4C2AB

Crystal structure of high-affinity von willebrand factor a1 domain with r1306q and i1309v mutations in complex with high affinity gpib alpha
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
266
structure length
266
Chain Sequence
b'HPICEVSKVASHLEVNCDKRRLTALPPDLPKDTTILHLSENLLYTFSLATLMPYTRLTQLNLDRCELTKLQVDGTLPVLGTLDLSHNQLQSLPLLGQTLPALTVLDVSFNRLTSLPLGALRGLGELQELYLKGNELKTLPPGLLTPTPKLEKLSLANNRLTELPAGLLNGLENLDTLLLQENSLYTIPKGFFGSHLLPFAFLHGNPWLCNCEILYFRRWLQDNAENVYVWKQVVDVKAVTSNVASVQCDNSDKFPVYKYPGKGCPT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords VON WILLEBRAND FACTOR
publication title Towards the Structural Basis of Regulation of Von Willebrand Factor Binding to Glycoprotein Ib
pubmed doi rcsb
source organism Homo sapiens
molecule tags Blood clotting
total genus 72
structure length 266
sequence length 266
ec nomenclature
pdb deposition date 2013-08-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01462 LRRNT Leucine rich repeat N-terminal domain
B PF13855 LRR_8 Leucine rich repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 4c2aB00
4L3FA 4R6GA 3DZEA 3RFEA 4QXEA 1W8AA 4XOSA 1DS9A 4R5CA 1M9SA 2BNHA 3O53A 3VQ2A 2UZYA 2Z7XB 2Z81A 1XWDC 4J0MA 2V9SA 5GMGA 4Z79A 4FS7A 3VQ1A 4ECNA 3UL7A 2O6QA 5AWDA 3UL8A 4Q3GA 4MQWX 4P91A 4I6JB 5CMPA 5AWCA 1KOOA 4XGOA 1P8VA 1YRGA 4AY9X 4Z64C 1SQ0B 2V9TB 3FXIA 2P1MB 4U08A 4R0AA 4K17A 2O6SA 3A79B 3RFJA 4G8AA 4H09A 3KJ4A 4PQ8A 1D0BA 2JE1A 2UZXA 3OGLB 4RCWA 2JE0A 3OGMB 4QBZA 1PGVA 3C6OB 3E3ZA 3E2JA 2RR6A 3JB9j 1O6TA 1P9AG 4YEBB 4WYKA 4LXRA 4IM6A 3REZA 4C2AB 4PEQB 4CP6A 2Z7XA 1H6TA 1KOHA 3W3LA 1G9UA 4R5DA 3RGXA 2P1QB 2P1NB 1OTOA 2ASTB 4V2EA 4Z8GA 5HDHA 2WQWA 4NKGA 4C2BB 4QC0A 4L3AA 2OMUA 2WQUA 3UL9A 4LXSA 5IJDA 3OJAB 1OZNA 5AWBA 2WFHA 2Z82A 4LI2A 4RCAB 5GS2B 5IYXC 2OMZA 4R07A 2ID5A 1H6UA 1FO1A 2WQVA 4CILA 1FT8A 4RWTC 3WPEA 4LSCA 4OQTA 3ZYOA 4BSUA 1O6VA 3ZYJA 4GT6A 3P72A 3WPHA 1M9LA 5B0TA 1OGQA 4M7EA 3W3JA 1QYYA 4R58A 1OOKG 2RA8A 2IFGA 4R6FA 4CC4A 4MN8B 4KXFB 4PERA 2ELLA 4U06A 3CVRA 4LSXA 2R9UA 1XEUA 1U0ND 4Q3IA 3C6NB 4GLPA 2Z64A 2Z63A 5B4PA 4XSQA 3UN9A 2OMXA 4J4LA 3W3MA 4FDWA 1OTNA 4FD0A 2XOTA 4V2DA 4P8SA 3OJAA 3CIGA 3E6JA 2OMTA 1XCDA 2O6RA 3OGKB 1LTXA 2ASSB 3RJ0A 3WPDA 2JQDA 4UFRA 4V2CA 3RFSA 4KNGA 2Z66A 4PSJA 4CNCA 3ULAA 2Z62A 4R6AA 3SB4A 3ZYIA 3O6NA 2P1PB 2Y5QA 5HZLB 5AWAA 3M19A 1K5DC 1DCEA 3TSRE 4BV4R 3RGZA 4M7EC 2V70A 3WPGA 3G39A 4Z61C 4CC4C 5GQRK 3BZ5A 1M10B 4Y61B 3RIZA 1DFJI 1P8TA 4WP6A 4LSXC 3G06A 5IJCA 4ARRA 5GS0A 4BSRA 5AZ5A 1JL5A 4R6JA 2WQXA 1Z7XW 2OMWA 3ULUA 4LSAA 4NKHA 5LFNA 3ULVA 1A9NA 3CIYA 3ZYNA 4U7LA 1O6SA 4FCGA 4LI1A 2FT3A 2Q4GW 3E4GA 4ARNA 4ECOA 1IO0A 1GWBA 3WN4A 2CA6A 3GOZA 3G3BA 4FHOA 5A5CA 4R08A 2OMVA 4U09A 2OMYA 3W3KA 5GMHA 1WWLA 3M18A 3RW6A 1OTMA 4HQ1A 1K5GC 4AW4A 3G04C 5GMFA 2XWTC 4EZGA 3WPCA 4R09A 2Z65A 3C6PB 4Q62A 4Z94G 3PMHG 5FTTB 1XECA 4BSSA 3WPIA 1A4YA 4B8CD 1FQVA 3G3AA 3RW7A 4TZHA 3WPBA 2A0ZA 1ZIWA 3W3NA 5IJBA 1FS2A 2BEXA 4PKIG 3WPFA 1M0ZA 4FMZA 5B0NA 4KT1A 5CMNA 3W3GA 1XKUA 4CNMA 5D3IA 2P1OB
chains in the Genus database with same CATH superfamily
4L3FA 4R6GA 3DZEA 3RFEA 4QXEA 1W8AA 4XOSA 1DS9A 4R5CA 1M9SA 2BNHA 3O53A 3VQ2A 2UZYA 2Z7XB 2Z81A 1XWDC 4J0MA 2V9SA 5GMGA 4Z79A 4FS7A 3VQ1A 4ECNA 3UL7A 2O6QA 5AWDA 3UL8A 4Q3GA 4MQWX 4P91A 4I6JB 5CMPA 5AWCA 1KOOA 4XGOA 1P8VA 1YRGA 4AY9X 4Z64C 1SQ0B 2V9TB 3FXIA 2P1MB 4U08A 4R0AA 4K17A 2O6SA 3A79B 3RFJA 4G8AA 4H09A 3KJ4A 4PQ8A 1D0BA 2JE1A 2UZXA 3OGLB 4RCWA 2JE0A 3OGMB 4QBZA 1PGVA 3C6OB 3E3ZA 3E2JA 2RR6A 3JB9j 1O6TA 1P9AG 4YEBB 4WYKA 4LXRA 4IM6A 3REZA 4C2AB 4PEQB 4CP6A 2Z7XA 1H6TA 1KOHA 3W3LA 1G9UA 4R5DA 3RGXA 2P1QB 2P1NB 1OTOA 2ASTB 4V2EA 4Z8GA 5HDHA 2WQWA 4NKGA 4C2BB 4QC0A 4L3AA 2OMUA 2WQUA 3UL9A 4LXSA 5IJDA 3OJAB 1OZNA 5AWBA 2WFHA 2Z82A 4LI2A 4RCAB 5GS2B 5IYXC 2OMZA 4R07A 2ID5A 1H6UA 1FO1A 2WQVA 4CILA 1FT8A 4RWTC 3WPEA 4LSCA 4OQTA 3ZYOA 4BSUA 1O6VA 3ZYJA 4GT6A 3P72A 3WPHA 1M9LA 5B0TA 1OGQA 4M7EA 3W3JA 1QYYA 4R58A 1OOKG 2RA8A 2IFGA 4R6FA 4CC4A 4MN8B 4KXFB 4PERA 2ELLA 4U06A 3CVRA 4LSXA 2R9UA 1XEUA 1U0ND 4Q3IA 3C6NB 4GLPA 2Z64A 2Z63A 5B4PA 4XSQA 3UN9A 2OMXA 4J4LA 3W3MA 4FDWA 1OTNA 4FD0A 2XOTA 4V2DA 4P8SA 3OJAA 3CIGA 3E6JA 2OMTA 1XCDA 2O6RA 3OGKB 1LTXA 2ASSB 3RJ0A 3WPDA 2JQDA 4UFRA 4V2CA 3RFSA 4KNGA 2Z66A 4PSJA 4CNCA 3ULAA 2Z62A 4R6AA 3SB4A 3ZYIA 3O6NA 2P1PB 2Y5QA 5HZLB 5AWAA 3M19A 1K5DC 1DCEA 3TSRE 4BV4R 3RGZA 4M7EC 2V70A 3WPGA 3G39A 4Z61C 4CC4C 5GQRK 3BZ5A 1M10B 4Y61B 3RIZA 1DFJI 1P8TA 4WP6A 4LSXC 3G06A 5IJCA 4ARRA 5GS0A 4BSRA 5AZ5A 1JL5A 4R6JA 2WQXA 1Z7XW 2OMWA 3ULUA 4LSAA 4NKHA 5LFNA 3ULVA 1A9NA 3CIYA 3ZYNA 4U7LA 1O6SA 4FCGA 4LI1A 2FT3A 2Q4GW 4NZTM 3E4GA 4ARNA 4ECOA 1IO0A 1GWBA 3WN4A 2CA6A 3GOZA 3G3BA 4FHOA 5A5CA 4R08A 2OMVA 4U09A 2OMYA 3W3KA 5GMHA 1WWLA 3M18A 3RW6A 1OTMA 4HQ1A 1K5GC 4AW4A 3G04C 5GMFA 2XWTC 4EZGA 3WPCA 4R09A 2Z65A 3C6PB 4Q62A 4Z94G 3PMHG 5FTTB 1XECA 4BSSA 3WPIA 4NZRM 1A4YA 4B8CD 1FQVA 3G3AA 3RW7A 4TZHA 3WPBA 2A0ZA 1ZIWA 3W3NA 5IJBA 1FS2A 2BEXA 4PKIG 3WPFA 1M0ZA 4FMZA 5B0NA 4KT1A 5CMNA 3W3GA 1XKUA 4CNMA 5D3IA 2P1OB
chains in the Genus database with same CATH topology
4L3FA 4R6GA 3DZEA 3RFEA 4QXEA 1W8AA 4XOSA 1DS9A 4R5CA 1M9SA 2BNHA 3O53A 3VQ2A 2UZYA 2Z7XB 2Z81A 1XWDC 4J0MA 2V9SA 5GMGA 4Z79A 4FS7A 3VQ1A 4ECNA 3UL7A 2O6QA 5AWDA 3UL8A 4Q3GA 4MQWX 4P91A 4I6JB 5CMPA 5AWCA 1KOOA 4XGOA 1P8VA 1YRGA 4AY9X 4Z64C 1SQ0B 2V9TB 3FXIA 2P1MB 4U08A 4R0AA 4K17A 2O6SA 3A79B 3RFJA 4G8AA 4H09A 3KJ4A 4PQ8A 1D0BA 2JE1A 2UZXA 3OGLB 4RCWA 2JE0A 3OGMB 4QBZA 1PGVA 3C6OB 3E3ZA 3E2JA 2RR6A 3JB9j 1O6TA 1P9AG 4YEBB 4WYKA 4LXRA 4IM6A 3REZA 4C2AB 4PEQB 4CP6A 2Z7XA 1H6TA 1KOHA 3W3LA 1G9UA 4R5DA 3RGXA 2P1QB 2P1NB 1OTOA 2ASTB 4V2EA 4Z8GA 5HDHA 2WQWA 4NKGA 4C2BB 4QC0A 4L3AA 2OMUA 2WQUA 3UL9A 4LXSA 5IJDA 3OJAB 1OZNA 5AWBA 2WFHA 2Z82A 4LI2A 4RCAB 5GS2B 5IYXC 2OMZA 4R07A 2ID5A 1H6UA 1FO1A 2WQVA 4CILA 1FT8A 4RWTC 3WPEA 4LSCA 4OQTA 3ZYOA 4BSUA 1O6VA 3ZYJA 4GT6A 3P72A 3WPHA 1M9LA 5B0TA 1OGQA 4M7EA 3W3JA 1QYYA 4R58A 1OOKG 2RA8A 2IFGA 4R6FA 4CC4A 4MN8B 4KXFB 4PERA 2ELLA 4U06A 3CVRA 4LSXA 2R9UA 1XEUA 1U0ND 4Q3IA 3C6NB 4GLPA 2Z64A 2Z63A 5B4PA 4XSQA 3UN9A 2OMXA 4J4LA 3W3MA 4FDWA 1OTNA 4FD0A 2XOTA 4V2DA 4P8SA 3OJAA 3CIGA 3E6JA 2OMTA 1XCDA 2O6RA 3OGKB 1LTXA 2ASSB 3RJ0A 3WPDA 2JQDA 4UFRA 4V2CA 3RFSA 4KNGA 2Z66A 4PSJA 4CNCA 3ULAA 2Z62A 4R6AA 3SB4A 3ZYIA 3O6NA 2P1PB 2Y5QA 5HZLB 5AWAA 3M19A 1K5DC 1DCEA 3TSRE 4BV4R 3RGZA 4M7EC 2V70A 3WPGA 3G39A 4Z61C 4CC4C 5GQRK 3BZ5A 1M10B 4Y61B 3RIZA 1DFJI 1P8TA 4WP6A 4LSXC 3G06A 5IJCA 4ARRA 5GS0A 4BSRA 5AZ5A 1JL5A 4R6JA 2WQXA 1Z7XW 2OMWA 3ULUA 4LSAA 4NKHA 5LFNA 3ULVA 1A9NA 3CIYA 3ZYNA 4U7LA 1O6SA 4FCGA 4LI1A 2FT3A 2Q4GW 3E4GA 4ARNA 4ECOA 1IO0A 1GWBA 3WN4A 2CA6A 3GOZA 3G3BA 4FHOA 5A5CA 4R08A 2OMVA 4U09A 2OMYA 3W3KA 5GMHA 1WWLA 3M18A 3RW6A 1OTMA 4HQ1A 1K5GC 4AW4A 3G04C 5GMFA 2XWTC 4EZGA 3WPCA 4R09A 2Z65A 3C6PB 4Q62A 4Z94G 3PMHG 5FTTB 1XECA 4BSSA 3WPIA 1A4YA 4B8CD 1FQVA 3G3AA 3RW7A 4TZHA 3WPBA 2A0ZA 1ZIWA 3W3NA 5IJBA 1FS2A 2BEXA 4PKIG 3WPFA 1M0ZA 4FMZA 5B0NA 4KT1A 5CMNA 3W3GA 1XKUA 4CNMA 5D3IA 2P1OB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4L3F A;  4R6G A;  3DZE A;  3RFE A;  4QXE A;  1W8A A;  4XOS A;  1DS9 A;  4R5C A;  1M9S A;  2BNH A;  3O53 A;  3VQ2 A;  2UZY A;  2Z7X B;  2Z81 A;  1XWD C;  4J0M A;  2V9S A;  5GMG A;  4Z79 A;  4FS7 A;  3VQ1 A;  4ECN A;  3UL7 A;  2O6Q A;  5AWD A;  3UL8 A;  4Q3G A;  4MQW X;  4P91 A;  4I6J B;  5CMP A;  5AWC A;  1KOO A;  4XGO A;  1P8V A;  1YRG A;  4AY9 X;  4Z64 C;  1SQ0 B;  2V9T B;  3FXI A;  2P1M B;  4U08 A;  4R0A A;  4K17 A;  2O6S A;  3A79 B;  3RFJ A;  4G8A A;  4H09 A;  3KJ4 A;  4PQ8 A;  1D0B A;  2JE1 A;  2UZX A;  3OGL B;  4RCW A;  2JE0 A;  3OGM B;  4QBZ A;  1PGV A;  3C6O B;  3E3Z A;  3E2J A;  2RR6 A;  3JB9 j;  1O6T A;  1P9A G;  4YEB B;  4WYK A;  4LXR A;  4IM6 A;  3REZ A;  4C2A B;  4PEQ B;  4CP6 A;  2Z7X A;  1H6T A;  1KOH A;  3W3L A;  1G9U A;  4R5D A;  3RGX A;  2P1Q B;  2P1N B;  1OTO A;  2AST B;  4V2E A;  4Z8G A;  5HDH A;  2WQW A;  4NKG A;  4C2B B;  4QC0 A;  4L3A A;  2OMU A;  2WQU A;  3UL9 A;  4LXS A;  5IJD A;  3OJA B;  1OZN A;  5AWB A;  2WFH A;  2Z82 A;  4LI2 A;  4RCA B;  5GS2 B;  5IYX C;  2OMZ A;  4R07 A;  2ID5 A;  1H6U A;  1FO1 A;  2WQV A;  4CIL A;  1FT8 A;  4RWT C;  3WPE A;  4LSC A;  4OQT A;  3ZYO A;  4BSU A;  1O6V A;  3ZYJ A;  4GT6 A;  3P72 A;  3WPH A;  1M9L A;  5B0T A;  1OGQ A;  4M7E A;  3W3J A;  1QYY A;  4R58 A;  1OOK G;  2RA8 A;  2IFG A;  4R6F A;  4CC4 A;  4MN8 B;  4KXF B;  4PER A;  2ELL A;  4U06 A;  3CVR A;  4LSX A;  2R9U A;  1XEU A;  1U0N D;  4Q3I A;  3C6N B;  4GLP A;  2Z64 A;  2Z63 A;  5B4P A;  4XSQ A;  3UN9 A;  2OMX A;  4J4L A;  3W3M A;  4FDW A;  1OTN A;  4FD0 A;  2XOT A;  4V2D A;  4P8S A;  3OJA A;  3CIG A;  3E6J A;  2OMT A;  1XCD A;  2O6R A;  3OGK B;  1LTX A;  2ASS B;  3RJ0 A;  3WPD A;  2JQD A;  4UFR A;  4V2C A;  3RFS A;  4KNG A;  2Z66 A;  4PSJ A;  4CNC A;  3ULA A;  2Z62 A;  4R6A A;  3SB4 A;  3ZYI A;  3O6N A;  2P1P B;  2Y5Q A;  5HZL B;  5AWA A;  3M19 A;  1K5D C;  1DCE A;  3TSR E;  4BV4 R;  3RGZ A;  4M7E C;  2V70 A;  3WPG A;  3G39 A;  4Z61 C;  4CC4 C;  5GQR K;  3BZ5 A;  1M10 B;  4Y61 B;  3RIZ A;  1DFJ I;  1P8T A;  4WP6 A;  4LSX C;  3G06 A;  5IJC A;  4ARR A;  5GS0 A;  4BSR A;  5AZ5 A;  1JL5 A;  4R6J A;  2WQX A;  1Z7X W;  2OMW A;  3ULU A;  4LSA A;  4NKH A;  5LFN A;  3ULV A;  1A9N A;  3CIY A;  3ZYN A;  4U7L A;  1O6S A;  4FCG A;  4LI1 A;  2FT3 A;  2Q4G W;  3E4G A;  4ARN A;  4ECO A;  1IO0 A;  1GWB A;  3WN4 A;  2CA6 A;  3GOZ A;  3G3B A;  4FHO A;  5A5C A;  4R08 A;  2OMV A;  4U09 A;  2OMY A;  3W3K A;  5GMH A;  1WWL A;  3M18 A;  3RW6 A;  1OTM A;  4HQ1 A;  1K5G C;  4AW4 A;  3G04 C;  5GMF A;  2XWT C;  4EZG A;  3WPC A;  4R09 A;  2Z65 A;  3C6P B;  4Q62 A;  4Z94 G;  3PMH G;  5FTT B;  1XEC A;  4BSS A;  3WPI A;  1A4Y A;  4B8C D;  1FQV A;  3G3A A;  3RW7 A;  4TZH A;  3WPB A;  2A0Z A;  1ZIW A;  3W3N A;  5IJB A;  1FS2 A;  2BEX A;  4PKI G;  3WPF A;  1M0Z A;  4FMZ A;  5B0N A;  4KT1 A;  5CMN A;  3W3G A;  1XKU A;  4CNM A;  5D3I A;  2P1O B; 
#chains in the Genus database with same CATH topology
 4L3F A;  4R6G A;  3DZE A;  3RFE A;  4QXE A;  1W8A A;  4XOS A;  1DS9 A;  4R5C A;  1M9S A;  2BNH A;  3O53 A;  3VQ2 A;  2UZY A;  2Z7X B;  2Z81 A;  1XWD C;  4J0M A;  2V9S A;  5GMG A;  4Z79 A;  4FS7 A;  3VQ1 A;  4ECN A;  3UL7 A;  2O6Q A;  5AWD A;  3UL8 A;  4Q3G A;  4MQW X;  4P91 A;  4I6J B;  5CMP A;  5AWC A;  1KOO A;  4XGO A;  1P8V A;  1YRG A;  4AY9 X;  4Z64 C;  1SQ0 B;  2V9T B;  3FXI A;  2P1M B;  4U08 A;  4R0A A;  4K17 A;  2O6S A;  3A79 B;  3RFJ A;  4G8A A;  4H09 A;  3KJ4 A;  4PQ8 A;  1D0B A;  2JE1 A;  2UZX A;  3OGL B;  4RCW A;  2JE0 A;  3OGM B;  4QBZ A;  1PGV A;  3C6O B;  3E3Z A;  3E2J A;  2RR6 A;  3JB9 j;  1O6T A;  1P9A G;  4YEB B;  4WYK A;  4LXR A;  4IM6 A;  3REZ A;  4C2A B;  4PEQ B;  4CP6 A;  2Z7X A;  1H6T A;  1KOH A;  3W3L A;  1G9U A;  4R5D A;  3RGX A;  2P1Q B;  2P1N B;  1OTO A;  2AST B;  4V2E A;  4Z8G A;  5HDH A;  2WQW A;  4NKG A;  4C2B B;  4QC0 A;  4L3A A;  2OMU A;  2WQU A;  3UL9 A;  4LXS A;  5IJD A;  3OJA B;  1OZN A;  5AWB A;  2WFH A;  2Z82 A;  4LI2 A;  4RCA B;  5GS2 B;  5IYX C;  2OMZ A;  4R07 A;  2ID5 A;  1H6U A;  1FO1 A;  2WQV A;  4CIL A;  1FT8 A;  4RWT C;  3WPE A;  4LSC A;  4OQT A;  3ZYO A;  4BSU A;  1O6V A;  3ZYJ A;  4GT6 A;  3P72 A;  3WPH A;  1M9L A;  5B0T A;  1OGQ A;  4M7E A;  3W3J A;  1QYY A;  4R58 A;  1OOK G;  2RA8 A;  2IFG A;  4R6F A;  4CC4 A;  4MN8 B;  4KXF B;  4PER A;  2ELL A;  4U06 A;  3CVR A;  4LSX A;  2R9U A;  1XEU A;  1U0N D;  4Q3I A;  3C6N B;  4GLP A;  2Z64 A;  2Z63 A;  5B4P A;  4XSQ A;  3UN9 A;  2OMX A;  4J4L A;  3W3M A;  4FDW A;  1OTN A;  4FD0 A;  2XOT A;  4V2D A;  4P8S A;  3OJA A;  3CIG A;  3E6J A;  2OMT A;  1XCD A;  2O6R A;  3OGK B;  1LTX A;  2ASS B;  3RJ0 A;  3WPD A;  2JQD A;  4UFR A;  4V2C A;  3RFS A;  4KNG A;  2Z66 A;  4PSJ A;  4CNC A;  3ULA A;  2Z62 A;  4R6A A;  3SB4 A;  3ZYI A;  3O6N A;  2P1P B;  2Y5Q A;  5HZL B;  5AWA A;  3M19 A;  1K5D C;  1DCE A;  3TSR E;  4BV4 R;  3RGZ A;  4M7E C;  2V70 A;  3WPG A;  3G39 A;  4Z61 C;  4CC4 C;  5GQR K;  3BZ5 A;  1M10 B;  4Y61 B;  3RIZ A;  1DFJ I;  1P8T A;  4WP6 A;  4LSX C;  3G06 A;  5IJC A;  4ARR A;  5GS0 A;  4BSR A;  5AZ5 A;  1JL5 A;  4R6J A;  2WQX A;  1Z7X W;  2OMW A;  3ULU A;  4LSA A;  4NKH A;  5LFN A;  3ULV A;  1A9N A;  3CIY A;  3ZYN A;  4U7L A;  1O6S A;  4FCG A;  4LI1 A;  2FT3 A;  2Q4G W;  4NZT M;  3E4G A;  4ARN A;  4ECO A;  1IO0 A;  1GWB A;  3WN4 A;  2CA6 A;  3GOZ A;  3G3B A;  4FHO A;  5A5C A;  4R08 A;  2OMV A;  4U09 A;  2OMY A;  3W3K A;  5GMH A;  1WWL A;  3M18 A;  3RW6 A;  1OTM A;  4HQ1 A;  1K5G C;  4AW4 A;  3G04 C;  5GMF A;  2XWT C;  4EZG A;  3WPC A;  4R09 A;  2Z65 A;  3C6P B;  4Q62 A;  4Z94 G;  3PMH G;  5FTT B;  1XEC A;  4BSS A;  3WPI A;  4NZR M;  1A4Y A;  4B8C D;  1FQV A;  3G3A A;  3RW7 A;  4TZH A;  3WPB A;  2A0Z A;  1ZIW A;  3W3N A;  5IJB A;  1FS2 A;  2BEX A;  4PKI G;  3WPF A;  1M0Z A;  4FMZ A;  5B0N A;  4KT1 A;  5CMN A;  3W3G A;  1XKU A;  4CNM A;  5D3I A;  2P1O B; 
#chains in the Genus database with same CATH homology
 4L3F A;  4R6G A;  3DZE A;  3RFE A;  4QXE A;  1W8A A;  4XOS A;  1DS9 A;  4R5C A;  1M9S A;  2BNH A;  3O53 A;  3VQ2 A;  2UZY A;  2Z7X B;  2Z81 A;  1XWD C;  4J0M A;  2V9S A;  5GMG A;  4Z79 A;  4FS7 A;  3VQ1 A;  4ECN A;  3UL7 A;  2O6Q A;  5AWD A;  3UL8 A;  4Q3G A;  4MQW X;  4P91 A;  4I6J B;  5CMP A;  5AWC A;  1KOO A;  4XGO A;  1P8V A;  1YRG A;  4AY9 X;  4Z64 C;  1SQ0 B;  2V9T B;  3FXI A;  2P1M B;  4U08 A;  4R0A A;  4K17 A;  2O6S A;  3A79 B;  3RFJ A;  4G8A A;  4H09 A;  3KJ4 A;  4PQ8 A;  1D0B A;  2JE1 A;  2UZX A;  3OGL B;  4RCW A;  2JE0 A;  3OGM B;  4QBZ A;  1PGV A;  3C6O B;  3E3Z A;  3E2J A;  2RR6 A;  3JB9 j;  1O6T A;  1P9A G;  4YEB B;  4WYK A;  4LXR A;  4IM6 A;  3REZ A;  4C2A B;  4PEQ B;  4CP6 A;  2Z7X A;  1H6T A;  1KOH A;  3W3L A;  1G9U A;  4R5D A;  3RGX A;  2P1Q B;  2P1N B;  1OTO A;  2AST B;  4V2E A;  4Z8G A;  5HDH A;  2WQW A;  4NKG A;  4C2B B;  4QC0 A;  4L3A A;  2OMU A;  2WQU A;  3UL9 A;  4LXS A;  5IJD A;  3OJA B;  1OZN A;  5AWB A;  2WFH A;  2Z82 A;  4LI2 A;  4RCA B;  5GS2 B;  5IYX C;  2OMZ A;  4R07 A;  2ID5 A;  1H6U A;  1FO1 A;  2WQV A;  4CIL A;  1FT8 A;  4RWT C;  3WPE A;  4LSC A;  4OQT A;  3ZYO A;  4BSU A;  1O6V A;  3ZYJ A;  4GT6 A;  3P72 A;  3WPH A;  1M9L A;  5B0T A;  1OGQ A;  4M7E A;  3W3J A;  1QYY A;  4R58 A;  1OOK G;  2RA8 A;  2IFG A;  4R6F A;  4CC4 A;  4MN8 B;  4KXF B;  4PER A;  2ELL A;  4U06 A;  3CVR A;  4LSX A;  2R9U A;  1XEU A;  1U0N D;  4Q3I A;  3C6N B;  4GLP A;  2Z64 A;  2Z63 A;  5B4P A;  4XSQ A;  3UN9 A;  2OMX A;  4J4L A;  3W3M A;  4FDW A;  1OTN A;  4FD0 A;  2XOT A;  4V2D A;  4P8S A;  3OJA A;  3CIG A;  3E6J A;  2OMT A;  1XCD A;  2O6R A;  3OGK B;  1LTX A;  2ASS B;  3RJ0 A;  3WPD A;  2JQD A;  4UFR A;  4V2C A;  3RFS A;  4KNG A;  2Z66 A;  4PSJ A;  4CNC A;  3ULA A;  2Z62 A;  4R6A A;  3SB4 A;  3ZYI A;  3O6N A;  2P1P B;  2Y5Q A;  5HZL B;  5AWA A;  3M19 A;  1K5D C;  1DCE A;  3TSR E;  4BV4 R;  3RGZ A;  4M7E C;  2V70 A;  3WPG A;  3G39 A;  4Z61 C;  4CC4 C;  5GQR K;  3BZ5 A;  1M10 B;  4Y61 B;  3RIZ A;  1DFJ I;  1P8T A;  4WP6 A;  4LSX C;  3G06 A;  5IJC A;  4ARR A;  5GS0 A;  4BSR A;  5AZ5 A;  1JL5 A;  4R6J A;  2WQX A;  1Z7X W;  2OMW A;  3ULU A;  4LSA A;  4NKH A;  5LFN A;  3ULV A;  1A9N A;  3CIY A;  3ZYN A;  4U7L A;  1O6S A;  4FCG A;  4LI1 A;  2FT3 A;  2Q4G W;  3E4G A;  4ARN A;  4ECO A;  1IO0 A;  1GWB A;  3WN4 A;  2CA6 A;  3GOZ A;  3G3B A;  4FHO A;  5A5C A;  4R08 A;  2OMV A;  4U09 A;  2OMY A;  3W3K A;  5GMH A;  1WWL A;  3M18 A;  3RW6 A;  1OTM A;  4HQ1 A;  1K5G C;  4AW4 A;  3G04 C;  5GMF A;  2XWT C;  4EZG A;  3WPC A;  4R09 A;  2Z65 A;  3C6P B;  4Q62 A;  4Z94 G;  3PMH G;  5FTT B;  1XEC A;  4BSS A;  3WPI A;  1A4Y A;  4B8C D;  1FQV A;  3G3A A;  3RW7 A;  4TZH A;  3WPB A;  2A0Z A;  1ZIW A;  3W3N A;  5IJB A;  1FS2 A;  2BEX A;  4PKI G;  3WPF A;  1M0Z A;  4FMZ A;  5B0N A;  4KT1 A;  5CMN A;  3W3G A;  1XKU A;  4CNM A;  5D3I A;  2P1O B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...