4LI1A

Crystal structures of lgr4 and its complex with r-spondin1
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
424
structure length
424
Chain Sequence
PCPAPCACDLDGGADCSGKGLVTVPDGLSVFTHSLDLSMNNITKLPEGAFKGFPYLEELRLAGNDLSIIHPMALSGLKELKVLTLQNNQLKTVPSESLKGLVSLQSLRLDANHIVTVPEDSFEGLVQLRHLWLDDNSLTEVPIRPLSNLPSLQALTLALNKISHIPDYAFSNLSSLVVLHLHNNKIRTLGPHCFHGLDNLEALDLNYNNLIDFPDSIRSLPNLKELGFHSNSITIIPDGAFVKNPLLRTIHLYDNPLSFVGNSAFQNLSDLHFLIIRGASNVQWFPNLTGTNNLESLTLTGTKIRSIPIKFCQEQKMLRTLDLSYNEISALVGFEGCSSLEEVYLQNNQIQEVQNETFQGLAALRMLDLSRNRIHTIHKEAFVTLKALTNLDLSFNDLTAFPTAGLHGLNQLKLTGNPNFKETL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Leucine-rich repeat-containing G-protein coupled receptor 4
publication title Crystal structures of lgr4 and its complex with R-spondin1.
pubmed doi rcsb
source organism Xenopus (silurana) tropicalis
molecule tags Hormone receptor
total genus 120
structure length 424
sequence length 424
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13855 LRR_8 Leucine rich repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 4li1A01
2R9UA 3WPIA 4LSCA 3RW6A 4FCGA 3G39A 4R6GA 2BNHA 3WPHA 3RGZA 4QBZA 5LFNA 4GLPA 4R08A 3G04C 3M19A 3PMHG 2IFGA 2A0ZA 2P1MB 2Z7XB 2Z63A 4V2EA 3C6NB 1H6UA 3OJAA 3WPDA 1QYYA 3RFEA 4FD0A 2JE0A 4MN8B 3WPGA 4PQ8A 1O6TA 3RW7A 5HZLB 1DS9A 4TZHA 3O6NA 4LSXC 2WQXA 4Z61C 2P1OB 3RIZA 2RA8A 4UFRA 5GQRK 4U7LA 1M9LA 4R09A 4C2AB 4V2CA 4CC4C 4KT1A 5AWBA 2ELLA 3GOZA 3M18A 3WPCA 3VQ2A 1A9NA 4Z94G 2WQVA 4ARRA 1PGVA 4B8CD 1SQ0B 1FO1A 4Q3IA 5GMHA 4J0MA 5GS0A 2Z81A 2Y5QA 4L3AA 1G9UA 1XECA 1M10B 3G06A 2WQWA 1DFJI 3W3NA 3ULVA 3W3GA 3WPFA 3VQ1A 2Z65A 1FQVA 4K17A 4PEQB 1FS2A 1GWBA 1IO0A 5HDHA 3W3MA 2WFHA 4Q62A 1OOKG 4R5CA 3O53A 3ULAA 4ECOA 2O6QA 4Z79A 4M7EA 2OMVA 2Z62A 5IJCA 1KOOA 4LXRA 4WYKA 3KJ4A 4CNCA 1KOHA 2UZYA 3CVRA 1YRGA 5B4PA 2V70A 4QXEA 4HQ1A 5AZ5A 4P8SA 4AY9X 4I6JB 3OGKB 4BSRA 4FS7A 3OGMB 4PSJA 4AW4A 2RR6A 4PERA 4GT6A 2OMXA 2P1QB 5CMNA 1P8VA 2WQUA 3DZEA 5AWAA 4L3FA 3P72A 3ZYNA 1U0ND 3WPBA 2Z82A 4R6FA 1OTNA 1XWDC 4XSQA 4CC4A 3ZYOA 4G8AA 3OJAB 4PKIG 3TSRE 2FT3A 3RFJA 1OTMA 5B0NA 3ZYJA 5AWDA 4Z64C 5CMPA 5IYXC 2UZXA 4XGOA 4RWTC 4Q3GA 3CIYA 2ID5A 1LTXA 1M0ZA 4LI2A 1XKUA 1XCDA 1W8AA 4RCAB 1M9SA 3RGXA 3RFSA 4R58A 4Z8GA 4R6JA 4BV4R 2Z64A 4KXFB 1WWLA 1K5GC 2OMWA 4J4LA 1OGQA 2OMUA 4LSAA 5GMFA 1O6VA 1P8TA 4BSSA 2Z7XA 1K5DC 1A4YA 2OMZA 5GS2B 2V9TB 3UL8A 3BZ5A 4U09A 2BEXA 3UN9A 1FT8A 2OMTA 1H6TA 2ASSB 3UL9A 2JQDA 3CIGA 5A5CA 3WN4A 4MQWX 3JB9j 1D0BA 3FXIA 4R07A 4ARNA 2V9SA 4M7EC 4Y61B 2JE1A 1ZIWA 1OZNA 3E2JA 3G3AA 4FMZA 3W3LA 4FHOA 4LSXA 1O6SA 4ECNA 4R6AA 2CA6A 5FTTB 4CILA 2XWTC 4CNMA 3E4GA 2P1PB 4KNGA 1DCEA 3E3ZA 1Z7XW 2XOTA 4XOSA 2Q4GW 5D3IA 3UL7A 4YEBB 2P1NB 1JL5A 4LXSA 4EZGA 5AWCA 3REZA 4FDWA 4C2BB 4R5DA 4U08A 3SB4A 2O6SA 3C6PB 3E6JA 4NKHA 4LI1A 4R0AA 4P91A 3WPEA 4WP6A 3A79B 4U06A 4QC0A 3ULUA 3W3JA 4OQTA 4V2DA 2ASTB 5B0TA 5IJDA 3C6OB 2OMYA 3ZYIA 3OGLB 5GMGA 4CP6A 1OTOA 4H09A 3RJ0A 1P9AG 2O6RA 2Z66A 4BSUA 4RCWA 4IM6A 4NKGA 1XEUA 5IJBA 3W3KA 3G3BA
chains in the Genus database with same CATH superfamily
2R9UA 3WPIA 4LSCA 3RW6A 4FCGA 3G39A 4R6GA 2BNHA 3WPHA 3RGZA 4QBZA 5LFNA 4GLPA 4R08A 3G04C 3M19A 3PMHG 2IFGA 2A0ZA 2P1MB 2Z7XB 2Z63A 4V2EA 3C6NB 1H6UA 3OJAA 3WPDA 1QYYA 3RFEA 4FD0A 2JE0A 4MN8B 3WPGA 4PQ8A 1O6TA 3RW7A 5HZLB 1DS9A 4TZHA 3O6NA 4LSXC 2WQXA 4Z61C 2P1OB 3RIZA 2RA8A 4UFRA 5GQRK 4U7LA 1M9LA 4R09A 4C2AB 4V2CA 4CC4C 4KT1A 5AWBA 2ELLA 3GOZA 3M18A 3WPCA 3VQ2A 1A9NA 4Z94G 2WQVA 4ARRA 1PGVA 4B8CD 1SQ0B 1FO1A 4Q3IA 5GMHA 4J0MA 5GS0A 2Z81A 2Y5QA 4L3AA 1G9UA 1XECA 1M10B 3G06A 2WQWA 1DFJI 3W3NA 3ULVA 3W3GA 3WPFA 3VQ1A 2Z65A 1FQVA 4K17A 4PEQB 1FS2A 1GWBA 1IO0A 5HDHA 3W3MA 2WFHA 4Q62A 1OOKG 4R5CA 3O53A 3ULAA 4ECOA 2O6QA 4Z79A 4M7EA 2OMVA 2Z62A 5IJCA 1KOOA 4LXRA 4WYKA 3KJ4A 4CNCA 1KOHA 2UZYA 3CVRA 1YRGA 5B4PA 2V70A 4QXEA 4HQ1A 5AZ5A 4P8SA 4AY9X 4I6JB 3OGKB 4BSRA 4FS7A 3OGMB 4PSJA 4AW4A 2RR6A 4PERA 4GT6A 2OMXA 2P1QB 5CMNA 1P8VA 2WQUA 3DZEA 5AWAA 4L3FA 3P72A 3ZYNA 1U0ND 3WPBA 2Z82A 4R6FA 1OTNA 1XWDC 4XSQA 4CC4A 3ZYOA 4G8AA 3OJAB 4PKIG 3TSRE 2FT3A 3RFJA 1OTMA 5B0NA 3ZYJA 5AWDA 4Z64C 5CMPA 5IYXC 2UZXA 4XGOA 4RWTC 4Q3GA 3CIYA 2ID5A 1LTXA 1M0ZA 4LI2A 1XKUA 1XCDA 1W8AA 4RCAB 1M9SA 3RGXA 3RFSA 4R58A 4Z8GA 4R6JA 4NZRM 4BV4R 2Z64A 4KXFB 1WWLA 1K5GC 2OMWA 4J4LA 1OGQA 2OMUA 4LSAA 5GMFA 1O6VA 1P8TA 4BSSA 2Z7XA 1K5DC 1A4YA 2OMZA 5GS2B 2V9TB 3UL8A 3BZ5A 4U09A 2BEXA 3UN9A 1FT8A 2OMTA 1H6TA 2ASSB 3UL9A 2JQDA 3CIGA 5A5CA 3WN4A 4MQWX 3JB9j 1D0BA 3FXIA 4R07A 4ARNA 2V9SA 4M7EC 4Y61B 2JE1A 1ZIWA 1OZNA 3E2JA 3G3AA 4FMZA 3W3LA 4FHOA 4LSXA 1O6SA 4ECNA 4R6AA 2CA6A 5FTTB 4CILA 2XWTC 4CNMA 3E4GA 2P1PB 4KNGA 1DCEA 3E3ZA 1Z7XW 2XOTA 4XOSA 2Q4GW 5D3IA 3UL7A 4YEBB 2P1NB 1JL5A 4LXSA 4EZGA 5AWCA 3REZA 4FDWA 4C2BB 4R5DA 4U08A 3SB4A 2O6SA 3C6PB 3E6JA 4NKHA 4LI1A 4R0AA 4P91A 3WPEA 4WP6A 3A79B 4U06A 4QC0A 3ULUA 3W3JA 4OQTA 4V2DA 2ASTB 5B0TA 5IJDA 3C6OB 2OMYA 3ZYIA 3OGLB 5GMGA 4CP6A 1OTOA 4H09A 4NZTM 3RJ0A 1P9AG 2O6RA 2Z66A 4BSUA 4RCWA 4IM6A 4NKGA 1XEUA 5IJBA 3W3KA 3G3BA
chains in the Genus database with same CATH topology
2R9UA 3WPIA 4LSCA 3RW6A 4FCGA 3G39A 4R6GA 2BNHA 3WPHA 3RGZA 4QBZA 5LFNA 4GLPA 4R08A 3G04C 3M19A 3PMHG 2IFGA 2A0ZA 2P1MB 2Z7XB 2Z63A 4V2EA 3C6NB 1H6UA 3OJAA 3WPDA 1QYYA 3RFEA 4FD0A 2JE0A 4MN8B 3WPGA 4PQ8A 1O6TA 3RW7A 5HZLB 1DS9A 4TZHA 3O6NA 4LSXC 2WQXA 4Z61C 2P1OB 3RIZA 2RA8A 4UFRA 5GQRK 4U7LA 1M9LA 4R09A 4C2AB 4V2CA 4CC4C 4KT1A 5AWBA 2ELLA 3GOZA 3M18A 3WPCA 3VQ2A 1A9NA 4Z94G 2WQVA 4ARRA 1PGVA 4B8CD 1SQ0B 1FO1A 4Q3IA 5GMHA 4J0MA 5GS0A 2Z81A 2Y5QA 4L3AA 1G9UA 1XECA 1M10B 3G06A 2WQWA 1DFJI 3W3NA 3ULVA 3W3GA 3WPFA 3VQ1A 2Z65A 1FQVA 4K17A 4PEQB 1FS2A 1GWBA 1IO0A 5HDHA 3W3MA 2WFHA 4Q62A 1OOKG 4R5CA 3O53A 3ULAA 4ECOA 2O6QA 4Z79A 4M7EA 2OMVA 2Z62A 5IJCA 1KOOA 4LXRA 4WYKA 3KJ4A 4CNCA 1KOHA 2UZYA 3CVRA 1YRGA 5B4PA 2V70A 4QXEA 4HQ1A 5AZ5A 4P8SA 4AY9X 4I6JB 3OGKB 4BSRA 4FS7A 3OGMB 4PSJA 4AW4A 2RR6A 4PERA 4GT6A 2OMXA 2P1QB 5CMNA 1P8VA 2WQUA 3DZEA 5AWAA 4L3FA 3P72A 3ZYNA 1U0ND 3WPBA 2Z82A 4R6FA 1OTNA 1XWDC 4XSQA 4CC4A 3ZYOA 4G8AA 3OJAB 4PKIG 3TSRE 2FT3A 3RFJA 1OTMA 5B0NA 3ZYJA 5AWDA 4Z64C 5CMPA 5IYXC 2UZXA 4XGOA 4RWTC 4Q3GA 3CIYA 2ID5A 1LTXA 1M0ZA 4LI2A 1XKUA 1XCDA 1W8AA 4RCAB 1M9SA 3RGXA 3RFSA 4R58A 4Z8GA 4R6JA 4BV4R 2Z64A 4KXFB 1WWLA 1K5GC 2OMWA 4J4LA 1OGQA 2OMUA 4LSAA 5GMFA 1O6VA 1P8TA 4BSSA 2Z7XA 1K5DC 1A4YA 2OMZA 5GS2B 2V9TB 3UL8A 3BZ5A 4U09A 2BEXA 3UN9A 1FT8A 2OMTA 1H6TA 2ASSB 3UL9A 2JQDA 3CIGA 5A5CA 3WN4A 4MQWX 3JB9j 1D0BA 3FXIA 4R07A 4ARNA 2V9SA 4M7EC 4Y61B 2JE1A 1ZIWA 1OZNA 3E2JA 3G3AA 4FMZA 3W3LA 4FHOA 4LSXA 1O6SA 4ECNA 4R6AA 2CA6A 5FTTB 4CILA 2XWTC 4CNMA 3E4GA 2P1PB 4KNGA 1DCEA 3E3ZA 1Z7XW 2XOTA 4XOSA 2Q4GW 5D3IA 3UL7A 4YEBB 2P1NB 1JL5A 4LXSA 4EZGA 5AWCA 3REZA 4FDWA 4C2BB 4R5DA 4U08A 3SB4A 2O6SA 3C6PB 3E6JA 4NKHA 4LI1A 4R0AA 4P91A 3WPEA 4WP6A 3A79B 4U06A 4QC0A 3ULUA 3W3JA 4OQTA 4V2DA 2ASTB 5B0TA 5IJDA 3C6OB 2OMYA 3ZYIA 3OGLB 5GMGA 4CP6A 1OTOA 4H09A 3RJ0A 1P9AG 2O6RA 2Z66A 4BSUA 4RCWA 4IM6A 4NKGA 1XEUA 5IJBA 3W3KA 3G3BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2R9U A;  3WPI A;  4LSC A;  3RW6 A;  4FCG A;  3G39 A;  4R6G A;  2BNH A;  3WPH A;  3RGZ A;  4QBZ A;  5LFN A;  4GLP A;  4R08 A;  3G04 C;  3M19 A;  3PMH G;  2IFG A;  2A0Z A;  2P1M B;  2Z7X B;  2Z63 A;  4V2E A;  3C6N B;  1H6U A;  3OJA A;  3WPD A;  1QYY A;  3RFE A;  4FD0 A;  2JE0 A;  4MN8 B;  3WPG A;  4PQ8 A;  1O6T A;  3RW7 A;  5HZL B;  1DS9 A;  4TZH A;  3O6N A;  4LSX C;  2WQX A;  4Z61 C;  2P1O B;  3RIZ A;  2RA8 A;  4UFR A;  5GQR K;  4U7L A;  1M9L A;  4R09 A;  4C2A B;  4V2C A;  4CC4 C;  4KT1 A;  5AWB A;  2ELL A;  3GOZ A;  3M18 A;  3WPC A;  3VQ2 A;  1A9N A;  4Z94 G;  2WQV A;  4ARR A;  1PGV A;  4B8C D;  1SQ0 B;  1FO1 A;  4Q3I A;  5GMH A;  4J0M A;  5GS0 A;  2Z81 A;  2Y5Q A;  4L3A A;  1G9U A;  1XEC A;  1M10 B;  3G06 A;  2WQW A;  1DFJ I;  3W3N A;  3ULV A;  3W3G A;  3WPF A;  3VQ1 A;  2Z65 A;  1FQV A;  4K17 A;  4PEQ B;  1FS2 A;  1GWB A;  1IO0 A;  5HDH A;  3W3M A;  2WFH A;  4Q62 A;  1OOK G;  4R5C A;  3O53 A;  3ULA A;  4ECO A;  2O6Q A;  4Z79 A;  4M7E A;  2OMV A;  2Z62 A;  5IJC A;  1KOO A;  4LXR A;  4WYK A;  3KJ4 A;  4CNC A;  1KOH A;  2UZY A;  3CVR A;  1YRG A;  5B4P A;  2V70 A;  4QXE A;  4HQ1 A;  5AZ5 A;  4P8S A;  4AY9 X;  4I6J B;  3OGK B;  4BSR A;  4FS7 A;  3OGM B;  4PSJ A;  4AW4 A;  2RR6 A;  4PER A;  4GT6 A;  2OMX A;  2P1Q B;  5CMN A;  1P8V A;  2WQU A;  3DZE A;  5AWA A;  4L3F A;  3P72 A;  3ZYN A;  1U0N D;  3WPB A;  2Z82 A;  4R6F A;  1OTN A;  1XWD C;  4XSQ A;  4CC4 A;  3ZYO A;  4G8A A;  3OJA B;  4PKI G;  3TSR E;  2FT3 A;  3RFJ A;  1OTM A;  5B0N A;  3ZYJ A;  5AWD A;  4Z64 C;  5CMP A;  5IYX C;  2UZX A;  4XGO A;  4RWT C;  4Q3G A;  3CIY A;  2ID5 A;  1LTX A;  1M0Z A;  4LI2 A;  1XKU A;  1XCD A;  1W8A A;  4RCA B;  1M9S A;  3RGX A;  3RFS A;  4R58 A;  4Z8G A;  4R6J A;  4BV4 R;  2Z64 A;  4KXF B;  1WWL A;  1K5G C;  2OMW A;  4J4L A;  1OGQ A;  2OMU A;  4LSA A;  5GMF A;  1O6V A;  1P8T A;  4BSS A;  2Z7X A;  1K5D C;  1A4Y A;  2OMZ A;  5GS2 B;  2V9T B;  3UL8 A;  3BZ5 A;  4U09 A;  2BEX A;  3UN9 A;  1FT8 A;  2OMT A;  1H6T A;  2ASS B;  3UL9 A;  2JQD A;  3CIG A;  5A5C A;  3WN4 A;  4MQW X;  3JB9 j;  1D0B A;  3FXI A;  4R07 A;  4ARN A;  2V9S A;  4M7E C;  4Y61 B;  2JE1 A;  1ZIW A;  1OZN A;  3E2J A;  3G3A A;  4FMZ A;  3W3L A;  4FHO A;  4LSX A;  1O6S A;  4ECN A;  4R6A A;  2CA6 A;  5FTT B;  4CIL A;  2XWT C;  4CNM A;  3E4G A;  2P1P B;  4KNG A;  1DCE A;  3E3Z A;  1Z7X W;  2XOT A;  4XOS A;  2Q4G W;  5D3I A;  3UL7 A;  4YEB B;  2P1N B;  1JL5 A;  4LXS A;  4EZG A;  5AWC A;  3REZ A;  4FDW A;  4C2B B;  4R5D A;  4U08 A;  3SB4 A;  2O6S A;  3C6P B;  3E6J A;  4NKH A;  4LI1 A;  4R0A A;  4P91 A;  3WPE A;  4WP6 A;  3A79 B;  4U06 A;  4QC0 A;  3ULU A;  3W3J A;  4OQT A;  4V2D A;  2AST B;  5B0T A;  5IJD A;  3C6O B;  2OMY A;  3ZYI A;  3OGL B;  5GMG A;  4CP6 A;  1OTO A;  4H09 A;  3RJ0 A;  1P9A G;  2O6R A;  2Z66 A;  4BSU A;  4RCW A;  4IM6 A;  4NKG A;  1XEU A;  5IJB A;  3W3K A;  3G3B A; 
#chains in the Genus database with same CATH topology
 2R9U A;  3WPI A;  4LSC A;  3RW6 A;  4FCG A;  3G39 A;  4R6G A;  2BNH A;  3WPH A;  3RGZ A;  4QBZ A;  5LFN A;  4GLP A;  4R08 A;  3G04 C;  3M19 A;  3PMH G;  2IFG A;  2A0Z A;  2P1M B;  2Z7X B;  2Z63 A;  4V2E A;  3C6N B;  1H6U A;  3OJA A;  3WPD A;  1QYY A;  3RFE A;  4FD0 A;  2JE0 A;  4MN8 B;  3WPG A;  4PQ8 A;  1O6T A;  3RW7 A;  5HZL B;  1DS9 A;  4TZH A;  3O6N A;  4LSX C;  2WQX A;  4Z61 C;  2P1O B;  3RIZ A;  2RA8 A;  4UFR A;  5GQR K;  4U7L A;  1M9L A;  4R09 A;  4C2A B;  4V2C A;  4CC4 C;  4KT1 A;  5AWB A;  2ELL A;  3GOZ A;  3M18 A;  3WPC A;  3VQ2 A;  1A9N A;  4Z94 G;  2WQV A;  4ARR A;  1PGV A;  4B8C D;  1SQ0 B;  1FO1 A;  4Q3I A;  5GMH A;  4J0M A;  5GS0 A;  2Z81 A;  2Y5Q A;  4L3A A;  1G9U A;  1XEC A;  1M10 B;  3G06 A;  2WQW A;  1DFJ I;  3W3N A;  3ULV A;  3W3G A;  3WPF A;  3VQ1 A;  2Z65 A;  1FQV A;  4K17 A;  4PEQ B;  1FS2 A;  1GWB A;  1IO0 A;  5HDH A;  3W3M A;  2WFH A;  4Q62 A;  1OOK G;  4R5C A;  3O53 A;  3ULA A;  4ECO A;  2O6Q A;  4Z79 A;  4M7E A;  2OMV A;  2Z62 A;  5IJC A;  1KOO A;  4LXR A;  4WYK A;  3KJ4 A;  4CNC A;  1KOH A;  2UZY A;  3CVR A;  1YRG A;  5B4P A;  2V70 A;  4QXE A;  4HQ1 A;  5AZ5 A;  4P8S A;  4AY9 X;  4I6J B;  3OGK B;  4BSR A;  4FS7 A;  3OGM B;  4PSJ A;  4AW4 A;  2RR6 A;  4PER A;  4GT6 A;  2OMX A;  2P1Q B;  5CMN A;  1P8V A;  2WQU A;  3DZE A;  5AWA A;  4L3F A;  3P72 A;  3ZYN A;  1U0N D;  3WPB A;  2Z82 A;  4R6F A;  1OTN A;  1XWD C;  4XSQ A;  4CC4 A;  3ZYO A;  4G8A A;  3OJA B;  4PKI G;  3TSR E;  2FT3 A;  3RFJ A;  1OTM A;  5B0N A;  3ZYJ A;  5AWD A;  4Z64 C;  5CMP A;  5IYX C;  2UZX A;  4XGO A;  4RWT C;  4Q3G A;  3CIY A;  2ID5 A;  1LTX A;  1M0Z A;  4LI2 A;  1XKU A;  1XCD A;  1W8A A;  4RCA B;  1M9S A;  3RGX A;  3RFS A;  4R58 A;  4Z8G A;  4R6J A;  4NZR M;  4BV4 R;  2Z64 A;  4KXF B;  1WWL A;  1K5G C;  2OMW A;  4J4L A;  1OGQ A;  2OMU A;  4LSA A;  5GMF A;  1O6V A;  1P8T A;  4BSS A;  2Z7X A;  1K5D C;  1A4Y A;  2OMZ A;  5GS2 B;  2V9T B;  3UL8 A;  3BZ5 A;  4U09 A;  2BEX A;  3UN9 A;  1FT8 A;  2OMT A;  1H6T A;  2ASS B;  3UL9 A;  2JQD A;  3CIG A;  5A5C A;  3WN4 A;  4MQW X;  3JB9 j;  1D0B A;  3FXI A;  4R07 A;  4ARN A;  2V9S A;  4M7E C;  4Y61 B;  2JE1 A;  1ZIW A;  1OZN A;  3E2J A;  3G3A A;  4FMZ A;  3W3L A;  4FHO A;  4LSX A;  1O6S A;  4ECN A;  4R6A A;  2CA6 A;  5FTT B;  4CIL A;  2XWT C;  4CNM A;  3E4G A;  2P1P B;  4KNG A;  1DCE A;  3E3Z A;  1Z7X W;  2XOT A;  4XOS A;  2Q4G W;  5D3I A;  3UL7 A;  4YEB B;  2P1N B;  1JL5 A;  4LXS A;  4EZG A;  5AWC A;  3REZ A;  4FDW A;  4C2B B;  4R5D A;  4U08 A;  3SB4 A;  2O6S A;  3C6P B;  3E6J A;  4NKH A;  4LI1 A;  4R0A A;  4P91 A;  3WPE A;  4WP6 A;  3A79 B;  4U06 A;  4QC0 A;  3ULU A;  3W3J A;  4OQT A;  4V2D A;  2AST B;  5B0T A;  5IJD A;  3C6O B;  2OMY A;  3ZYI A;  3OGL B;  5GMG A;  4CP6 A;  1OTO A;  4H09 A;  4NZT M;  3RJ0 A;  1P9A G;  2O6R A;  2Z66 A;  4BSU A;  4RCW A;  4IM6 A;  4NKG A;  1XEU A;  5IJB A;  3W3K A;  3G3B A; 
#chains in the Genus database with same CATH homology
 2R9U A;  3WPI A;  4LSC A;  3RW6 A;  4FCG A;  3G39 A;  4R6G A;  2BNH A;  3WPH A;  3RGZ A;  4QBZ A;  5LFN A;  4GLP A;  4R08 A;  3G04 C;  3M19 A;  3PMH G;  2IFG A;  2A0Z A;  2P1M B;  2Z7X B;  2Z63 A;  4V2E A;  3C6N B;  1H6U A;  3OJA A;  3WPD A;  1QYY A;  3RFE A;  4FD0 A;  2JE0 A;  4MN8 B;  3WPG A;  4PQ8 A;  1O6T A;  3RW7 A;  5HZL B;  1DS9 A;  4TZH A;  3O6N A;  4LSX C;  2WQX A;  4Z61 C;  2P1O B;  3RIZ A;  2RA8 A;  4UFR A;  5GQR K;  4U7L A;  1M9L A;  4R09 A;  4C2A B;  4V2C A;  4CC4 C;  4KT1 A;  5AWB A;  2ELL A;  3GOZ A;  3M18 A;  3WPC A;  3VQ2 A;  1A9N A;  4Z94 G;  2WQV A;  4ARR A;  1PGV A;  4B8C D;  1SQ0 B;  1FO1 A;  4Q3I A;  5GMH A;  4J0M A;  5GS0 A;  2Z81 A;  2Y5Q A;  4L3A A;  1G9U A;  1XEC A;  1M10 B;  3G06 A;  2WQW A;  1DFJ I;  3W3N A;  3ULV A;  3W3G A;  3WPF A;  3VQ1 A;  2Z65 A;  1FQV A;  4K17 A;  4PEQ B;  1FS2 A;  1GWB A;  1IO0 A;  5HDH A;  3W3M A;  2WFH A;  4Q62 A;  1OOK G;  4R5C A;  3O53 A;  3ULA A;  4ECO A;  2O6Q A;  4Z79 A;  4M7E A;  2OMV A;  2Z62 A;  5IJC A;  1KOO A;  4LXR A;  4WYK A;  3KJ4 A;  4CNC A;  1KOH A;  2UZY A;  3CVR A;  1YRG A;  5B4P A;  2V70 A;  4QXE A;  4HQ1 A;  5AZ5 A;  4P8S A;  4AY9 X;  4I6J B;  3OGK B;  4BSR A;  4FS7 A;  3OGM B;  4PSJ A;  4AW4 A;  2RR6 A;  4PER A;  4GT6 A;  2OMX A;  2P1Q B;  5CMN A;  1P8V A;  2WQU A;  3DZE A;  5AWA A;  4L3F A;  3P72 A;  3ZYN A;  1U0N D;  3WPB A;  2Z82 A;  4R6F A;  1OTN A;  1XWD C;  4XSQ A;  4CC4 A;  3ZYO A;  4G8A A;  3OJA B;  4PKI G;  3TSR E;  2FT3 A;  3RFJ A;  1OTM A;  5B0N A;  3ZYJ A;  5AWD A;  4Z64 C;  5CMP A;  5IYX C;  2UZX A;  4XGO A;  4RWT C;  4Q3G A;  3CIY A;  2ID5 A;  1LTX A;  1M0Z A;  4LI2 A;  1XKU A;  1XCD A;  1W8A A;  4RCA B;  1M9S A;  3RGX A;  3RFS A;  4R58 A;  4Z8G A;  4R6J A;  4BV4 R;  2Z64 A;  4KXF B;  1WWL A;  1K5G C;  2OMW A;  4J4L A;  1OGQ A;  2OMU A;  4LSA A;  5GMF A;  1O6V A;  1P8T A;  4BSS A;  2Z7X A;  1K5D C;  1A4Y A;  2OMZ A;  5GS2 B;  2V9T B;  3UL8 A;  3BZ5 A;  4U09 A;  2BEX A;  3UN9 A;  1FT8 A;  2OMT A;  1H6T A;  2ASS B;  3UL9 A;  2JQD A;  3CIG A;  5A5C A;  3WN4 A;  4MQW X;  3JB9 j;  1D0B A;  3FXI A;  4R07 A;  4ARN A;  2V9S A;  4M7E C;  4Y61 B;  2JE1 A;  1ZIW A;  1OZN A;  3E2J A;  3G3A A;  4FMZ A;  3W3L A;  4FHO A;  4LSX A;  1O6S A;  4ECN A;  4R6A A;  2CA6 A;  5FTT B;  4CIL A;  2XWT C;  4CNM A;  3E4G A;  2P1P B;  4KNG A;  1DCE A;  3E3Z A;  1Z7X W;  2XOT A;  4XOS A;  2Q4G W;  5D3I A;  3UL7 A;  4YEB B;  2P1N B;  1JL5 A;  4LXS A;  4EZG A;  5AWC A;  3REZ A;  4FDW A;  4C2B B;  4R5D A;  4U08 A;  3SB4 A;  2O6S A;  3C6P B;  3E6J A;  4NKH A;  4LI1 A;  4R0A A;  4P91 A;  3WPE A;  4WP6 A;  3A79 B;  4U06 A;  4QC0 A;  3ULU A;  3W3J A;  4OQT A;  4V2D A;  2AST B;  5B0T A;  5IJD A;  3C6O B;  2OMY A;  3ZYI A;  3OGL B;  5GMG A;  4CP6 A;  1OTO A;  4H09 A;  3RJ0 A;  1P9A G;  2O6R A;  2Z66 A;  4BSU A;  4RCW A;  4IM6 A;  4NKG A;  1XEU A;  5IJB A;  3W3K A;  3G3B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...