4C2AB

Crystal structure of high-affinity von willebrand factor a1 domain with r1306q and i1309v mutations in complex with high affinity gpib alpha
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
266
structure length
266
Chain Sequence
HPICEVSKVASHLEVNCDKRRLTALPPDLPKDTTILHLSENLLYTFSLATLMPYTRLTQLNLDRCELTKLQVDGTLPVLGTLDLSHNQLQSLPLLGQTLPALTVLDVSFNRLTSLPLGALRGLGELQELYLKGNELKTLPPGLLTPTPKLEKLSLANNRLTELPAGLLNGLENLDTLLLQENSLYTIPKGFFGSHLLPFAFLHGNPWLCNCEILYFRRWLQDNAENVYVWKQVVDVKAVTSNVASVQCDNSDKFPVYKYPGKGCPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords VON WILLEBRAND FACTOR
publication title Towards the Structural Basis of Regulation of Von Willebrand Factor Binding to Glycoprotein Ib
pubmed doi rcsb
source organism Homo sapiens
molecule tags Blood clotting
total genus 72
structure length 266
sequence length 266
ec nomenclature
pdb deposition date 2013-08-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01462 LRRNT Leucine rich repeat N-terminal domain
B PF13855 LRR_8 Leucine rich repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 4c2aB00
4R09A 4U08A 3RFJA 4Y61B 3G3BA 1K5DC 3UL9A 4U06A 2V70A 3ULUA 4J4LA 3DZEA 4C2BB 4XOSA 4FD0A 3W3JA 4PQ8A 4B8CD 1OZNA 3JB9j 1JL5A 1WWLA 3O6NA 2WQUA 3A79B 4U09A 5B0NA 2OMVA 4CNCA 3TSRE 4CILA 4QBZA 1O6TA 2Z66A 1M9SA 4ECNA 5D3IA 2P1OB 3W3KA 4MN8B 4V2EA 2V9SA 4LXRA 3E6JA 4KT1A 4AW4A 4ARNA 1GWBA 3WPHA 4FS7A 4NKGA 2WQVA 2P1NB 2OMZA 1H6TA 1H6UA 5GMGA 1P8VA 1M10B 4H09A 2Z65A 4PERA 1A9NA 3CIGA 2Z7XA 1ZIWA 4NKHA 1YRGA 2OMXA 2O6QA 2OMUA 2Z63A 4QC0A 4AY9X 1XCDA 4OQTA 4Z61C 4PEQB 3M19A 3RIZA 5LFNA 2BNHA 3SB4A 5AWDA 2WQXA 2Y5QA 1LTXA 5IJCA 1D0BA 2OMTA 4Z8GA 1PGVA 1M9LA 3OJAA 4BV4R 2FT3A 4LSAA 3P72A 3WPFA 2RA8A 3OGMB 4R5DA 3UN9A 2Z7XB 3ZYJA 4HQ1A 1FQVA 2Q4GW 4XGOA 1XEUA 2Z82A 2CA6A 3RW6A 1FO1A 1FS2A 3VQ1A 2IFGA 2V9TB 4L3AA 2O6SA 1XKUA 1KOOA 4L3FA 4ECOA 4R58A 1O6VA 4MQWX 5GQRK 2RR6A 4BSUA 5AWBA 4M7EC 4Q62A 1XECA 3G39A 3WPCA 1P9AG 3G06A 4FMZA 5HDHA 3ULVA 3W3GA 4C2AB 2XWTC 3WPIA 5HZLB 4R6JA 1U0ND 3G04C 3W3NA 3C6PB 2JE0A 4TZHA 4YEBB 4R6GA 3FXIA 5AWCA 4RCAB 4FCGA 1DCEA 4LSXC 2P1PB 1G9UA 1OGQA 1Z7XW 3REZA 3W3LA 1IO0A 5A5CA 1OTNA 1QYYA 4J0MA 5CMNA 3ULAA 4CNMA 5B4PA 3UL7A 3RGZA 3WPGA 4ARRA 3VQ2A 4IM6A 3RJ0A 2WQWA 1FT8A 3RGXA 4EZGA 4KXFB 3C6OB 4M7EA 4K17A 1W8AA 4R08A 1OTOA 4CC4C 3ZYNA 4XSQA 2JE1A 5IYXC 2WFHA 3CVRA 3E4GA 3WPEA 3CIYA 3WN4A 5GS0A 4LXSA 3RW7A 4LSCA 4RWTC 1XWDC 1DS9A 3WPBA 4PSJA 4Z94G 1KOHA 2ASSB 5B0TA 4LSXA 2O6RA 1M0ZA 2UZXA 3GOZA 4LI2A 1DFJI 2XOTA 4BSRA 4LI1A 3KJ4A 4I6JB 3RFSA 2P1MB 4R6FA 4WYKA 3E2JA 4R6AA 3C6NB 1P8TA 3OGLB 4Z64C 1OTMA 4U7LA 5IJDA 3O53A 5CMPA 4G8AA 1O6SA 1K5GC 2ELLA 3OJAB 4GT6A 3G3AA 2A0ZA 3BZ5A 4FDWA 4UFRA 4GLPA 3RFEA 5AZ5A 4P91A 3W3MA 4CC4A 4R5CA 4WP6A 4BSSA 2Z64A 4R07A 2UZYA 2Z81A 2ID5A 4FHOA 2OMWA 4QXEA 1OOKG 3E3ZA 4R0AA 4PKIG 2R9UA 3PMHG 4Z79A 3WPDA 4RCWA 2P1QB 4V2CA 4Q3GA 4P8SA 2OMYA 5IJBA 4Q3IA 5GMFA 4V2DA 3M18A 5AWAA 2ASTB 3UL8A 3OGKB 5GMHA 5FTTB 2JQDA 2BEXA 3ZYIA 3ZYOA 4CP6A 4KNGA 5GS2B 1SQ0B 2Z62A 1A4YA
chains in the Genus database with same CATH superfamily
4R09A 4U08A 3RFJA 4Y61B 3G3BA 1K5DC 3UL9A 4U06A 2V70A 3ULUA 4J4LA 3DZEA 4C2BB 4XOSA 4FD0A 3W3JA 4PQ8A 4B8CD 1OZNA 3JB9j 1JL5A 1WWLA 3O6NA 2WQUA 3A79B 4U09A 5B0NA 2OMVA 4CNCA 3TSRE 4CILA 4QBZA 1O6TA 2Z66A 1M9SA 4ECNA 5D3IA 2P1OB 3W3KA 4MN8B 4V2EA 2V9SA 4LXRA 3E6JA 4KT1A 4AW4A 4ARNA 1GWBA 3WPHA 4FS7A 4NKGA 2WQVA 2P1NB 2OMZA 1H6TA 1H6UA 5GMGA 1P8VA 1M10B 4H09A 2Z65A 4PERA 1A9NA 3CIGA 2Z7XA 1ZIWA 4NKHA 1YRGA 2OMXA 2O6QA 2OMUA 4NZRM 2Z63A 4QC0A 4AY9X 1XCDA 4OQTA 4Z61C 4PEQB 3M19A 3RIZA 5LFNA 2BNHA 3SB4A 5AWDA 2WQXA 2Y5QA 1LTXA 5IJCA 1D0BA 2OMTA 4Z8GA 1PGVA 1M9LA 3OJAA 4BV4R 2FT3A 4LSAA 3P72A 3WPFA 2RA8A 3OGMB 4R5DA 3UN9A 2Z7XB 3ZYJA 4HQ1A 1FQVA 2Q4GW 4XGOA 1XEUA 2Z82A 2CA6A 3RW6A 1FO1A 1FS2A 3VQ1A 2IFGA 2V9TB 4L3AA 2O6SA 1XKUA 1KOOA 4L3FA 4ECOA 4R58A 1O6VA 4MQWX 5GQRK 2RR6A 4BSUA 5AWBA 4M7EC 4Q62A 1XECA 3G39A 3WPCA 1P9AG 3G06A 4FMZA 5HDHA 3ULVA 3W3GA 4C2AB 2XWTC 3WPIA 5HZLB 4R6JA 1U0ND 3G04C 3W3NA 3C6PB 2JE0A 4TZHA 4YEBB 4R6GA 3FXIA 5AWCA 4RCAB 4FCGA 1DCEA 4LSXC 2P1PB 1G9UA 1OGQA 1Z7XW 3REZA 3W3LA 1IO0A 5A5CA 1OTNA 1QYYA 4J0MA 5CMNA 3ULAA 4CNMA 5B4PA 3UL7A 3RGZA 3WPGA 4ARRA 3VQ2A 4IM6A 3RJ0A 2WQWA 1FT8A 3RGXA 4EZGA 4KXFB 3C6OB 4M7EA 4K17A 1W8AA 4R08A 1OTOA 4CC4C 3ZYNA 4XSQA 2JE1A 5IYXC 2WFHA 3CVRA 3E4GA 3WPEA 3CIYA 3WN4A 5GS0A 4LXSA 3RW7A 4LSCA 4RWTC 1XWDC 1DS9A 3WPBA 4PSJA 4Z94G 1KOHA 2ASSB 5B0TA 4LSXA 2O6RA 1M0ZA 2UZXA 3GOZA 4LI2A 1DFJI 2XOTA 4BSRA 4LI1A 3KJ4A 4I6JB 3RFSA 2P1MB 4R6FA 4WYKA 3E2JA 4R6AA 3C6NB 1P8TA 3OGLB 4Z64C 1OTMA 4U7LA 5IJDA 3O53A 5CMPA 4G8AA 1O6SA 1K5GC 2ELLA 3OJAB 4GT6A 3G3AA 2A0ZA 3BZ5A 4FDWA 4NZTM 4GLPA 4UFRA 3RFEA 5AZ5A 4P91A 3W3MA 4CC4A 4R5CA 4WP6A 4BSSA 2Z64A 4R07A 2UZYA 2Z81A 2ID5A 4FHOA 2OMWA 4QXEA 1OOKG 3E3ZA 4R0AA 4PKIG 2R9UA 3PMHG 4Z79A 3WPDA 4RCWA 2P1QB 4V2CA 4Q3GA 4P8SA 2OMYA 5IJBA 4Q3IA 5GMFA 4V2DA 3M18A 5AWAA 2ASTB 3UL8A 3OGKB 5GMHA 5FTTB 2JQDA 2BEXA 3ZYIA 3ZYOA 4CP6A 4KNGA 5GS2B 1SQ0B 2Z62A 1A4YA
chains in the Genus database with same CATH topology
4R09A 4U08A 3RFJA 4Y61B 3G3BA 1K5DC 3UL9A 4U06A 2V70A 3ULUA 4J4LA 3DZEA 4C2BB 4XOSA 4FD0A 3W3JA 4PQ8A 4B8CD 1OZNA 3JB9j 1JL5A 1WWLA 3O6NA 2WQUA 3A79B 4U09A 5B0NA 2OMVA 4CNCA 3TSRE 4CILA 4QBZA 1O6TA 2Z66A 1M9SA 4ECNA 5D3IA 2P1OB 3W3KA 4MN8B 4V2EA 2V9SA 4LXRA 3E6JA 4KT1A 4AW4A 4ARNA 1GWBA 3WPHA 4FS7A 4NKGA 2WQVA 2P1NB 2OMZA 1H6TA 1H6UA 5GMGA 1P8VA 1M10B 4H09A 2Z65A 4PERA 1A9NA 3CIGA 2Z7XA 1ZIWA 4NKHA 1YRGA 2OMXA 2O6QA 2OMUA 2Z63A 4QC0A 4AY9X 1XCDA 4OQTA 4Z61C 4PEQB 3M19A 3RIZA 5LFNA 2BNHA 3SB4A 5AWDA 2WQXA 2Y5QA 1LTXA 5IJCA 1D0BA 2OMTA 4Z8GA 1PGVA 1M9LA 3OJAA 4BV4R 2FT3A 4LSAA 3P72A 3WPFA 2RA8A 3OGMB 4R5DA 3UN9A 2Z7XB 3ZYJA 4HQ1A 1FQVA 2Q4GW 4XGOA 1XEUA 2Z82A 2CA6A 3RW6A 1FO1A 1FS2A 3VQ1A 2IFGA 2V9TB 4L3AA 2O6SA 1XKUA 1KOOA 4L3FA 4ECOA 4R58A 1O6VA 4MQWX 5GQRK 2RR6A 4BSUA 5AWBA 4M7EC 4Q62A 1XECA 3G39A 3WPCA 1P9AG 3G06A 4FMZA 5HDHA 3ULVA 3W3GA 4C2AB 2XWTC 3WPIA 5HZLB 4R6JA 1U0ND 3G04C 3W3NA 3C6PB 2JE0A 4TZHA 4YEBB 4R6GA 3FXIA 5AWCA 4RCAB 4FCGA 1DCEA 4LSXC 2P1PB 1G9UA 1OGQA 1Z7XW 3REZA 3W3LA 1IO0A 5A5CA 1OTNA 1QYYA 4J0MA 5CMNA 3ULAA 4CNMA 5B4PA 3UL7A 3RGZA 3WPGA 4ARRA 3VQ2A 4IM6A 3RJ0A 2WQWA 1FT8A 3RGXA 4EZGA 4KXFB 3C6OB 4M7EA 4K17A 1W8AA 4R08A 1OTOA 4CC4C 3ZYNA 4XSQA 2JE1A 5IYXC 2WFHA 3CVRA 3E4GA 3WPEA 3CIYA 3WN4A 5GS0A 4LXSA 3RW7A 4LSCA 4RWTC 1XWDC 1DS9A 3WPBA 4PSJA 4Z94G 1KOHA 2ASSB 5B0TA 4LSXA 2O6RA 1M0ZA 2UZXA 3GOZA 4LI2A 1DFJI 2XOTA 4BSRA 4LI1A 3KJ4A 4I6JB 3RFSA 2P1MB 4R6FA 4WYKA 3E2JA 4R6AA 3C6NB 1P8TA 3OGLB 4Z64C 1OTMA 4U7LA 5IJDA 3O53A 5CMPA 4G8AA 1O6SA 1K5GC 2ELLA 3OJAB 4GT6A 3G3AA 2A0ZA 3BZ5A 4FDWA 4UFRA 4GLPA 3RFEA 5AZ5A 4P91A 3W3MA 4CC4A 4R5CA 4WP6A 4BSSA 2Z64A 4R07A 2UZYA 2Z81A 2ID5A 4FHOA 2OMWA 4QXEA 1OOKG 3E3ZA 4R0AA 4PKIG 2R9UA 3PMHG 4Z79A 3WPDA 4RCWA 2P1QB 4V2CA 4Q3GA 4P8SA 2OMYA 5IJBA 4Q3IA 5GMFA 4V2DA 3M18A 5AWAA 2ASTB 3UL8A 3OGKB 5GMHA 5FTTB 2JQDA 2BEXA 3ZYIA 3ZYOA 4CP6A 4KNGA 5GS2B 1SQ0B 2Z62A 1A4YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4R09 A;  4U08 A;  3RFJ A;  4Y61 B;  3G3B A;  1K5D C;  3UL9 A;  4U06 A;  2V70 A;  3ULU A;  4J4L A;  3DZE A;  4C2B B;  4XOS A;  4FD0 A;  3W3J A;  4PQ8 A;  4B8C D;  1OZN A;  3JB9 j;  1JL5 A;  1WWL A;  3O6N A;  2WQU A;  3A79 B;  4U09 A;  5B0N A;  2OMV A;  4CNC A;  3TSR E;  4CIL A;  4QBZ A;  1O6T A;  2Z66 A;  1M9S A;  4ECN A;  5D3I A;  2P1O B;  3W3K A;  4MN8 B;  4V2E A;  2V9S A;  4LXR A;  3E6J A;  4KT1 A;  4AW4 A;  4ARN A;  1GWB A;  3WPH A;  4FS7 A;  4NKG A;  2WQV A;  2P1N B;  2OMZ A;  1H6T A;  1H6U A;  5GMG A;  1P8V A;  1M10 B;  4H09 A;  2Z65 A;  4PER A;  1A9N A;  3CIG A;  2Z7X A;  1ZIW A;  4NKH A;  1YRG A;  2OMX A;  2O6Q A;  2OMU A;  2Z63 A;  4QC0 A;  4AY9 X;  1XCD A;  4OQT A;  4Z61 C;  4PEQ B;  3M19 A;  3RIZ A;  5LFN A;  2BNH A;  3SB4 A;  5AWD A;  2WQX A;  2Y5Q A;  1LTX A;  5IJC A;  1D0B A;  2OMT A;  4Z8G A;  1PGV A;  1M9L A;  3OJA A;  4BV4 R;  2FT3 A;  4LSA A;  3P72 A;  3WPF A;  2RA8 A;  3OGM B;  4R5D A;  3UN9 A;  2Z7X B;  3ZYJ A;  4HQ1 A;  1FQV A;  2Q4G W;  4XGO A;  1XEU A;  2Z82 A;  2CA6 A;  3RW6 A;  1FO1 A;  1FS2 A;  3VQ1 A;  2IFG A;  2V9T B;  4L3A A;  2O6S A;  1XKU A;  1KOO A;  4L3F A;  4ECO A;  4R58 A;  1O6V A;  4MQW X;  5GQR K;  2RR6 A;  4BSU A;  5AWB A;  4M7E C;  4Q62 A;  1XEC A;  3G39 A;  3WPC A;  1P9A G;  3G06 A;  4FMZ A;  5HDH A;  3ULV A;  3W3G A;  4C2A B;  2XWT C;  3WPI A;  5HZL B;  4R6J A;  1U0N D;  3G04 C;  3W3N A;  3C6P B;  2JE0 A;  4TZH A;  4YEB B;  4R6G A;  3FXI A;  5AWC A;  4RCA B;  4FCG A;  1DCE A;  4LSX C;  2P1P B;  1G9U A;  1OGQ A;  1Z7X W;  3REZ A;  3W3L A;  1IO0 A;  5A5C A;  1OTN A;  1QYY A;  4J0M A;  5CMN A;  3ULA A;  4CNM A;  5B4P A;  3UL7 A;  3RGZ A;  3WPG A;  4ARR A;  3VQ2 A;  4IM6 A;  3RJ0 A;  2WQW A;  1FT8 A;  3RGX A;  4EZG A;  4KXF B;  3C6O B;  4M7E A;  4K17 A;  1W8A A;  4R08 A;  1OTO A;  4CC4 C;  3ZYN A;  4XSQ A;  2JE1 A;  5IYX C;  2WFH A;  3CVR A;  3E4G A;  3WPE A;  3CIY A;  3WN4 A;  5GS0 A;  4LXS A;  3RW7 A;  4LSC A;  4RWT C;  1XWD C;  1DS9 A;  3WPB A;  4PSJ A;  4Z94 G;  1KOH A;  2ASS B;  5B0T A;  4LSX A;  2O6R A;  1M0Z A;  2UZX A;  3GOZ A;  4LI2 A;  1DFJ I;  2XOT A;  4BSR A;  4LI1 A;  3KJ4 A;  4I6J B;  3RFS A;  2P1M B;  4R6F A;  4WYK A;  3E2J A;  4R6A A;  3C6N B;  1P8T A;  3OGL B;  4Z64 C;  1OTM A;  4U7L A;  5IJD A;  3O53 A;  5CMP A;  4G8A A;  1O6S A;  1K5G C;  2ELL A;  3OJA B;  4GT6 A;  3G3A A;  2A0Z A;  3BZ5 A;  4FDW A;  4UFR A;  4GLP A;  3RFE A;  5AZ5 A;  4P91 A;  3W3M A;  4CC4 A;  4R5C A;  4WP6 A;  4BSS A;  2Z64 A;  4R07 A;  2UZY A;  2Z81 A;  2ID5 A;  4FHO A;  2OMW A;  4QXE A;  1OOK G;  3E3Z A;  4R0A A;  4PKI G;  2R9U A;  3PMH G;  4Z79 A;  3WPD A;  4RCW A;  2P1Q B;  4V2C A;  4Q3G A;  4P8S A;  2OMY A;  5IJB A;  4Q3I A;  5GMF A;  4V2D A;  3M18 A;  5AWA A;  2AST B;  3UL8 A;  3OGK B;  5GMH A;  5FTT B;  2JQD A;  2BEX A;  3ZYI A;  3ZYO A;  4CP6 A;  4KNG A;  5GS2 B;  1SQ0 B;  2Z62 A;  1A4Y A; 
#chains in the Genus database with same CATH topology
 4R09 A;  4U08 A;  3RFJ A;  4Y61 B;  3G3B A;  1K5D C;  3UL9 A;  4U06 A;  2V70 A;  3ULU A;  4J4L A;  3DZE A;  4C2B B;  4XOS A;  4FD0 A;  3W3J A;  4PQ8 A;  4B8C D;  1OZN A;  3JB9 j;  1JL5 A;  1WWL A;  3O6N A;  2WQU A;  3A79 B;  4U09 A;  5B0N A;  2OMV A;  4CNC A;  3TSR E;  4CIL A;  4QBZ A;  1O6T A;  2Z66 A;  1M9S A;  4ECN A;  5D3I A;  2P1O B;  3W3K A;  4MN8 B;  4V2E A;  2V9S A;  4LXR A;  3E6J A;  4KT1 A;  4AW4 A;  4ARN A;  1GWB A;  3WPH A;  4FS7 A;  4NKG A;  2WQV A;  2P1N B;  2OMZ A;  1H6T A;  1H6U A;  5GMG A;  1P8V A;  1M10 B;  4H09 A;  2Z65 A;  4PER A;  1A9N A;  3CIG A;  2Z7X A;  1ZIW A;  4NKH A;  1YRG A;  2OMX A;  2O6Q A;  2OMU A;  4NZR M;  2Z63 A;  4QC0 A;  4AY9 X;  1XCD A;  4OQT A;  4Z61 C;  4PEQ B;  3M19 A;  3RIZ A;  5LFN A;  2BNH A;  3SB4 A;  5AWD A;  2WQX A;  2Y5Q A;  1LTX A;  5IJC A;  1D0B A;  2OMT A;  4Z8G A;  1PGV A;  1M9L A;  3OJA A;  4BV4 R;  2FT3 A;  4LSA A;  3P72 A;  3WPF A;  2RA8 A;  3OGM B;  4R5D A;  3UN9 A;  2Z7X B;  3ZYJ A;  4HQ1 A;  1FQV A;  2Q4G W;  4XGO A;  1XEU A;  2Z82 A;  2CA6 A;  3RW6 A;  1FO1 A;  1FS2 A;  3VQ1 A;  2IFG A;  2V9T B;  4L3A A;  2O6S A;  1XKU A;  1KOO A;  4L3F A;  4ECO A;  4R58 A;  1O6V A;  4MQW X;  5GQR K;  2RR6 A;  4BSU A;  5AWB A;  4M7E C;  4Q62 A;  1XEC A;  3G39 A;  3WPC A;  1P9A G;  3G06 A;  4FMZ A;  5HDH A;  3ULV A;  3W3G A;  4C2A B;  2XWT C;  3WPI A;  5HZL B;  4R6J A;  1U0N D;  3G04 C;  3W3N A;  3C6P B;  2JE0 A;  4TZH A;  4YEB B;  4R6G A;  3FXI A;  5AWC A;  4RCA B;  4FCG A;  1DCE A;  4LSX C;  2P1P B;  1G9U A;  1OGQ A;  1Z7X W;  3REZ A;  3W3L A;  1IO0 A;  5A5C A;  1OTN A;  1QYY A;  4J0M A;  5CMN A;  3ULA A;  4CNM A;  5B4P A;  3UL7 A;  3RGZ A;  3WPG A;  4ARR A;  3VQ2 A;  4IM6 A;  3RJ0 A;  2WQW A;  1FT8 A;  3RGX A;  4EZG A;  4KXF B;  3C6O B;  4M7E A;  4K17 A;  1W8A A;  4R08 A;  1OTO A;  4CC4 C;  3ZYN A;  4XSQ A;  2JE1 A;  5IYX C;  2WFH A;  3CVR A;  3E4G A;  3WPE A;  3CIY A;  3WN4 A;  5GS0 A;  4LXS A;  3RW7 A;  4LSC A;  4RWT C;  1XWD C;  1DS9 A;  3WPB A;  4PSJ A;  4Z94 G;  1KOH A;  2ASS B;  5B0T A;  4LSX A;  2O6R A;  1M0Z A;  2UZX A;  3GOZ A;  4LI2 A;  1DFJ I;  2XOT A;  4BSR A;  4LI1 A;  3KJ4 A;  4I6J B;  3RFS A;  2P1M B;  4R6F A;  4WYK A;  3E2J A;  4R6A A;  3C6N B;  1P8T A;  3OGL B;  4Z64 C;  1OTM A;  4U7L A;  5IJD A;  3O53 A;  5CMP A;  4G8A A;  1O6S A;  1K5G C;  2ELL A;  3OJA B;  4GT6 A;  3G3A A;  2A0Z A;  3BZ5 A;  4FDW A;  4NZT M;  4GLP A;  4UFR A;  3RFE A;  5AZ5 A;  4P91 A;  3W3M A;  4CC4 A;  4R5C A;  4WP6 A;  4BSS A;  2Z64 A;  4R07 A;  2UZY A;  2Z81 A;  2ID5 A;  4FHO A;  2OMW A;  4QXE A;  1OOK G;  3E3Z A;  4R0A A;  4PKI G;  2R9U A;  3PMH G;  4Z79 A;  3WPD A;  4RCW A;  2P1Q B;  4V2C A;  4Q3G A;  4P8S A;  2OMY A;  5IJB A;  4Q3I A;  5GMF A;  4V2D A;  3M18 A;  5AWA A;  2AST B;  3UL8 A;  3OGK B;  5GMH A;  5FTT B;  2JQD A;  2BEX A;  3ZYI A;  3ZYO A;  4CP6 A;  4KNG A;  5GS2 B;  1SQ0 B;  2Z62 A;  1A4Y A; 
#chains in the Genus database with same CATH homology
 4R09 A;  4U08 A;  3RFJ A;  4Y61 B;  3G3B A;  1K5D C;  3UL9 A;  4U06 A;  2V70 A;  3ULU A;  4J4L A;  3DZE A;  4C2B B;  4XOS A;  4FD0 A;  3W3J A;  4PQ8 A;  4B8C D;  1OZN A;  3JB9 j;  1JL5 A;  1WWL A;  3O6N A;  2WQU A;  3A79 B;  4U09 A;  5B0N A;  2OMV A;  4CNC A;  3TSR E;  4CIL A;  4QBZ A;  1O6T A;  2Z66 A;  1M9S A;  4ECN A;  5D3I A;  2P1O B;  3W3K A;  4MN8 B;  4V2E A;  2V9S A;  4LXR A;  3E6J A;  4KT1 A;  4AW4 A;  4ARN A;  1GWB A;  3WPH A;  4FS7 A;  4NKG A;  2WQV A;  2P1N B;  2OMZ A;  1H6T A;  1H6U A;  5GMG A;  1P8V A;  1M10 B;  4H09 A;  2Z65 A;  4PER A;  1A9N A;  3CIG A;  2Z7X A;  1ZIW A;  4NKH A;  1YRG A;  2OMX A;  2O6Q A;  2OMU A;  2Z63 A;  4QC0 A;  4AY9 X;  1XCD A;  4OQT A;  4Z61 C;  4PEQ B;  3M19 A;  3RIZ A;  5LFN A;  2BNH A;  3SB4 A;  5AWD A;  2WQX A;  2Y5Q A;  1LTX A;  5IJC A;  1D0B A;  2OMT A;  4Z8G A;  1PGV A;  1M9L A;  3OJA A;  4BV4 R;  2FT3 A;  4LSA A;  3P72 A;  3WPF A;  2RA8 A;  3OGM B;  4R5D A;  3UN9 A;  2Z7X B;  3ZYJ A;  4HQ1 A;  1FQV A;  2Q4G W;  4XGO A;  1XEU A;  2Z82 A;  2CA6 A;  3RW6 A;  1FO1 A;  1FS2 A;  3VQ1 A;  2IFG A;  2V9T B;  4L3A A;  2O6S A;  1XKU A;  1KOO A;  4L3F A;  4ECO A;  4R58 A;  1O6V A;  4MQW X;  5GQR K;  2RR6 A;  4BSU A;  5AWB A;  4M7E C;  4Q62 A;  1XEC A;  3G39 A;  3WPC A;  1P9A G;  3G06 A;  4FMZ A;  5HDH A;  3ULV A;  3W3G A;  4C2A B;  2XWT C;  3WPI A;  5HZL B;  4R6J A;  1U0N D;  3G04 C;  3W3N A;  3C6P B;  2JE0 A;  4TZH A;  4YEB B;  4R6G A;  3FXI A;  5AWC A;  4RCA B;  4FCG A;  1DCE A;  4LSX C;  2P1P B;  1G9U A;  1OGQ A;  1Z7X W;  3REZ A;  3W3L A;  1IO0 A;  5A5C A;  1OTN A;  1QYY A;  4J0M A;  5CMN A;  3ULA A;  4CNM A;  5B4P A;  3UL7 A;  3RGZ A;  3WPG A;  4ARR A;  3VQ2 A;  4IM6 A;  3RJ0 A;  2WQW A;  1FT8 A;  3RGX A;  4EZG A;  4KXF B;  3C6O B;  4M7E A;  4K17 A;  1W8A A;  4R08 A;  1OTO A;  4CC4 C;  3ZYN A;  4XSQ A;  2JE1 A;  5IYX C;  2WFH A;  3CVR A;  3E4G A;  3WPE A;  3CIY A;  3WN4 A;  5GS0 A;  4LXS A;  3RW7 A;  4LSC A;  4RWT C;  1XWD C;  1DS9 A;  3WPB A;  4PSJ A;  4Z94 G;  1KOH A;  2ASS B;  5B0T A;  4LSX A;  2O6R A;  1M0Z A;  2UZX A;  3GOZ A;  4LI2 A;  1DFJ I;  2XOT A;  4BSR A;  4LI1 A;  3KJ4 A;  4I6J B;  3RFS A;  2P1M B;  4R6F A;  4WYK A;  3E2J A;  4R6A A;  3C6N B;  1P8T A;  3OGL B;  4Z64 C;  1OTM A;  4U7L A;  5IJD A;  3O53 A;  5CMP A;  4G8A A;  1O6S A;  1K5G C;  2ELL A;  3OJA B;  4GT6 A;  3G3A A;  2A0Z A;  3BZ5 A;  4FDW A;  4UFR A;  4GLP A;  3RFE A;  5AZ5 A;  4P91 A;  3W3M A;  4CC4 A;  4R5C A;  4WP6 A;  4BSS A;  2Z64 A;  4R07 A;  2UZY A;  2Z81 A;  2ID5 A;  4FHO A;  2OMW A;  4QXE A;  1OOK G;  3E3Z A;  4R0A A;  4PKI G;  2R9U A;  3PMH G;  4Z79 A;  3WPD A;  4RCW A;  2P1Q B;  4V2C A;  4Q3G A;  4P8S A;  2OMY A;  5IJB A;  4Q3I A;  5GMF A;  4V2D A;  3M18 A;  5AWA A;  2AST B;  3UL8 A;  3OGK B;  5GMH A;  5FTT B;  2JQD A;  2BEX A;  3ZYI A;  3ZYO A;  4CP6 A;  4KNG A;  5GS2 B;  1SQ0 B;  2Z62 A;  1A4Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...