4C2AB

Crystal structure of high-affinity von willebrand factor a1 domain with r1306q and i1309v mutations in complex with high affinity gpib alpha
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
266
structure length
266
Chain Sequence
HPICEVSKVASHLEVNCDKRRLTALPPDLPKDTTILHLSENLLYTFSLATLMPYTRLTQLNLDRCELTKLQVDGTLPVLGTLDLSHNQLQSLPLLGQTLPALTVLDVSFNRLTSLPLGALRGLGELQELYLKGNELKTLPPGLLTPTPKLEKLSLANNRLTELPAGLLNGLENLDTLLLQENSLYTIPKGFFGSHLLPFAFLHGNPWLCNCEILYFRRWLQDNAENVYVWKQVVDVKAVTSNVASVQCDNSDKFPVYKYPGKGCPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Blood clotting
molecule keywords VON WILLEBRAND FACTOR
publication title Towards the Structural Basis of Regulation of Von Willebrand Factor Binding to Glycoprotein Ib
pubmed doi rcsb
source organism Homo sapiens
total genus 72
structure length 266
sequence length 266
ec nomenclature
pdb deposition date 2013-08-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01462 LRRNT Leucine rich repeat N-terminal domain
B PF13855 LRR_8 Leucine rich repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 4c2aB00
1YRGA 2WQXA 1U0ND 3M19A 2Y5QA 3UL9A 2A0ZA 4IM6A 4Z79A 4V2DA 1W8AA 3WPEA 4FHOA 4ECOA 4BV4R 1OTNA 3ULUA 3RIZA 3OJAA 1DFJI 5IJDA 3RGXA 2BNHA 3OGKB 3UL8A 3TSRE 1O6VA 3GOZA 1FQVA 3ZYNA 1A4YA 4H09A 1PGVA 3W3NA 1K5DC 1XKUA 2OMVA 3OGMB 3UN9A 2P1QB 3REZA 3WPGA 1M10B 1M9LA 2JE0A 2WQWA 3ZYIA 1XECA 3BZ5A 4LI1A 4LSXA 4QBZA 4CNMA 3WPCA 5B0NA 1K5GC 3RFJA 5GMFA 3M18A 2P1OB 1XEUA 1OZNA 1DCEA 4Z61C 1FO1A 2Z64A 5AWBA 2R9UA 2Z65A 2Z63A 4WYKA 2OMUA 4LSCA 1WWLA 2RR6A 4Y61B 4BSRA 3CVRA 4L3AA 4LSXC 4P91A 4U7LA 4ARRA 2RA8A 4NKGA 2UZYA 4U08A 2OMTA 3KJ4A 5FTTB 4Q3GA 2Z7XB 3WPDA 4L3FA 5CMNA 4QXEA 5A5CA 3E3ZA 2P1PB 5LFNA 4BSUA 3E6JA 5HZLB 3WPHA 5GMHA 5IJCA 1QYYA 4XOSA 4GLPA 1KOHA 1D0BA 4PSJA 3RGZA 4Z8GA 1O6TA 4R58A 4RCWA 4M7EC 3W3MA 5B0TA 3DZEA 3VQ1A 2JE1A 4FD0A 4R6GA 2OMWA 4Z64C 2OMXA 5AZ5A 3UL7A 1DS9A 3FXIA 3W3JA 4KT1A 2O6QA 3RJ0A 4J4LA 5AWDA 5AWAA 1P9AG 2IFGA 1OGQA 4U06A 3G06A 4V2CA 3JB9j 3CIGA 3RW6A 3PMHG 3W3LA 2BEXA 1H6UA 4PKIG 1XCDA 3WPFA 3O53A 3ULVA 2Z7XA 4J0MA 5IYXC 1XWDC 1OTOA 2ID5A 4B8CD 5GMGA 4AW4A 3O6NA 2ELLA 3W3GA 4Z94G 3OGLB 4LSAA 4CP6A 5CMPA 1JL5A 4ARNA 5GS2B 3RFSA 2Z66A 3C6NB 1GWBA 4CILA 2V70A 5B4PA 4KXFB 4HQ1A 3VQ2A 4R09A 4M7EA 2XWTC 3ZYJA 4PEQB 4U09A 1SQ0B 3G39A 3RFEA 4CC4A 4R07A 1P8VA 2O6RA 5D3IA 3CIYA 4V2EA 3WN4A 3G3BA 4FDWA 4QC0A 4AY9X 2WQVA 1KOOA 4PQ8A 4XSQA 5HDHA 4LXRA 2CA6A 4C2BB 4G8AA 3ULAA 1A9NA 4BSSA 2V9TB 4R0AA 4K17A 1ZIWA 4XGOA 3C6PB 4CC4C 1M0ZA 2Q4GW 3G04C 4R6AA 4WP6A 4YEBB 1FT8A 4Q3IA 3SB4A 4MQWX 1LTXA 3OJAB 1H6TA 4GT6A 2ASSB 2P1MB 2Z82A 2WQUA 4PERA 4EZGA 4UFRA 2FT3A 2O6SA 4LI2A 4FMZA 4R5DA 4RWTC 3ZYOA 5IJBA 4P8SA 1G9UA 1IO0A 2JQDA 4RCAB 3C6OB 3WPBA 4TZHA 4CNCA 3RW7A 4R6FA 1OOKG 4FS7A 1OTMA 4OQTA 3W3KA 3WPIA 3G3AA 4LXSA 2ASTB 1M9SA 2Z62A 4R6JA 4NKHA 3E4GA 2OMZA 2XOTA 5GQRK 5AWCA 4FCGA 2WFHA 4C2AB 2UZXA 4KNGA 1FS2A 1Z7XW 1P8TA 2Z81A 3P72A 3E2JA 4I6JB 4R5CA 4ECNA 2P1NB 4R08A 3A79B 2V9SA 4MN8B 2OMYA 1O6SA 4Q62A 5GS0A
chains in the Genus database with same CATH superfamily
1YRGA 2WQXA 1U0ND 3M19A 2Y5QA 3UL9A 2A0ZA 4IM6A 4Z79A 4V2DA 1W8AA 3WPEA 4FHOA 4ECOA 4BV4R 1OTNA 3ULUA 3RIZA 3OJAA 1DFJI 5IJDA 3RGXA 2BNHA 3OGKB 3UL8A 4NZTM 3TSRE 1O6VA 3GOZA 1FQVA 3ZYNA 1A4YA 4H09A 1PGVA 3W3NA 1K5DC 1XKUA 2OMVA 3OGMB 3UN9A 2P1QB 3REZA 3WPGA 1M10B 1M9LA 2JE0A 2WQWA 3ZYIA 1XECA 3BZ5A 4LI1A 4LSXA 4QBZA 4CNMA 3WPCA 5B0NA 1K5GC 3RFJA 5GMFA 3M18A 2P1OB 1XEUA 1OZNA 1DCEA 4Z61C 1FO1A 2Z64A 5AWBA 2R9UA 2Z65A 2Z63A 4WYKA 2OMUA 4LSCA 1WWLA 2RR6A 4Y61B 4BSRA 3CVRA 4L3AA 4LSXC 4P91A 4U7LA 4ARRA 2RA8A 4NKGA 2UZYA 4U08A 2OMTA 3KJ4A 5FTTB 4Q3GA 2Z7XB 3WPDA 4L3FA 5CMNA 4QXEA 5A5CA 3E3ZA 2P1PB 5LFNA 4BSUA 3E6JA 5HZLB 3WPHA 5GMHA 5IJCA 1QYYA 4XOSA 4GLPA 1KOHA 1D0BA 4PSJA 3RGZA 4Z8GA 1O6TA 4R58A 4RCWA 4M7EC 3W3MA 5B0TA 3DZEA 3VQ1A 2JE1A 4FD0A 4R6GA 2OMWA 4Z64C 2OMXA 5AZ5A 3UL7A 1DS9A 3FXIA 3W3JA 4KT1A 2O6QA 3RJ0A 4J4LA 5AWDA 5AWAA 1P9AG 2IFGA 1OGQA 4U06A 3G06A 4V2CA 3JB9j 3CIGA 3RW6A 3PMHG 3W3LA 2BEXA 1H6UA 4PKIG 1XCDA 4NZRM 3WPFA 3O53A 3ULVA 2Z7XA 4J0MA 5IYXC 1XWDC 1OTOA 2ID5A 4B8CD 5GMGA 4AW4A 3O6NA 2ELLA 3W3GA 4Z94G 3OGLB 4LSAA 4CP6A 5CMPA 1JL5A 4ARNA 5GS2B 3RFSA 2Z66A 3C6NB 1GWBA 4CILA 2V70A 5B4PA 4KXFB 4HQ1A 3VQ2A 4R09A 4M7EA 2XWTC 3ZYJA 4PEQB 4U09A 1SQ0B 3G39A 3RFEA 4CC4A 4R07A 1P8VA 2O6RA 5D3IA 3CIYA 4V2EA 3WN4A 3G3BA 4FDWA 4QC0A 4AY9X 2WQVA 1KOOA 4PQ8A 4XSQA 5HDHA 4LXRA 2CA6A 4C2BB 4G8AA 3ULAA 1A9NA 4BSSA 2V9TB 4R0AA 4K17A 1ZIWA 4XGOA 3C6PB 4CC4C 1M0ZA 2Q4GW 3G04C 4R6AA 4WP6A 4YEBB 1FT8A 4Q3IA 3SB4A 4MQWX 1LTXA 3OJAB 1H6TA 4GT6A 2ASSB 2P1MB 2Z82A 2WQUA 4PERA 4EZGA 4UFRA 2FT3A 2O6SA 4LI2A 4FMZA 4R5DA 4RWTC 3ZYOA 5IJBA 4P8SA 1G9UA 1IO0A 2JQDA 4RCAB 3C6OB 3WPBA 4TZHA 4CNCA 3RW7A 4R6FA 1OOKG 4FS7A 1OTMA 4OQTA 3W3KA 3WPIA 3G3AA 4LXSA 2ASTB 1M9SA 2Z62A 4R6JA 4NKHA 3E4GA 2OMZA 2XOTA 5GQRK 5AWCA 4FCGA 2WFHA 4C2AB 2UZXA 4KNGA 1FS2A 1Z7XW 1P8TA 2Z81A 3P72A 3E2JA 4I6JB 4R5CA 4ECNA 2P1NB 4R08A 3A79B 2V9SA 4MN8B 2OMYA 1O6SA 4Q62A 5GS0A
chains in the Genus database with same CATH topology
1YRGA 2WQXA 1U0ND 3M19A 2Y5QA 3UL9A 2A0ZA 4IM6A 4Z79A 4V2DA 1W8AA 3WPEA 4FHOA 4ECOA 4BV4R 1OTNA 3ULUA 3RIZA 3OJAA 1DFJI 5IJDA 3RGXA 2BNHA 3OGKB 3UL8A 3TSRE 1O6VA 3GOZA 1FQVA 3ZYNA 1A4YA 4H09A 1PGVA 3W3NA 1K5DC 1XKUA 2OMVA 3OGMB 3UN9A 2P1QB 3REZA 3WPGA 1M10B 1M9LA 2JE0A 2WQWA 3ZYIA 1XECA 3BZ5A 4LI1A 4LSXA 4QBZA 4CNMA 3WPCA 5B0NA 1K5GC 3RFJA 5GMFA 3M18A 2P1OB 1XEUA 1OZNA 1DCEA 4Z61C 1FO1A 2Z64A 5AWBA 2R9UA 2Z65A 2Z63A 4WYKA 2OMUA 4LSCA 1WWLA 2RR6A 4Y61B 4BSRA 3CVRA 4L3AA 4LSXC 4P91A 4U7LA 4ARRA 2RA8A 4NKGA 2UZYA 4U08A 2OMTA 3KJ4A 5FTTB 4Q3GA 2Z7XB 3WPDA 4L3FA 5CMNA 4QXEA 5A5CA 3E3ZA 2P1PB 5LFNA 4BSUA 3E6JA 5HZLB 3WPHA 5GMHA 5IJCA 1QYYA 4XOSA 4GLPA 1KOHA 1D0BA 4PSJA 3RGZA 4Z8GA 1O6TA 4R58A 4RCWA 4M7EC 3W3MA 5B0TA 3DZEA 3VQ1A 2JE1A 4FD0A 4R6GA 2OMWA 4Z64C 2OMXA 5AZ5A 3UL7A 1DS9A 3FXIA 3W3JA 4KT1A 2O6QA 3RJ0A 4J4LA 5AWDA 5AWAA 1P9AG 2IFGA 1OGQA 4U06A 3G06A 4V2CA 3JB9j 3CIGA 3RW6A 3PMHG 3W3LA 2BEXA 1H6UA 4PKIG 1XCDA 3WPFA 3O53A 3ULVA 2Z7XA 4J0MA 5IYXC 1XWDC 1OTOA 2ID5A 4B8CD 5GMGA 4AW4A 3O6NA 2ELLA 3W3GA 4Z94G 3OGLB 4LSAA 4CP6A 5CMPA 1JL5A 4ARNA 5GS2B 3RFSA 2Z66A 3C6NB 1GWBA 4CILA 2V70A 5B4PA 4KXFB 4HQ1A 3VQ2A 4R09A 4M7EA 2XWTC 3ZYJA 4PEQB 4U09A 1SQ0B 3G39A 3RFEA 4CC4A 4R07A 1P8VA 2O6RA 5D3IA 3CIYA 4V2EA 3WN4A 3G3BA 4FDWA 4QC0A 4AY9X 2WQVA 1KOOA 4PQ8A 4XSQA 5HDHA 4LXRA 2CA6A 4C2BB 4G8AA 3ULAA 1A9NA 4BSSA 2V9TB 4R0AA 4K17A 1ZIWA 4XGOA 3C6PB 4CC4C 1M0ZA 2Q4GW 3G04C 4R6AA 4WP6A 4YEBB 1FT8A 4Q3IA 3SB4A 4MQWX 1LTXA 3OJAB 1H6TA 4GT6A 2ASSB 2P1MB 2Z82A 2WQUA 4PERA 4EZGA 4UFRA 2FT3A 2O6SA 4LI2A 4FMZA 4R5DA 4RWTC 3ZYOA 5IJBA 4P8SA 1G9UA 1IO0A 2JQDA 4RCAB 3C6OB 3WPBA 4TZHA 4CNCA 3RW7A 4R6FA 1OOKG 4FS7A 1OTMA 4OQTA 3W3KA 3WPIA 3G3AA 4LXSA 2ASTB 1M9SA 2Z62A 4R6JA 4NKHA 3E4GA 2OMZA 2XOTA 5GQRK 5AWCA 4FCGA 2WFHA 4C2AB 2UZXA 4KNGA 1FS2A 1Z7XW 1P8TA 2Z81A 3P72A 3E2JA 4I6JB 4R5CA 4ECNA 2P1NB 4R08A 3A79B 2V9SA 4MN8B 2OMYA 1O6SA 4Q62A 5GS0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YRG A;  2WQX A;  1U0N D;  3M19 A;  2Y5Q A;  3UL9 A;  2A0Z A;  4IM6 A;  4Z79 A;  4V2D A;  1W8A A;  3WPE A;  4FHO A;  4ECO A;  4BV4 R;  1OTN A;  3ULU A;  3RIZ A;  3OJA A;  1DFJ I;  5IJD A;  3RGX A;  2BNH A;  3OGK B;  3UL8 A;  3TSR E;  1O6V A;  3GOZ A;  1FQV A;  3ZYN A;  1A4Y A;  4H09 A;  1PGV A;  3W3N A;  1K5D C;  1XKU A;  2OMV A;  3OGM B;  3UN9 A;  2P1Q B;  3REZ A;  3WPG A;  1M10 B;  1M9L A;  2JE0 A;  2WQW A;  3ZYI A;  1XEC A;  3BZ5 A;  4LI1 A;  4LSX A;  4QBZ A;  4CNM A;  3WPC A;  5B0N A;  1K5G C;  3RFJ A;  5GMF A;  3M18 A;  2P1O B;  1XEU A;  1OZN A;  1DCE A;  4Z61 C;  1FO1 A;  2Z64 A;  5AWB A;  2R9U A;  2Z65 A;  2Z63 A;  4WYK A;  2OMU A;  4LSC A;  1WWL A;  2RR6 A;  4Y61 B;  4BSR A;  3CVR A;  4L3A A;  4LSX C;  4P91 A;  4U7L A;  4ARR A;  2RA8 A;  4NKG A;  2UZY A;  4U08 A;  2OMT A;  3KJ4 A;  5FTT B;  4Q3G A;  2Z7X B;  3WPD A;  4L3F A;  5CMN A;  4QXE A;  5A5C A;  3E3Z A;  2P1P B;  5LFN A;  4BSU A;  3E6J A;  5HZL B;  3WPH A;  5GMH A;  5IJC A;  1QYY A;  4XOS A;  4GLP A;  1KOH A;  1D0B A;  4PSJ A;  3RGZ A;  4Z8G A;  1O6T A;  4R58 A;  4RCW A;  4M7E C;  3W3M A;  5B0T A;  3DZE A;  3VQ1 A;  2JE1 A;  4FD0 A;  4R6G A;  2OMW A;  4Z64 C;  2OMX A;  5AZ5 A;  3UL7 A;  1DS9 A;  3FXI A;  3W3J A;  4KT1 A;  2O6Q A;  3RJ0 A;  4J4L A;  5AWD A;  5AWA A;  1P9A G;  2IFG A;  1OGQ A;  4U06 A;  3G06 A;  4V2C A;  3JB9 j;  3CIG A;  3RW6 A;  3PMH G;  3W3L A;  2BEX A;  1H6U A;  4PKI G;  1XCD A;  3WPF A;  3O53 A;  3ULV A;  2Z7X A;  4J0M A;  5IYX C;  1XWD C;  1OTO A;  2ID5 A;  4B8C D;  5GMG A;  4AW4 A;  3O6N A;  2ELL A;  3W3G A;  4Z94 G;  3OGL B;  4LSA A;  4CP6 A;  5CMP A;  1JL5 A;  4ARN A;  5GS2 B;  3RFS A;  2Z66 A;  3C6N B;  1GWB A;  4CIL A;  2V70 A;  5B4P A;  4KXF B;  4HQ1 A;  3VQ2 A;  4R09 A;  4M7E A;  2XWT C;  3ZYJ A;  4PEQ B;  4U09 A;  1SQ0 B;  3G39 A;  3RFE A;  4CC4 A;  4R07 A;  1P8V A;  2O6R A;  5D3I A;  3CIY A;  4V2E A;  3WN4 A;  3G3B A;  4FDW A;  4QC0 A;  4AY9 X;  2WQV A;  1KOO A;  4PQ8 A;  4XSQ A;  5HDH A;  4LXR A;  2CA6 A;  4C2B B;  4G8A A;  3ULA A;  1A9N A;  4BSS A;  2V9T B;  4R0A A;  4K17 A;  1ZIW A;  4XGO A;  3C6P B;  4CC4 C;  1M0Z A;  2Q4G W;  3G04 C;  4R6A A;  4WP6 A;  4YEB B;  1FT8 A;  4Q3I A;  3SB4 A;  4MQW X;  1LTX A;  3OJA B;  1H6T A;  4GT6 A;  2ASS B;  2P1M B;  2Z82 A;  2WQU A;  4PER A;  4EZG A;  4UFR A;  2FT3 A;  2O6S A;  4LI2 A;  4FMZ A;  4R5D A;  4RWT C;  3ZYO A;  5IJB A;  4P8S A;  1G9U A;  1IO0 A;  2JQD A;  4RCA B;  3C6O B;  3WPB A;  4TZH A;  4CNC A;  3RW7 A;  4R6F A;  1OOK G;  4FS7 A;  1OTM A;  4OQT A;  3W3K A;  3WPI A;  3G3A A;  4LXS A;  2AST B;  1M9S A;  2Z62 A;  4R6J A;  4NKH A;  3E4G A;  2OMZ A;  2XOT A;  5GQR K;  5AWC A;  4FCG A;  2WFH A;  4C2A B;  2UZX A;  4KNG A;  1FS2 A;  1Z7X W;  1P8T A;  2Z81 A;  3P72 A;  3E2J A;  4I6J B;  4R5C A;  4ECN A;  2P1N B;  4R08 A;  3A79 B;  2V9S A;  4MN8 B;  2OMY A;  1O6S A;  4Q62 A;  5GS0 A; 
#chains in the Genus database with same CATH topology
 1YRG A;  2WQX A;  1U0N D;  3M19 A;  2Y5Q A;  3UL9 A;  2A0Z A;  4IM6 A;  4Z79 A;  4V2D A;  1W8A A;  3WPE A;  4FHO A;  4ECO A;  4BV4 R;  1OTN A;  3ULU A;  3RIZ A;  3OJA A;  1DFJ I;  5IJD A;  3RGX A;  2BNH A;  3OGK B;  3UL8 A;  4NZT M;  3TSR E;  1O6V A;  3GOZ A;  1FQV A;  3ZYN A;  1A4Y A;  4H09 A;  1PGV A;  3W3N A;  1K5D C;  1XKU A;  2OMV A;  3OGM B;  3UN9 A;  2P1Q B;  3REZ A;  3WPG A;  1M10 B;  1M9L A;  2JE0 A;  2WQW A;  3ZYI A;  1XEC A;  3BZ5 A;  4LI1 A;  4LSX A;  4QBZ A;  4CNM A;  3WPC A;  5B0N A;  1K5G C;  3RFJ A;  5GMF A;  3M18 A;  2P1O B;  1XEU A;  1OZN A;  1DCE A;  4Z61 C;  1FO1 A;  2Z64 A;  5AWB A;  2R9U A;  2Z65 A;  2Z63 A;  4WYK A;  2OMU A;  4LSC A;  1WWL A;  2RR6 A;  4Y61 B;  4BSR A;  3CVR A;  4L3A A;  4LSX C;  4P91 A;  4U7L A;  4ARR A;  2RA8 A;  4NKG A;  2UZY A;  4U08 A;  2OMT A;  3KJ4 A;  5FTT B;  4Q3G A;  2Z7X B;  3WPD A;  4L3F A;  5CMN A;  4QXE A;  5A5C A;  3E3Z A;  2P1P B;  5LFN A;  4BSU A;  3E6J A;  5HZL B;  3WPH A;  5GMH A;  5IJC A;  1QYY A;  4XOS A;  4GLP A;  1KOH A;  1D0B A;  4PSJ A;  3RGZ A;  4Z8G A;  1O6T A;  4R58 A;  4RCW A;  4M7E C;  3W3M A;  5B0T A;  3DZE A;  3VQ1 A;  2JE1 A;  4FD0 A;  4R6G A;  2OMW A;  4Z64 C;  2OMX A;  5AZ5 A;  3UL7 A;  1DS9 A;  3FXI A;  3W3J A;  4KT1 A;  2O6Q A;  3RJ0 A;  4J4L A;  5AWD A;  5AWA A;  1P9A G;  2IFG A;  1OGQ A;  4U06 A;  3G06 A;  4V2C A;  3JB9 j;  3CIG A;  3RW6 A;  3PMH G;  3W3L A;  2BEX A;  1H6U A;  4PKI G;  1XCD A;  4NZR M;  3WPF A;  3O53 A;  3ULV A;  2Z7X A;  4J0M A;  5IYX C;  1XWD C;  1OTO A;  2ID5 A;  4B8C D;  5GMG A;  4AW4 A;  3O6N A;  2ELL A;  3W3G A;  4Z94 G;  3OGL B;  4LSA A;  4CP6 A;  5CMP A;  1JL5 A;  4ARN A;  5GS2 B;  3RFS A;  2Z66 A;  3C6N B;  1GWB A;  4CIL A;  2V70 A;  5B4P A;  4KXF B;  4HQ1 A;  3VQ2 A;  4R09 A;  4M7E A;  2XWT C;  3ZYJ A;  4PEQ B;  4U09 A;  1SQ0 B;  3G39 A;  3RFE A;  4CC4 A;  4R07 A;  1P8V A;  2O6R A;  5D3I A;  3CIY A;  4V2E A;  3WN4 A;  3G3B A;  4FDW A;  4QC0 A;  4AY9 X;  2WQV A;  1KOO A;  4PQ8 A;  4XSQ A;  5HDH A;  4LXR A;  2CA6 A;  4C2B B;  4G8A A;  3ULA A;  1A9N A;  4BSS A;  2V9T B;  4R0A A;  4K17 A;  1ZIW A;  4XGO A;  3C6P B;  4CC4 C;  1M0Z A;  2Q4G W;  3G04 C;  4R6A A;  4WP6 A;  4YEB B;  1FT8 A;  4Q3I A;  3SB4 A;  4MQW X;  1LTX A;  3OJA B;  1H6T A;  4GT6 A;  2ASS B;  2P1M B;  2Z82 A;  2WQU A;  4PER A;  4EZG A;  4UFR A;  2FT3 A;  2O6S A;  4LI2 A;  4FMZ A;  4R5D A;  4RWT C;  3ZYO A;  5IJB A;  4P8S A;  1G9U A;  1IO0 A;  2JQD A;  4RCA B;  3C6O B;  3WPB A;  4TZH A;  4CNC A;  3RW7 A;  4R6F A;  1OOK G;  4FS7 A;  1OTM A;  4OQT A;  3W3K A;  3WPI A;  3G3A A;  4LXS A;  2AST B;  1M9S A;  2Z62 A;  4R6J A;  4NKH A;  3E4G A;  2OMZ A;  2XOT A;  5GQR K;  5AWC A;  4FCG A;  2WFH A;  4C2A B;  2UZX A;  4KNG A;  1FS2 A;  1Z7X W;  1P8T A;  2Z81 A;  3P72 A;  3E2J A;  4I6J B;  4R5C A;  4ECN A;  2P1N B;  4R08 A;  3A79 B;  2V9S A;  4MN8 B;  2OMY A;  1O6S A;  4Q62 A;  5GS0 A; 
#chains in the Genus database with same CATH homology
 1YRG A;  2WQX A;  1U0N D;  3M19 A;  2Y5Q A;  3UL9 A;  2A0Z A;  4IM6 A;  4Z79 A;  4V2D A;  1W8A A;  3WPE A;  4FHO A;  4ECO A;  4BV4 R;  1OTN A;  3ULU A;  3RIZ A;  3OJA A;  1DFJ I;  5IJD A;  3RGX A;  2BNH A;  3OGK B;  3UL8 A;  3TSR E;  1O6V A;  3GOZ A;  1FQV A;  3ZYN A;  1A4Y A;  4H09 A;  1PGV A;  3W3N A;  1K5D C;  1XKU A;  2OMV A;  3OGM B;  3UN9 A;  2P1Q B;  3REZ A;  3WPG A;  1M10 B;  1M9L A;  2JE0 A;  2WQW A;  3ZYI A;  1XEC A;  3BZ5 A;  4LI1 A;  4LSX A;  4QBZ A;  4CNM A;  3WPC A;  5B0N A;  1K5G C;  3RFJ A;  5GMF A;  3M18 A;  2P1O B;  1XEU A;  1OZN A;  1DCE A;  4Z61 C;  1FO1 A;  2Z64 A;  5AWB A;  2R9U A;  2Z65 A;  2Z63 A;  4WYK A;  2OMU A;  4LSC A;  1WWL A;  2RR6 A;  4Y61 B;  4BSR A;  3CVR A;  4L3A A;  4LSX C;  4P91 A;  4U7L A;  4ARR A;  2RA8 A;  4NKG A;  2UZY A;  4U08 A;  2OMT A;  3KJ4 A;  5FTT B;  4Q3G A;  2Z7X B;  3WPD A;  4L3F A;  5CMN A;  4QXE A;  5A5C A;  3E3Z A;  2P1P B;  5LFN A;  4BSU A;  3E6J A;  5HZL B;  3WPH A;  5GMH A;  5IJC A;  1QYY A;  4XOS A;  4GLP A;  1KOH A;  1D0B A;  4PSJ A;  3RGZ A;  4Z8G A;  1O6T A;  4R58 A;  4RCW A;  4M7E C;  3W3M A;  5B0T A;  3DZE A;  3VQ1 A;  2JE1 A;  4FD0 A;  4R6G A;  2OMW A;  4Z64 C;  2OMX A;  5AZ5 A;  3UL7 A;  1DS9 A;  3FXI A;  3W3J A;  4KT1 A;  2O6Q A;  3RJ0 A;  4J4L A;  5AWD A;  5AWA A;  1P9A G;  2IFG A;  1OGQ A;  4U06 A;  3G06 A;  4V2C A;  3JB9 j;  3CIG A;  3RW6 A;  3PMH G;  3W3L A;  2BEX A;  1H6U A;  4PKI G;  1XCD A;  3WPF A;  3O53 A;  3ULV A;  2Z7X A;  4J0M A;  5IYX C;  1XWD C;  1OTO A;  2ID5 A;  4B8C D;  5GMG A;  4AW4 A;  3O6N A;  2ELL A;  3W3G A;  4Z94 G;  3OGL B;  4LSA A;  4CP6 A;  5CMP A;  1JL5 A;  4ARN A;  5GS2 B;  3RFS A;  2Z66 A;  3C6N B;  1GWB A;  4CIL A;  2V70 A;  5B4P A;  4KXF B;  4HQ1 A;  3VQ2 A;  4R09 A;  4M7E A;  2XWT C;  3ZYJ A;  4PEQ B;  4U09 A;  1SQ0 B;  3G39 A;  3RFE A;  4CC4 A;  4R07 A;  1P8V A;  2O6R A;  5D3I A;  3CIY A;  4V2E A;  3WN4 A;  3G3B A;  4FDW A;  4QC0 A;  4AY9 X;  2WQV A;  1KOO A;  4PQ8 A;  4XSQ A;  5HDH A;  4LXR A;  2CA6 A;  4C2B B;  4G8A A;  3ULA A;  1A9N A;  4BSS A;  2V9T B;  4R0A A;  4K17 A;  1ZIW A;  4XGO A;  3C6P B;  4CC4 C;  1M0Z A;  2Q4G W;  3G04 C;  4R6A A;  4WP6 A;  4YEB B;  1FT8 A;  4Q3I A;  3SB4 A;  4MQW X;  1LTX A;  3OJA B;  1H6T A;  4GT6 A;  2ASS B;  2P1M B;  2Z82 A;  2WQU A;  4PER A;  4EZG A;  4UFR A;  2FT3 A;  2O6S A;  4LI2 A;  4FMZ A;  4R5D A;  4RWT C;  3ZYO A;  5IJB A;  4P8S A;  1G9U A;  1IO0 A;  2JQD A;  4RCA B;  3C6O B;  3WPB A;  4TZH A;  4CNC A;  3RW7 A;  4R6F A;  1OOK G;  4FS7 A;  1OTM A;  4OQT A;  3W3K A;  3WPI A;  3G3A A;  4LXS A;  2AST B;  1M9S A;  2Z62 A;  4R6J A;  4NKH A;  3E4G A;  2OMZ A;  2XOT A;  5GQR K;  5AWC A;  4FCG A;  2WFH A;  4C2A B;  2UZX A;  4KNG A;  1FS2 A;  1Z7X W;  1P8T A;  2Z81 A;  3P72 A;  3E2J A;  4I6J B;  4R5C A;  4ECN A;  2P1N B;  4R08 A;  3A79 B;  2V9S A;  4MN8 B;  2OMY A;  1O6S A;  4Q62 A;  5GS0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...