y5QA 5A5CA 3DZEA 4FDWA 1FT8A 2P1PB 4Z61C 1U0ND 3PMHG 3BZ5A 1D0BA 4R07A 4ECNA 4OQTA 1A4YA 2Q4GW 1FO1A 2P1MB 1XEUA 3UL9A 5IJBA 4PERA 2ID5A 3JB9j 1M9SA 5AWDA 1XKUA 4U7LA 4LXRA 4GT6A 1M10B 2Z81A 4V2EA 3C6PB 4Z64C 3M18A 4MN8B 3CVRA 3W3JA 5AWCA 3CIYA 5B0TA 3ZYJA 1XWDC 3FXIA 4V2CA 2Z63A 4BV4R 3WPBA 3ULVA 1M9LA 4B8CD 3E3ZA 4J4LA 5CMNA 4EZGA 4AY9X 4Y61B 3OJAA 3CIGA 4FS7A 5FTTB 3RFEA 4H09A 3WPFA 1OTOA 2Z82A 3OGKB 3ZYNA 4NZRM 2Z62A 5LFNA 1DCEA 3A79B 4MQWX 1PGVA 5GMHA 1ZIWA 4C2AB 4CP6A 4TZHA 1OGQA 2RA8A 4L3AA 2V9TB 3G06A 2P1NB 4WYKA 1FS2A 1P9AG 5GQRK
chains in the Genus database with same CATH topology
3G04C 4CNCA 3E6JA 4FMZA 4R6JA 5CMPA 3OGLB 4FHOA 1K5DC 3OGMB 1XECA 3C6OB 4NKGA 4U08A 1H6UA 3G3BA 4KXFB 3UL8A 1GWBA 2ELLA 3E4GA 3ZYIA 2JE0A 1P8VA 4CC4C 4IM6A 4XSQA 1M0ZA 5AWBA 2OMZA 1Z7XW 4KNGA 5IJCA 3OJAB 2V9SA 4KT1A 4P91A 3M19A 2JQDA 4R6GA 4K17A 5HDHA 1OOKG 2WQWA 4L3FA 2OMVA 3WN4A 3REZA 4P8SA 2Z65A 2WQUA 2P1OB 1OTNA 2OMYA 4Q3GA 3GOZA 2Z7XA 4FD0A 3WPHA 4PSJA 5D3IA 5GS0A 4BSUA 1FQVA 4R0AA 4Z8GA 4GLPA 4R5CA 2XWTC 2WQVA 4LSAA 4AW4A 1WWLA 4R5DA 4Z94G 3WPCA 2OMUA 1O6TA 3RFSA 4PEQB 4C2BB 1XCDA 4PKIG 2OMTA 2O6QA 4CNMA 2Z66A 3G39A 2O6RA 2R9UA 4QBZA 2BNHA 4R6FA 2OMWA 3RGZA 4FCGA 3ULAA 2WFHA 1P8TA 2Z7XB 5AZ5A 4I6JB 4J0MA 3WPIA 4YEBB 4CILA 4QC0A 4LXSA 4RCAB 2XOTA 5IJDA 1QYYA 2O6SA 4LSXC 2FT3A 3RFJA 3W3NA 4ARRA 3W3KA 5AWAA 2CA6A 2V70A 3UN9A 2A0ZA 4HQ1A 1W8AA 4RCWA 4ARNA 4V2DA 4R6AA 1K5GC 3RW7A 2JE1A 2P1QB 2RR6A 1JL5A 4ECOA 1SQ0B 1YRGA 4NKHA 4M7EC 4CC4A 4R08A 3WPEA 4U06A 5B4PA 3ZYOA 1KOHA 5GMGA 4LSXA 5GS2B 3RW6A 4LSCA 4Q62A 4U09A 3P72A 3C6NB 4LI2A 1IO0A 3RJ0A 2IFGA 2ASSB 3VQ1A 3ULUA 4Z79A 3KJ4A 3G3AA 3VQ2A 3UL7A 1OZNA 4XGOA 4M7EA 1G9UA 3W3MA 4XOSA 4Q3IA 3WPDA 4RWTC 3RIZA 1KOOA 3W3GA 4QXEA 3E2JA 2OMXA 3TSRE 4UFRA 1LTXA 3RGXA 4G8AA 2Z64A 4WP6A 3WPGA 4PQ8A 5HZLB 2BEXA 4R58A 1O6SA 1A9NA 5GMFA 3O53A 4R09A 4BSSA 5B0NA 1DS9A 3O6NA 2ASTB 4BSRA 1OTMA 1DFJI 4LI1A 3W3LA 1H6TA 3SB4A 5IYXC 2UZXA 2WQXA 1O6VA 2UZYA 2Y5QA 5A5CA 3DZEA 4FDWA 1FT8A 2P1PB 4Z61C 1U0ND 3PMHG 3BZ5A 1D0BA 4R07A 4ECNA 4OQTA 1A4YA 2Q4GW 1FO1A 2P1MB 1XEUA 3UL9A 5IJBA 4PERA 2ID5A 3JB9j 1M9SA 5AWDA 1XKUA 4U7LA 4LXRA 4GT6A 1M10B 2Z81A 4V2EA 3C6PB 4Z64C 3M18A 4MN8B 3CVRA 3W3JA 5AWCA 3CIYA 5B0TA 3ZYJA 1XWDC 3FXIA 4V2CA 2Z63A 4BV4R 3WPBA 3ULVA 1M9LA 4B8CD 3E3ZA 4J4LA 5CMNA 4EZGA 4AY9X 4Y61B 3OJAA 3CIGA 4FS7A 5FTTB 3RFEA 4H09A 3WPFA 1OTOA 2Z82A 3OGKB 3ZYNA 2Z62A 5LFNA 1DCEA 3A79B 4MQWX 1PGVA 5GMHA 1ZIWA 4C2AB 4CP6A 4TZHA 1OGQA 2RA8A 4L3AA 2V9TB 3G06A 2P1NB 4WYKA 1FS2A 1P9AG 5GQRK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3G04 C;  4CNC A;  3E6J A;  4FMZ A;  4R6J A;  5CMP A;  3OGL B;  4FHO A;  1K5D C;  3OGM B;  1XEC A;  3C6O B;  4NKG A;  4U08 A;  1H6U A;  3G3B A;  4KXF B;  3UL8 A;  1GWB A;  2ELL A;  3E4G A;  3ZYI A;  2JE0 A;  1P8V A;  4CC4 C;  4IM6 A;  4XSQ A;  1M0Z A;  5AWB A;  2OMZ A;  1Z7X W;  4KNG A;  5IJC A;  3OJA B;  2V9S A;  4KT1 A;  4P91 A;  3M19 A;  2JQD A;  4R6G A;  4K17 A;  5HDH A;  1OOK G;  2WQW A;  4L3F A;  2OMV A;  3WN4 A;  3REZ A;  4P8S A;  2Z65 A;  2WQU A;  2P1O B;  1OTN A;  2OMY A;  4Q3G A;  3GOZ A;  2Z7X A;  4FD0 A;  3WPH A;  4PSJ A;  5D3I A;  5GS0 A;  4BSU A;  1FQV A;  4R0A A;  4Z8G A;  4GLP A;  4R5C A;  2XWT C;  2WQV A;  4LSA A;  4AW4 A;  1WWL A;  4R5D A;  4Z94 G;  3WPC A;  2OMU A;  1O6T A;  3RFS A;  4PEQ B;  4C2B B;  1XCD A;  4PKI G;  2OMT A;  2O6Q A;  4CNM A;  2Z66 A;  3G39 A;  2O6R A;  2R9U A;  4QBZ A;  2BNH A;  4R6F A;  2OMW A;  3RGZ A;  4FCG A;  3ULA A;  2WFH A;  1P8T A;  2Z7X B;  5AZ5 A;  4I6J B;  4J0M A;  3WPI A;  4YEB B;  4CIL A;  4QC0 A;  4LXS A;  4RCA B;  2XOT A;  5IJD A;  1QYY A;  2O6S A;  4LSX C;  2FT3 A;  3RFJ A;  3W3N A;  4ARR A;  3W3K A;  5AWA A;  2CA6 A;  2V70 A;  3UN9 A;  2A0Z A;  4HQ1 A;  1W8A A;  4RCW A;  4ARN A;  4V2D A;  4R6A A;  1K5G C;  3RW7 A;  2JE1 A;  2P1Q B;  2RR6 A;  1JL5 A;  4ECO A;  1SQ0 B;  1YRG A;  4NKH A;  4M7E C;  4CC4 A;  4R08 A;  3WPE A;  4U06 A;  5B4P A;  3ZYO A;  1KOH A;  5GMG A;  4LSX A;  5GS2 B;  3RW6 A;  4LSC A;  4Q62 A;  4U09 A;  3P72 A;  3C6N B;  4LI2 A;  1IO0 A;  3RJ0 A;  2IFG A;  2ASS B;  3VQ1 A;  3ULU A;  4Z79 A;  3KJ4 A;  3G3A A;  3VQ2 A;  3UL7 A;  1OZN A;  4XGO A;  4M7E A;  1G9U A;  3W3M A;  4XOS A;  4Q3I A;  3WPD A;  4RWT C;  3RIZ A;  1KOO A;  3W3G A;  4QXE A;  3E2J A;  2OMX A;  3TSR E;  4UFR A;  1LTX A;  3RGX A;  4G8A A;  2Z64 A;  4WP6 A;  3WPG A;  4PQ8 A;  5HZL B;  2BEX A;  4R58 A;  1O6S A;  1A9N A;  5GMF A;  3O53 A;  4R09 A;  4BSS A;  5B0N A;  1DS9 A;  3O6N A;  2AST B;  4BSR A;  1OTM A;  1DFJ I;  4LI1 A;  3W3L A;  1H6T A;  3SB4 A;  5IYX C;  2UZX A;  2WQX A;  1O6V A;  2UZY A;  2Y5Q A;  5A5C A;  3DZE A;  4FDW A;  1FT8 A;  2P1P B;  4Z61 C;  1U0N D;  3PMH G;  3BZ5 A;  1D0B A;  4R07 A;  4ECN A;  4OQT A;  1A4Y A;  2Q4G W;  1FO1 A;  2P1M B;  1XEU A;  3UL9 A;  5IJB A;  4PER A;  2ID5 A;  3JB9 j;  1M9S A;  5AWD A;  1XKU A;  4U7L A;  4LXR A;  4GT6 A;  1M10 B;  2Z81 A;  4V2E A;  3C6P B;  4Z64 C;  3M18 A;  4MN8 B;  3CVR A;  3W3J A;  5AWC A;  3CIY A;  5B0T A;  3ZYJ A;  1XWD C;  3FXI A;  4V2C A;  2Z63 A;  4BV4 R;  3WPB A;  3ULV A;  1M9L A;  4B8C D;  3E3Z A;  4J4L A;  5CMN A;  4EZG A;  4AY9 X;  4Y61 B;  3OJA A;  3CIG A;  4FS7 A;  5FTT B;  3RFE A;  4H09 A;  3WPF A;  1OTO A;  2Z82 A;  3OGK B;  3ZYN A;  2Z62 A;  5LFN A;  1DCE A;  3A79 B;  4MQW X;  1PGV A;  5GMH A;  1ZIW A;  4C2A B;  4CP6 A;  4TZH A;  1OGQ A;  2RA8 A;  4L3A A;  2V9T B;  3G06 A;  2P1N B;  4WYK A;  1FS2 A;  1P9A G;  5GQR K; 
#chains in the Genus database with same CATH topology
 3G04 C;  4CNC A;  3E6J A;  4FMZ A;  4R6J A;  5CMP A;  3OGL B;  4FHO A;  1K5D C;  3OGM B;  1XEC A;  3C6O B;  4NKG A;  4U08 A;  1H6U A;  3G3B A;  4KXF B;  3UL8 A;  1GWB A;  2ELL A;  3E4G A;  3ZYI A;  2JE0 A;  1P8V A;  4CC4 C;  4IM6 A;  4XSQ A;  1M0Z A;  5AWB A;  2OMZ A;  1Z7X W;  4KNG A;  5IJC A;  3OJA B;  2V9S A;  4KT1 A;  4P91 A;  3M19 A;  2JQD A;  4R6G A;  4K17 A;  5HDH A;  1OOK G;  2WQW A;  4L3F A;  2OMV A;  3WN4 A;  3REZ A;  4P8S A;  2Z65 A;  2WQU A;  2P1O B;  1OTN A;  2OMY A;  4Q3G A;  3GOZ A;  2Z7X A;  4FD0 A;  3WPH A;  4PSJ A;  5D3I A;  5GS0 A;  4BSU A;  1FQV A;  4NZT M;  4R0A A;  4Z8G A;  4GLP A;  4R5C A;  2XWT C;  2WQV A;  4LSA A;  4AW4 A;  1WWL A;  4R5D A;  4Z94 G;  3WPC A;  2OMU A;  1O6T A;  3RFS A;  4PEQ B;  4C2B B;  1XCD A;  4PKI G;  2OMT A;  2O6Q A;  4CNM A;  2Z66 A;  3G39 A;  2O6R A;  2R9U A;  4QBZ A;  2BNH A;  4R6F A;  2OMW A;  3RGZ A;  4FCG A;  3ULA A;  2WFH A;  1P8T A;  2Z7X B;  5AZ5 A;  4I6J B;  4J0M A;  3WPI A;  4YEB B;  4CIL A;  4QC0 A;  4LXS A;  4RCA B;  2XOT A;  5IJD A;  1QYY A;  2O6S A;  4LSX C;  2FT3 A;  3RFJ A;  3W3N A;  4ARR A;  3W3K A;  5AWA A;  2CA6 A;  2V70 A;  3UN9 A;  2A0Z A;  4HQ1 A;  1W8A A;  4RCW A;  4ARN A;  4V2D A;  4R6A A;  1K5G C;  3RW7 A;  2JE1 A;  2P1Q B;  2RR6 A;  1JL5 A;  4ECO A;  1SQ0 B;  1YRG A;  4NKH A;  4M7E C;  4CC4 A;  4R08 A;  3WPE A;  4U06 A;  5B4P A;  3ZYO A;  1KOH A;  5GMG A;  4LSX A;  5GS2 B;  3RW6 A;  4LSC A;  4Q62 A;  4U09 A;  3P72 A;  3C6N B;  4LI2 A;  1IO0 A;  3RJ0 A;  2IFG A;  2ASS B;  3VQ1 A;  3ULU A;  4Z79 A;  3KJ4 A;  3G3A A;  3VQ2 A;  3UL7 A;  1OZN A;  4XGO A;  4M7E A;  1G9U A;  3W3M A;  4XOS A;  4Q3I A;  3WPD A;  4RWT C;  3RIZ A;  1KOO A;  3W3G A;  4QXE A;  3E2J A;  2OMX A;  3TSR E;  4UFR A;  1LTX A;  3RGX A;  4G8A A;  2Z64 A;  4WP6 A;  3WPG A;  4PQ8 A;  5HZL B;  2BEX A;  4R58 A;  1O6S A;  1A9N A;  5GMF A;  3O53 A;  4R09 A;  4BSS A;  5B0N A;  1DS9 A;  3O6N A;  2AST B;  4BSR A;  1OTM A;  1DFJ I;  4LI1 A;  3W3L A;  1H6T A;  3SB4 A;  5IYX C;  2UZX A;  2WQX A;  1O6V A;  2UZY A;  2Y5Q A;  5A5C A;  3DZE A;  4FDW A;  1FT8 A;  2P1P B;  4Z61 C;  1U0N D;  3PMH G;  3BZ5 A;  1D0B A;  4R07 A;  4ECN A;  4OQT A;  1A4Y A;  2Q4G W;  1FO1 A;  2P1M B;  1XEU A;  3UL9 A;  5IJB A;  4PER A;  2ID5 A;  3JB9 j;  1M9S A;  5AWD A;  1XKU A;  4U7L A;  4LXR A;  4GT6 A;  1M10 B;  2Z81 A;  4V2E A;  3C6P B;  4Z64 C;  3M18 A;  4MN8 B;  3CVR A;  3W3J A;  5AWC A;  3CIY A;  5B0T A;  3ZYJ A;  1XWD C;  3FXI A;  4V2C A;  2Z63 A;  4BV4 R;  3WPB A;  3ULV A;  1M9L A;  4B8C D;  3E3Z A;  4J4L A;  5CMN A;  4EZG A;  4AY9 X;  4Y61 B;  3OJA A;  3CIG A;  4FS7 A;  5FTT B;  3RFE A;  4H09 A;  3WPF A;  1OTO A;  2Z82 A;  3OGK B;  3ZYN A;  4NZR M;  2Z62 A;  5LFN A;  1DCE A;  3A79 B;  4MQW X;  1PGV A;  5GMH A;  1ZIW A;  4C2A B;  4CP6 A;  4TZH A;  1OGQ A;  2RA8 A;  4L3A A;  2V9T B;  3G06 A;  2P1N B;  4WYK A;  1FS2 A;  1P9A G;  5GQR K; 
#chains in the Genus database with same CATH homology
 3G04 C;  4CNC A;  3E6J A;  4FMZ A;  4R6J A;  5CMP A;  3OGL B;  4FHO A;  1K5D C;  3OGM B;  1XEC A;  3C6O B;  4NKG A;  4U08 A;  1H6U A;  3G3B A;  4KXF B;  3UL8 A;  1GWB A;  2ELL A;  3E4G A;  3ZYI A;  2JE0 A;  1P8V A;  4CC4 C;  4IM6 A;  4XSQ A;  1M0Z A;  5AWB A;  2OMZ A;  1Z7X W;  4KNG A;  5IJC A;  3OJA B;  2V9S A;  4KT1 A;  4P91 A;  3M19 A;  2JQD A;  4R6G A;  4K17 A;  5HDH A;  1OOK G;  2WQW A;  4L3F A;  2OMV A;  3WN4 A;  3REZ A;  4P8S A;  2Z65 A;  2WQU A;  2P1O B;  1OTN A;  2OMY A;  4Q3G A;  3GOZ A;  2Z7X A;  4FD0 A;  3WPH A;  4PSJ A;  5D3I A;  5GS0 A;  4BSU A;  1FQV A;  4R0A A;  4Z8G A;  4GLP A;  4R5C A;  2XWT C;  2WQV A;  4LSA A;  4AW4 A;  1WWL A;  4R5D A;  4Z94 G;  3WPC A;  2OMU A;  1O6T A;  3RFS A;  4PEQ B;  4C2B B;  1XCD A;  4PKI G;  2OMT A;  2O6Q A;  4CNM A;  2Z66 A;  3G39 A;  2O6R A;  2R9U A;  4QBZ A;  2BNH A;  4R6F A;  2OMW A;  3RGZ A;  4FCG A;  3ULA A;  2WFH A;  1P8T A;  2Z7X B;  5AZ5 A;  4I6J B;  4J0M A;  3WPI A;  4YEB B;  4CIL A;  4QC0 A;  4LXS A;  4RCA B;  2XOT A;  5IJD A;  1QYY A;  2O6S A;  4LSX C;  2FT3 A;  3RFJ A;  3W3N A;  4ARR A;  3W3K A;  5AWA A;  2CA6 A;  2V70 A;  3UN9 A;  2A0Z A;  4HQ1 A;  1W8A A;  4RCW A;  4ARN A;  4V2D A;  4R6A A;  1K5G C;  3RW7 A;  2JE1 A;  2P1Q B;  2RR6 A;  1JL5 A;  4ECO A;  1SQ0 B;  1YRG A;  4NKH A;  4M7E C;  4CC4 A;  4R08 A;  3WPE A;  4U06 A;  5B4P A;  3ZYO A;  1KOH A;  5GMG A;  4LSX A;  5GS2 B;  3RW6 A;  4LSC A;  4Q62 A;  4U09 A;  3P72 A;  3C6N B;  4LI2 A;  1IO0 A;  3RJ0 A;  2IFG A;  2ASS B;  3VQ1 A;  3ULU A;  4Z79 A;  3KJ4 A;  3G3A A;  3VQ2 A;  3UL7 A;  1OZN A;  4XGO A;  4M7E A;  1G9U A;  3W3M A;  4XOS A;  4Q3I A;  3WPD A;  4RWT C;  3RIZ A;  1KOO A;  3W3G A;  4QXE A;  3E2J A;  2OMX A;  3TSR E;  4UFR A;  1LTX A;  3RGX A;  4G8A A;  2Z64 A;  4WP6 A;  3WPG A;  4PQ8 A;  5HZL B;  2BEX A;  4R58 A;  1O6S A;  1A9N A;  5GMF A;  3O53 A;  4R09 A;  4BSS A;  5B0N A;  1DS9 A;  3O6N A;  2AST B;  4BSR A;  1OTM A;  1DFJ I;  4LI1 A;  3W3L A;  1H6T A;  3SB4 A;  5IYX C;  2UZX A;  2WQX A;  1O6V A;  2UZY A;  2Y5Q A;  5A5C A;  3DZE A;  4FDW A;  1FT8 A;  2P1P B;  4Z61 C;  1U0N D;  3PMH G;  3BZ5 A;  1D0B A;  4R07 A;  4ECN A;  4OQT A;  1A4Y A;  2Q4G W;  1FO1 A;  2P1M B;  1XEU A;  3UL9 A;  5IJB A;  4PER A;  2ID5 A;  3JB9 j;  1M9S A;  5AWD A;  1XKU A;  4U7L A;  4LXR A;  4GT6 A;  1M10 B;  2Z81 A;  4V2E A;  3C6P B;  4Z64 C;  3M18 A;  4MN8 B;  3CVR A;  3W3J A;  5AWC A;  3CIY A;  5B0T A;  3ZYJ A;  1XWD C;  3FXI A;  4V2C A;  2Z63 A;  4BV4 R;  3WPB A;  3ULV A;  1M9L A;  4B8C D;  3E3Z A;  4J4L A;  5CMN A;  4EZG A;  4AY9 X;  4Y61 B;  3OJA A;  3CIG A;  4FS7 A;  5FTT B;  3RFE A;  4H09 A;  3WPF A;  1OTO A;  2Z82 A;  3OGK B;  3ZYN A;  2Z62 A;  5LFN A;  1DCE A;  3A79 B;  4MQW X;  1PGV A;  5GMH A;  1ZIW A;  4C2A B;  4CP6 A;  4TZH A;  1OGQ A;  2RA8 A;  4L3A A;  2V9T B;  3G06 A;  2P1N B;  4WYK A;  1FS2 A;  1P9A G;  5GQR K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...