2O6RA

Structural diversity of the hagfish variable lymphocyte receptors b61
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
177
structure length
177
Chain Sequence
CPSRCSCSGTEIRCNSKGLTSVPTGIPSSATRLELESNKLQSLPHGVFDKLTQLTKLSLSQNQIQSLPDGVFDKLTKLTILYLHENKLQSLPNGVFDKLTQLKELALDTNQLKSVPDGIFDRLTSLQKIWLHTNPWDCSCPRIDYLSRWLNKNSQKEQGSAKCSGSGKPVRSIICPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Variable lymphocyte receptor B
publication title Structural diversity of the hagfish variable lymphocyte receptors
pubmed doi rcsb
source organism Eptatretus burgeri
total genus 53
structure length 177
sequence length 177
ec nomenclature
pdb deposition date 2006-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13855 LRR_8 Leucine rich repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 2o6rA00
4H09A 2JE0A 3A79B 1XEUA 4Y61B 2OMVA 2FT3A 4R6JA 4PQ8A 3OGLB 4C2AB 2WQUA 4AY9X 5GS2B 3W3JA 2Z81A 3UL9A 1M0ZA 4M7EC 2V9TB 3ZYNA 2A0ZA 2RR6A 4Q3GA 3RFEA 4HQ1A 2Z7XB 4GT6A 1G9UA 1A9NA 5GS0A 4U09A 2P1QB 2Z63A 3OGMB 4LI1A 4U08A 2XOTA 1DCEA 4L3AA 4V2CA 3RFJA 1W8AA 4KNGA 4XSQA 4BSRA 2JE1A 2V9SA 4LSCA 4FMZA 2Z62A 1SQ0B 1K5DC 2OMWA 4PERA 3OJAB 1XECA 5AWBA 5D3IA 2JQDA 4QBZA 3G3AA 4TZHA 4R5CA 3WPBA 3M19A 3ULVA 4GLPA 4BV4R 4C2BB 1H6TA 4EZGA 3E4GA 1M9LA 3G3BA 1Z7XW 4LI2A 3C6NB 4G8AA 1FT8A 3WPIA 3ZYIA 4CILA 2Z65A 3UL7A 5CMPA 4J4LA 4I6JB 5HZLB 3VQ2A 2ID5A 3W3LA 3RGXA 1WWLA 3CIYA 3G06A 4ARNA 3WN4A 3ZYJA 2BEXA 4CP6A 4XGOA 4Z94G 4OQTA 1OTOA 5B0TA 5IJCA 5LFNA 5A5CA 2R9UA 3M18A 2P1PB 1JL5A 2ASTB 5AZ5A 1M9SA 4XOSA 2Z82A 2OMYA 3E6JA 4ARRA 4R0AA 1P8VA 4YEBB 1IO0A 5CMNA 3FXIA 4Q62A 4UFRA 1OTNA 1XCDA 4IM6A 2RA8A 4Z64C 3WPGA 1P8TA 3KJ4A 4RCAB 1LTXA 1A4YA 1FQVA 1H6UA 4LSXA 3WPFA 3CVRA 5IJDA 4J0MA 5IJBA 1YRGA 5B4PA 4R6FA 3ULUA 4V2EA 2Z64A 4KXFB 4B8CD 3RW6A 4FHOA 3CIGA 4R6GA 4FDWA 4PSJA 3E2JA 3W3GA 3WPCA 3W3KA 2OMTA 4CC4C 4ECOA 1XKUA 1OGQA 4KT1A 2UZYA 2OMUA 4FCGA 2Q4GW 3WPHA 3ULAA 1OTMA 3TSRE 3BZ5A 2ELLA 3W3MA 1DFJI 1KOOA 3G04C 4Z8GA 1K5GC 2UZXA 4Q3IA 1O6SA 4PKIG 4QC0A 3SB4A 3PMHG 4K17A 4MQWX 2Y5QA 3RIZA 1O6TA 2WQXA 3C6PB 4P91A 5GQRK 2XWTC 4FS7A 4LXSA 1OZNA 2Z7XA 4M7EA 5B0NA 2OMXA 4R08A 1OOKG 2P1OB 1DS9A 1D0BA 5FTTB 1O6VA 2WFHA 4LXRA 4R58A 1P9AG 3VQ1A 5AWCA 2BNHA 4NKHA 3JB9j 2P1NB 4P8SA 3GOZA 3DZEA 3O53A 2O6RA 2Z66A 1M10B 4R09A 4V2DA 2V70A 4R6AA 3G39A 5IYXC 5HDHA 4AW4A 4WYKA 3OJAA 3RJ0A 2IFGA 3ZYOA 1GWBA 4Z79A 4R5DA 4BSSA 1PGVA 2ASSB 4RWTC 4WP6A 4U7LA 4U06A 3W3NA 3P72A 1KOHA 4R07A 4CC4A 1U0ND 1QYYA 4LSXC 3RGZA 2P1MB 2O6QA 4ECNA 3RW7A 3REZA 4MN8B 1ZIWA 3UL8A 3WPDA 5GMGA 1XWDC 3C6OB 2O6SA 4LSAA 5AWDA 3RFSA 2WQVA 5AWAA 4PEQB 4FD0A 4NKGA 3UN9A 4Z61C 4L3FA 3WPEA 2WQWA 5GMFA 2CA6A 4RCWA 2OMZA 1FS2A 1FO1A 3E3ZA 4CNMA 4CNCA 4BSUA 4QXEA 3OGKB 3O6NA 5GMHA
chains in the Genus database with same CATH superfamily
4H09A 2JE0A 3A79B 1XEUA 4Y61B 2OMVA 2FT3A 4R6JA 4PQ8A 3OGLB 4C2AB 2WQUA 4AY9X 5GS2B 3W3JA 2Z81A 3UL9A 1M0ZA 4M7EC 2V9TB 3ZYNA 2A0ZA 2RR6A 4Q3GA 3RFEA 4HQ1A 2Z7XB 4GT6A 1G9UA 1A9NA 5GS0A 4U09A 2P1QB 2Z63A 3OGMB 4LI1A 4U08A 2XOTA 1DCEA 4L3AA 4V2CA 3RFJA 1W8AA 4KNGA 4XSQA 4BSRA 2JE1A 2V9SA 4LSCA 4FMZA 2Z62A 1SQ0B 1K5DC 2OMWA 4PERA 3OJAB 1XECA 5AWBA 5D3IA 2JQDA 4QBZA 3G3AA 4TZHA 4R5CA 3WPBA 3M19A 3ULVA 4GLPA 4BV4R 4C2BB 1H6TA 4EZGA 3E4GA 1M9LA 3G3BA 1Z7XW 4LI2A 3C6NB 4G8AA 1FT8A 3WPIA 3ZYIA 4CILA 2Z65A 3UL7A 5CMPA 4J4LA 4I6JB 5HZLB 3VQ2A 2ID5A 3W3LA 3RGXA 1WWLA 3CIYA 3G06A 4ARNA 3WN4A 3ZYJA 2BEXA 4CP6A 4XGOA 4Z94G 4OQTA 1OTOA 5B0TA 5IJCA 5LFNA 5A5CA 2R9UA 3M18A 2P1PB 1JL5A 2ASTB 5AZ5A 1M9SA 4XOSA 2Z82A 2OMYA 3E6JA 4ARRA 4R0AA 1P8VA 4YEBB 1IO0A 5CMNA 3FXIA 4Q62A 4UFRA 1OTNA 1XCDA 4IM6A 2RA8A 4Z64C 3WPGA 1P8TA 3KJ4A 4RCAB 1LTXA 1A4YA 1FQVA 1H6UA 4LSXA 3WPFA 4NZRM 3CVRA 5IJDA 4J0MA 5IJBA 1YRGA 5B4PA 4R6FA 3ULUA 4V2EA 2Z64A 4KXFB 4B8CD 3RW6A 4FHOA 3CIGA 4R6GA 4FDWA 4PSJA 3E2JA 3W3GA 3WPCA 3W3KA 2OMTA 4CC4C 4ECOA 1XKUA 1OGQA 4KT1A 2UZYA 2OMUA 4FCGA 2Q4GW 3WPHA 3ULAA 1OTMA 3TSRE 3BZ5A 2ELLA 3W3MA 1DFJI 1KOOA 3G04C 4Z8GA 1K5GC 2UZXA 4Q3IA 1O6SA 4PKIG 4QC0A 3SB4A 3PMHG 4K17A 4MQWX 2Y5QA 3RIZA 1O6TA 2WQXA 3C6PB 4P91A 5GQRK 2XWTC 4FS7A 4LXSA 1OZNA 2Z7XA 4M7EA 5B0NA 2OMXA 4R08A 1OOKG 2P1OB 1DS9A 1D0BA 5FTTB 1O6VA 2WFHA 4LXRA 4R58A 1P9AG 3VQ1A 5AWCA 2BNHA 4NKHA 4NZTM 3JB9j 2P1NB 4P8SA 3GOZA 3DZEA 3O53A 2O6RA 2Z66A 1M10B 4R09A 4V2DA 2V70A 4R6AA 3G39A 5IYXC 5HDHA 4AW4A 4WYKA 3OJAA 3RJ0A 2IFGA 3ZYOA 1GWBA 4Z79A 4R5DA 4BSSA 1PGVA 2ASSB 4RWTC 4WP6A 4U7LA 4U06A 3W3NA 3P72A 1KOHA 4R07A 4CC4A 1U0ND 1QYYA 4LSXC 3RGZA 2P1MB 2O6QA 4ECNA 3RW7A 3REZA 4MN8B 1ZIWA 3UL8A 3WPDA 5GMGA 1XWDC 3C6OB 2O6SA 4LSAA 5AWDA 3RFSA 2WQVA 5AWAA 4PEQB 4FD0A 4NKGA 3UN9A 4Z61C 4L3FA 3WPEA 2WQWA 5GMFA 2CA6A 4RCWA 2OMZA 1FS2A 1FO1A 3E3ZA 4CNMA 4CNCA 4BSUA 4QXEA 3OGKB 3O6NA 5GMHA
chains in the Genus database with same CATH topology
4H09A 2JE0A 3A79B 1XEUA 4Y61B 2OMVA 2FT3A 4R6JA 4PQ8A 3OGLB 4C2AB 2WQUA 4AY9X 5GS2B 3W3JA 2Z81A 3UL9A 1M0ZA 4M7EC 2V9TB 3ZYNA 2A0ZA 2RR6A 4Q3GA 3RFEA 4HQ1A 2Z7XB 4GT6A 1G9UA 1A9NA 5GS0A 4U09A 2P1QB 2Z63A 3OGMB 4LI1A 4U08A 2XOTA 1DCEA 4L3AA 4V2CA 3RFJA 1W8AA 4KNGA 4XSQA 4BSRA 2JE1A 2V9SA 4LSCA 4FMZA 2Z62A 1SQ0B 1K5DC 2OMWA 4PERA 3OJAB 1XECA 5AWBA 5D3IA 2JQDA 4QBZA 3G3AA 4TZHA 4R5CA 3WPBA 3M19A 3ULVA 4GLPA 4BV4R 4C2BB 1H6TA 4EZGA 3E4GA 1M9LA 3G3BA 1Z7XW 4LI2A 3C6NB 4G8AA 1FT8A 3WPIA 3ZYIA 4CILA 2Z65A 3UL7A 5CMPA 4J4LA 4I6JB 5HZLB 3VQ2A 2ID5A 3W3LA 3RGXA 1WWLA 3CIYA 3G06A 4ARNA 3WN4A 3ZYJA 2BEXA 4CP6A 4XGOA 4Z94G 4OQTA 1OTOA 5B0TA 5IJCA 5LFNA 5A5CA 2R9UA 3M18A 2P1PB 1JL5A 2ASTB 5AZ5A 1M9SA 4XOSA 2Z82A 2OMYA 3E6JA 4ARRA 4R0AA 1P8VA 4YEBB 1IO0A 5CMNA 3FXIA 4Q62A 4UFRA 1OTNA 1XCDA 4IM6A 2RA8A 4Z64C 3WPGA 1P8TA 3KJ4A 4RCAB 1LTXA 1A4YA 1FQVA 1H6UA 4LSXA 3WPFA 3CVRA 5IJDA 4J0MA 5IJBA 1YRGA 5B4PA 4R6FA 3ULUA 4V2EA 2Z64A 4KXFB 4B8CD 3RW6A 4FHOA 3CIGA 4R6GA 4FDWA 4PSJA 3E2JA 3W3GA 3WPCA 3W3KA 2OMTA 4CC4C 4ECOA 1XKUA 1OGQA 4KT1A 2UZYA 2OMUA 4FCGA 2Q4GW 3WPHA 3ULAA 1OTMA 3TSRE 3BZ5A 2ELLA 3W3MA 1DFJI 1KOOA 3G04C 4Z8GA 1K5GC 2UZXA 4Q3IA 1O6SA 4PKIG 4QC0A 3SB4A 3PMHG 4K17A 4MQWX 2Y5QA 3RIZA 1O6TA 2WQXA 3C6PB 4P91A 5GQRK 2XWTC 4FS7A 4LXSA 1OZNA 2Z7XA 4M7EA 5B0NA 2OMXA 4R08A 1OOKG 2P1OB 1DS9A 1D0BA 5FTTB 1O6VA 2WFHA 4LXRA 4R58A 1P9AG 3VQ1A 5AWCA 2BNHA 4NKHA 3JB9j 2P1NB 4P8SA 3GOZA 3DZEA 3O53A 2O6RA 2Z66A 1M10B 4R09A 4V2DA 2V70A 4R6AA 3G39A 5IYXC 5HDHA 4AW4A 4WYKA 3OJAA 3RJ0A 2IFGA 3ZYOA 1GWBA 4Z79A 4R5DA 4BSSA 1PGVA 2ASSB 4RWTC 4WP6A 4U7LA 4U06A 3W3NA 3P72A 1KOHA 4R07A 4CC4A 1U0ND 1QYYA 4LSXC 3RGZA 2P1MB 2O6QA 4ECNA 3RW7A 3REZA 4MN8B 1ZIWA 3UL8A 3WPDA 5GMGA 1XWDC 3C6OB 2O6SA 4LSAA 5AWDA 3RFSA 2WQVA 5AWAA 4PEQB 4FD0A 4NKGA 3UN9A 4Z61C 4L3FA 3WPEA 2WQWA 5GMFA 2CA6A 4RCWA 2OMZA 1FS2A 1FO1A 3E3ZA 4CNMA 4CNCA 4BSUA 4QXEA 3OGKB 3O6NA 5GMHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4H09 A;  2JE0 A;  3A79 B;  1XEU A;  4Y61 B;  2OMV A;  2FT3 A;  4R6J A;  4PQ8 A;  3OGL B;  4C2A B;  2WQU A;  4AY9 X;  5GS2 B;  3W3J A;  2Z81 A;  3UL9 A;  1M0Z A;  4M7E C;  2V9T B;  3ZYN A;  2A0Z A;  2RR6 A;  4Q3G A;  3RFE A;  4HQ1 A;  2Z7X B;  4GT6 A;  1G9U A;  1A9N A;  5GS0 A;  4U09 A;  2P1Q B;  2Z63 A;  3OGM B;  4LI1 A;  4U08 A;  2XOT A;  1DCE A;  4L3A A;  4V2C A;  3RFJ A;  1W8A A;  4KNG A;  4XSQ A;  4BSR A;  2JE1 A;  2V9S A;  4LSC A;  4FMZ A;  2Z62 A;  1SQ0 B;  1K5D C;  2OMW A;  4PER A;  3OJA B;  1XEC A;  5AWB A;  5D3I A;  2JQD A;  4QBZ A;  3G3A A;  4TZH A;  4R5C A;  3WPB A;  3M19 A;  3ULV A;  4GLP A;  4BV4 R;  4C2B B;  1H6T A;  4EZG A;  3E4G A;  1M9L A;  3G3B A;  1Z7X W;  4LI2 A;  3C6N B;  4G8A A;  1FT8 A;  3WPI A;  3ZYI A;  4CIL A;  2Z65 A;  3UL7 A;  5CMP A;  4J4L A;  4I6J B;  5HZL B;  3VQ2 A;  2ID5 A;  3W3L A;  3RGX A;  1WWL A;  3CIY A;  3G06 A;  4ARN A;  3WN4 A;  3ZYJ A;  2BEX A;  4CP6 A;  4XGO A;  4Z94 G;  4OQT A;  1OTO A;  5B0T A;  5IJC A;  5LFN A;  5A5C A;  2R9U A;  3M18 A;  2P1P B;  1JL5 A;  2AST B;  5AZ5 A;  1M9S A;  4XOS A;  2Z82 A;  2OMY A;  3E6J A;  4ARR A;  4R0A A;  1P8V A;  4YEB B;  1IO0 A;  5CMN A;  3FXI A;  4Q62 A;  4UFR A;  1OTN A;  1XCD A;  4IM6 A;  2RA8 A;  4Z64 C;  3WPG A;  1P8T A;  3KJ4 A;  4RCA B;  1LTX A;  1A4Y A;  1FQV A;  1H6U A;  4LSX A;  3WPF A;  3CVR A;  5IJD A;  4J0M A;  5IJB A;  1YRG A;  5B4P A;  4R6F A;  3ULU A;  4V2E A;  2Z64 A;  4KXF B;  4B8C D;  3RW6 A;  4FHO A;  3CIG A;  4R6G A;  4FDW A;  4PSJ A;  3E2J A;  3W3G A;  3WPC A;  3W3K A;  2OMT A;  4CC4 C;  4ECO A;  1XKU A;  1OGQ A;  4KT1 A;  2UZY A;  2OMU A;  4FCG A;  2Q4G W;  3WPH A;  3ULA A;  1OTM A;  3TSR E;  3BZ5 A;  2ELL A;  3W3M A;  1DFJ I;  1KOO A;  3G04 C;  4Z8G A;  1K5G C;  2UZX A;  4Q3I A;  1O6S A;  4PKI G;  4QC0 A;  3SB4 A;  3PMH G;  4K17 A;  4MQW X;  2Y5Q A;  3RIZ A;  1O6T A;  2WQX A;  3C6P B;  4P91 A;  5GQR K;  2XWT C;  4FS7 A;  4LXS A;  1OZN A;  2Z7X A;  4M7E A;  5B0N A;  2OMX A;  4R08 A;  1OOK G;  2P1O B;  1DS9 A;  1D0B A;  5FTT B;  1O6V A;  2WFH A;  4LXR A;  4R58 A;  1P9A G;  3VQ1 A;  5AWC A;  2BNH A;  4NKH A;  3JB9 j;  2P1N B;  4P8S A;  3GOZ A;  3DZE A;  3O53 A;  2O6R A;  2Z66 A;  1M10 B;  4R09 A;  4V2D A;  2V70 A;  4R6A A;  3G39 A;  5IYX C;  5HDH A;  4AW4 A;  4WYK A;  3OJA A;  3RJ0 A;  2IFG A;  3ZYO A;  1GWB A;  4Z79 A;  4R5D A;  4BSS A;  1PGV A;  2ASS B;  4RWT C;  4WP6 A;  4U7L A;  4U06 A;  3W3N A;  3P72 A;  1KOH A;  4R07 A;  4CC4 A;  1U0N D;  1QYY A;  4LSX C;  3RGZ A;  2P1M B;  2O6Q A;  4ECN A;  3RW7 A;  3REZ A;  4MN8 B;  1ZIW A;  3UL8 A;  3WPD A;  5GMG A;  1XWD C;  3C6O B;  2O6S A;  4LSA A;  5AWD A;  3RFS A;  2WQV A;  5AWA A;  4PEQ B;  4FD0 A;  4NKG A;  3UN9 A;  4Z61 C;  4L3F A;  3WPE A;  2WQW A;  5GMF A;  2CA6 A;  4RCW A;  2OMZ A;  1FS2 A;  1FO1 A;  3E3Z A;  4CNM A;  4CNC A;  4BSU A;  4QXE A;  3OGK B;  3O6N A;  5GMH A; 
#chains in the Genus database with same CATH topology
 4H09 A;  2JE0 A;  3A79 B;  1XEU A;  4Y61 B;  2OMV A;  2FT3 A;  4R6J A;  4PQ8 A;  3OGL B;  4C2A B;  2WQU A;  4AY9 X;  5GS2 B;  3W3J A;  2Z81 A;  3UL9 A;  1M0Z A;  4M7E C;  2V9T B;  3ZYN A;  2A0Z A;  2RR6 A;  4Q3G A;  3RFE A;  4HQ1 A;  2Z7X B;  4GT6 A;  1G9U A;  1A9N A;  5GS0 A;  4U09 A;  2P1Q B;  2Z63 A;  3OGM B;  4LI1 A;  4U08 A;  2XOT A;  1DCE A;  4L3A A;  4V2C A;  3RFJ A;  1W8A A;  4KNG A;  4XSQ A;  4BSR A;  2JE1 A;  2V9S A;  4LSC A;  4FMZ A;  2Z62 A;  1SQ0 B;  1K5D C;  2OMW A;  4PER A;  3OJA B;  1XEC A;  5AWB A;  5D3I A;  2JQD A;  4QBZ A;  3G3A A;  4TZH A;  4R5C A;  3WPB A;  3M19 A;  3ULV A;  4GLP A;  4BV4 R;  4C2B B;  1H6T A;  4EZG A;  3E4G A;  1M9L A;  3G3B A;  1Z7X W;  4LI2 A;  3C6N B;  4G8A A;  1FT8 A;  3WPI A;  3ZYI A;  4CIL A;  2Z65 A;  3UL7 A;  5CMP A;  4J4L A;  4I6J B;  5HZL B;  3VQ2 A;  2ID5 A;  3W3L A;  3RGX A;  1WWL A;  3CIY A;  3G06 A;  4ARN A;  3WN4 A;  3ZYJ A;  2BEX A;  4CP6 A;  4XGO A;  4Z94 G;  4OQT A;  1OTO A;  5B0T A;  5IJC A;  5LFN A;  5A5C A;  2R9U A;  3M18 A;  2P1P B;  1JL5 A;  2AST B;  5AZ5 A;  1M9S A;  4XOS A;  2Z82 A;  2OMY A;  3E6J A;  4ARR A;  4R0A A;  1P8V A;  4YEB B;  1IO0 A;  5CMN A;  3FXI A;  4Q62 A;  4UFR A;  1OTN A;  1XCD A;  4IM6 A;  2RA8 A;  4Z64 C;  3WPG A;  1P8T A;  3KJ4 A;  4RCA B;  1LTX A;  1A4Y A;  1FQV A;  1H6U A;  4LSX A;  3WPF A;  4NZR M;  3CVR A;  5IJD A;  4J0M A;  5IJB A;  1YRG A;  5B4P A;  4R6F A;  3ULU A;  4V2E A;  2Z64 A;  4KXF B;  4B8C D;  3RW6 A;  4FHO A;  3CIG A;  4R6G A;  4FDW A;  4PSJ A;  3E2J A;  3W3G A;  3WPC A;  3W3K A;  2OMT A;  4CC4 C;  4ECO A;  1XKU A;  1OGQ A;  4KT1 A;  2UZY A;  2OMU A;  4FCG A;  2Q4G W;  3WPH A;  3ULA A;  1OTM A;  3TSR E;  3BZ5 A;  2ELL A;  3W3M A;  1DFJ I;  1KOO A;  3G04 C;  4Z8G A;  1K5G C;  2UZX A;  4Q3I A;  1O6S A;  4PKI G;  4QC0 A;  3SB4 A;  3PMH G;  4K17 A;  4MQW X;  2Y5Q A;  3RIZ A;  1O6T A;  2WQX A;  3C6P B;  4P91 A;  5GQR K;  2XWT C;  4FS7 A;  4LXS A;  1OZN A;  2Z7X A;  4M7E A;  5B0N A;  2OMX A;  4R08 A;  1OOK G;  2P1O B;  1DS9 A;  1D0B A;  5FTT B;  1O6V A;  2WFH A;  4LXR A;  4R58 A;  1P9A G;  3VQ1 A;  5AWC A;  2BNH A;  4NKH A;  4NZT M;  3JB9 j;  2P1N B;  4P8S A;  3GOZ A;  3DZE A;  3O53 A;  2O6R A;  2Z66 A;  1M10 B;  4R09 A;  4V2D A;  2V70 A;  4R6A A;  3G39 A;  5IYX C;  5HDH A;  4AW4 A;  4WYK A;  3OJA A;  3RJ0 A;  2IFG A;  3ZYO A;  1GWB A;  4Z79 A;  4R5D A;  4BSS A;  1PGV A;  2ASS B;  4RWT C;  4WP6 A;  4U7L A;  4U06 A;  3W3N A;  3P72 A;  1KOH A;  4R07 A;  4CC4 A;  1U0N D;  1QYY A;  4LSX C;  3RGZ A;  2P1M B;  2O6Q A;  4ECN A;  3RW7 A;  3REZ A;  4MN8 B;  1ZIW A;  3UL8 A;  3WPD A;  5GMG A;  1XWD C;  3C6O B;  2O6S A;  4LSA A;  5AWD A;  3RFS A;  2WQV A;  5AWA A;  4PEQ B;  4FD0 A;  4NKG A;  3UN9 A;  4Z61 C;  4L3F A;  3WPE A;  2WQW A;  5GMF A;  2CA6 A;  4RCW A;  2OMZ A;  1FS2 A;  1FO1 A;  3E3Z A;  4CNM A;  4CNC A;  4BSU A;  4QXE A;  3OGK B;  3O6N A;  5GMH A; 
#chains in the Genus database with same CATH homology
 4H09 A;  2JE0 A;  3A79 B;  1XEU A;  4Y61 B;  2OMV A;  2FT3 A;  4R6J A;  4PQ8 A;  3OGL B;  4C2A B;  2WQU A;  4AY9 X;  5GS2 B;  3W3J A;  2Z81 A;  3UL9 A;  1M0Z A;  4M7E C;  2V9T B;  3ZYN A;  2A0Z A;  2RR6 A;  4Q3G A;  3RFE A;  4HQ1 A;  2Z7X B;  4GT6 A;  1G9U A;  1A9N A;  5GS0 A;  4U09 A;  2P1Q B;  2Z63 A;  3OGM B;  4LI1 A;  4U08 A;  2XOT A;  1DCE A;  4L3A A;  4V2C A;  3RFJ A;  1W8A A;  4KNG A;  4XSQ A;  4BSR A;  2JE1 A;  2V9S A;  4LSC A;  4FMZ A;  2Z62 A;  1SQ0 B;  1K5D C;  2OMW A;  4PER A;  3OJA B;  1XEC A;  5AWB A;  5D3I A;  2JQD A;  4QBZ A;  3G3A A;  4TZH A;  4R5C A;  3WPB A;  3M19 A;  3ULV A;  4GLP A;  4BV4 R;  4C2B B;  1H6T A;  4EZG A;  3E4G A;  1M9L A;  3G3B A;  1Z7X W;  4LI2 A;  3C6N B;  4G8A A;  1FT8 A;  3WPI A;  3ZYI A;  4CIL A;  2Z65 A;  3UL7 A;  5CMP A;  4J4L A;  4I6J B;  5HZL B;  3VQ2 A;  2ID5 A;  3W3L A;  3RGX A;  1WWL A;  3CIY A;  3G06 A;  4ARN A;  3WN4 A;  3ZYJ A;  2BEX A;  4CP6 A;  4XGO A;  4Z94 G;  4OQT A;  1OTO A;  5B0T A;  5IJC A;  5LFN A;  5A5C A;  2R9U A;  3M18 A;  2P1P B;  1JL5 A;  2AST B;  5AZ5 A;  1M9S A;  4XOS A;  2Z82 A;  2OMY A;  3E6J A;  4ARR A;  4R0A A;  1P8V A;  4YEB B;  1IO0 A;  5CMN A;  3FXI A;  4Q62 A;  4UFR A;  1OTN A;  1XCD A;  4IM6 A;  2RA8 A;  4Z64 C;  3WPG A;  1P8T A;  3KJ4 A;  4RCA B;  1LTX A;  1A4Y A;  1FQV A;  1H6U A;  4LSX A;  3WPF A;  3CVR A;  5IJD A;  4J0M A;  5IJB A;  1YRG A;  5B4P A;  4R6F A;  3ULU A;  4V2E A;  2Z64 A;  4KXF B;  4B8C D;  3RW6 A;  4FHO A;  3CIG A;  4R6G A;  4FDW A;  4PSJ A;  3E2J A;  3W3G A;  3WPC A;  3W3K A;  2OMT A;  4CC4 C;  4ECO A;  1XKU A;  1OGQ A;  4KT1 A;  2UZY A;  2OMU A;  4FCG A;  2Q4G W;  3WPH A;  3ULA A;  1OTM A;  3TSR E;  3BZ5 A;  2ELL A;  3W3M A;  1DFJ I;  1KOO A;  3G04 C;  4Z8G A;  1K5G C;  2UZX A;  4Q3I A;  1O6S A;  4PKI G;  4QC0 A;  3SB4 A;  3PMH G;  4K17 A;  4MQW X;  2Y5Q A;  3RIZ A;  1O6T A;  2WQX A;  3C6P B;  4P91 A;  5GQR K;  2XWT C;  4FS7 A;  4LXS A;  1OZN A;  2Z7X A;  4M7E A;  5B0N A;  2OMX A;  4R08 A;  1OOK G;  2P1O B;  1DS9 A;  1D0B A;  5FTT B;  1O6V A;  2WFH A;  4LXR A;  4R58 A;  1P9A G;  3VQ1 A;  5AWC A;  2BNH A;  4NKH A;  3JB9 j;  2P1N B;  4P8S A;  3GOZ A;  3DZE A;  3O53 A;  2O6R A;  2Z66 A;  1M10 B;  4R09 A;  4V2D A;  2V70 A;  4R6A A;  3G39 A;  5IYX C;  5HDH A;  4AW4 A;  4WYK A;  3OJA A;  3RJ0 A;  2IFG A;  3ZYO A;  1GWB A;  4Z79 A;  4R5D A;  4BSS A;  1PGV A;  2ASS B;  4RWT C;  4WP6 A;  4U7L A;  4U06 A;  3W3N A;  3P72 A;  1KOH A;  4R07 A;  4CC4 A;  1U0N D;  1QYY A;  4LSX C;  3RGZ A;  2P1M B;  2O6Q A;  4ECN A;  3RW7 A;  3REZ A;  4MN8 B;  1ZIW A;  3UL8 A;  3WPD A;  5GMG A;  1XWD C;  3C6O B;  2O6S A;  4LSA A;  5AWD A;  3RFS A;  2WQV A;  5AWA A;  4PEQ B;  4FD0 A;  4NKG A;  3UN9 A;  4Z61 C;  4L3F A;  3WPE A;  2WQW A;  5GMF A;  2CA6 A;  4RCW A;  2OMZ A;  1FS2 A;  1FO1 A;  3E3Z A;  4CNM A;  4CNC A;  4BSU A;  4QXE A;  3OGK B;  3O6N A;  5GMH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...