2O6RA

Structural diversity of the hagfish variable lymphocyte receptors b61
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
177
structure length
177
Chain Sequence
CPSRCSCSGTEIRCNSKGLTSVPTGIPSSATRLELESNKLQSLPHGVFDKLTQLTKLSLSQNQIQSLPDGVFDKLTKLTILYLHENKLQSLPNGVFDKLTQLKELALDTNQLKSVPDGIFDRLTSLQKIWLHTNPWDCSCPRIDYLSRWLNKNSQKEQGSAKCSGSGKPVRSIICPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Variable lymphocyte receptor B
publication title Structural diversity of the hagfish variable lymphocyte receptors
pubmed doi rcsb
source organism Eptatretus burgeri
molecule tags Immune system
total genus 53
structure length 177
sequence length 177
ec nomenclature
pdb deposition date 2006-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13855 LRR_8 Leucine rich repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 2o6rA00
3ZYJA 4AY9X 1U0ND 1JL5A 3OJAB 5B0NA 5IJDA 3WPDA 2V9TB 1OOKG 2OMZA 2Q4GW 4U06A 4YEBB 4CNMA 2Z63A 1K5GC 3VQ1A 4AW4A 5GQRK 3RFJA 4Z8GA 2BEXA 5GMHA 3UL8A 3M18A 5AWCA 3W3NA 4LXSA 5GMGA 4R6JA 5A5CA 4R6FA 3RFEA 4LSXA 2O6QA 2XWTC 4RCAB 4TZHA 3ZYIA 3WPGA 2JE0A 1M9SA 1OZNA 4LSAA 1O6VA 1XKUA 2P1OB 4QBZA 4CILA 2ELLA 3O53A 4CC4C 1YRGA 4MQWX 2OMTA 4PEQB 4Q3GA 3RGZA 5GS2B 1FS2A 2WQWA 2R9UA 4LI2A 4MN8B 1GWBA 2Z66A 3RFSA 1D0BA 2WQVA 4WP6A 2P1QB 5AWBA 4R08A 3SB4A 5IYXC 4PKIG 1IO0A 3PMHG 3P72A 2JQDA 3WPCA 2UZXA 4UFRA 1K5DC 2V70A 1P9AG 4CC4A 2JE1A 3ULVA 4KNGA 4J4LA 3C6PB 1KOOA 3CIGA 3OGKB 5HZLB 1M9LA 4Z61C 1P8VA 4Q3IA 3E4GA 3RW6A 3G3BA 4V2CA 4M7EC 4CP6A 2WQXA 4PQ8A 1XCDA 1FQVA 4U7LA 4R5DA 2Z82A 2Z7XA 3C6NB 4KXFB 4C2AB 2OMUA 5IJCA 4FDWA 3ULUA 3OJAA 1ZIWA 4OQTA 2ID5A 3ULAA 1LTXA 5IJBA 4L3FA 4U09A 3W3GA 1WWLA 5B0TA 2P1NB 4K17A 3TSRE 4BSUA 4ARNA 1FT8A 4P91A 2Z62A 4M7EA 4NKHA 4V2DA 1FO1A 1XECA 1KOHA 3DZEA 2OMXA 4CNCA 5CMPA 3ZYOA 4R6AA 5GMFA 3WPIA 1O6TA 4PSJA 3WPBA 3ZYNA 4KT1A 1QYYA 4FS7A 3G06A 3C6OB 4NKGA 2BNHA 3UL9A 4B8CD 4FD0A 4FCGA 4ARRA 1A4YA 2CA6A 4BV4R 1OTOA 2IFGA 2P1PB 3UN9A 2Z81A 4Z79A 2UZYA 4R58A 4PERA 2Z65A 3W3JA 1OTMA 4Z64C 3UL7A 5B4PA 4XSQA 1DS9A 4C2BB 4QXEA 5FTTB 4P8SA 1M0ZA 1OTNA 4G8AA 2V9SA 2Z7XB 3O6NA 4GT6A 3W3LA 2O6RA 3FXIA 3W3MA 1M10B 4BSRA 5AWDA 4XOSA 1P8TA 3CIYA 3M19A 2XOTA 4IM6A 2ASTB 3RJ0A 4RCWA 3G3AA 3GOZA 4FMZA 2A0ZA 4V2EA 3OGMB 3W3KA 3RIZA 3RGXA 1SQ0B 4QC0A 4LSCA 3JB9j 4Z94G 1A9NA 2WFHA 3OGLB 1DFJI 1DCEA 4I6JB 4R09A 2FT3A 5AZ5A 2Y5QA 5LFNA 4H09A 4GLPA 1H6UA 5AWAA 4ECOA 5HDHA 2P1MB 3WN4A 5GS0A 4FHOA 4Q62A 4R07A 3WPHA 2O6SA 3G39A 3KJ4A 3E2JA 3VQ2A 2RR6A 4R0AA 2WQUA 3E6JA 2OMVA 4RWTC 3E3ZA 4WYKA 1H6TA 1Z7XW 3RW7A 3BZ5A 3WPEA 1O6SA 4LI1A 3CVRA 2ASSB 4L3AA 3G04C 2RA8A 5D3IA 1XWDC 3WPFA 2OMWA 4ECNA 2Z64A 4Y61B 4U08A 4BSSA 2OMYA 1OGQA 3A79B 4R5CA 5CMNA 3REZA 4XGOA 4R6GA 4HQ1A 1G9UA 4J0MA 1W8AA 1PGVA 4LXRA 4LSXC 1XEUA 4EZGA
chains in the Genus database with same CATH superfamily
3ZYJA 4AY9X 1U0ND 1JL5A 3OJAB 5B0NA 5IJDA 3WPDA 2V9TB 1OOKG 2OMZA 2Q4GW 4U06A 4YEBB 4CNMA 2Z63A 1K5GC 3VQ1A 4AW4A 5GQRK 3RFJA 4Z8GA 2BEXA 5GMHA 3UL8A 3M18A 5AWCA 3W3NA 4LXSA 5GMGA 4R6JA 5A5CA 4R6FA 3RFEA 4LSXA 2O6QA 2XWTC 4RCAB 4TZHA 3ZYIA 3WPGA 2JE0A 1M9SA 1OZNA 4LSAA 1O6VA 1XKUA 2P1OB 4QBZA 4CILA 2ELLA 3O53A 4CC4C 1YRGA 4MQWX 2OMTA 4PEQB 4Q3GA 3RGZA 5GS2B 1FS2A 2WQWA 2R9UA 4LI2A 4MN8B 1GWBA 2Z66A 3RFSA 1D0BA 2WQVA 4WP6A 2P1QB 5AWBA 4R08A 3SB4A 5IYXC 4PKIG 1IO0A 3PMHG 3P72A 2JQDA 3WPCA 2UZXA 4UFRA 1K5DC 2V70A 1P9AG 4CC4A 2JE1A 3ULVA 4KNGA 4J4LA 4NZRM 3C6PB 1KOOA 3CIGA 3OGKB 5HZLB 1M9LA 4Z61C 1P8VA 4Q3IA 3E4GA 3RW6A 3G3BA 4V2CA 4M7EC 4CP6A 2WQXA 4PQ8A 1XCDA 1FQVA 4U7LA 4R5DA 2Z82A 2Z7XA 3C6NB 4KXFB 4C2AB 2OMUA 5IJCA 4FDWA 3ULUA 3OJAA 1ZIWA 4OQTA 2ID5A 3ULAA 1LTXA 5IJBA 4L3FA 4U09A 3W3GA 1WWLA 5B0TA 2P1NB 4K17A 3TSRE 4BSUA 4ARNA 1FT8A 4P91A 2Z62A 4NZTM 4NKHA 4M7EA 4V2DA 1FO1A 1XECA 1KOHA 3DZEA 2OMXA 4CNCA 5CMPA 3ZYOA 4R6AA 5GMFA 3WPIA 1O6TA 4PSJA 3WPBA 3ZYNA 4KT1A 1QYYA 4FS7A 3G06A 3C6OB 4NKGA 2BNHA 3UL9A 4B8CD 4FD0A 4FCGA 4ARRA 1A4YA 2CA6A 4BV4R 1OTOA 2IFGA 2P1PB 3UN9A 2Z81A 4Z79A 2UZYA 4R58A 4PERA 2Z65A 3W3JA 1OTMA 4Z64C 3UL7A 5B4PA 4XSQA 1DS9A 4C2BB 4QXEA 5FTTB 4P8SA 1M0ZA 1OTNA 4G8AA 2V9SA 2Z7XB 3O6NA 4GT6A 3W3LA 2O6RA 3FXIA 3W3MA 1M10B 4BSRA 5AWDA 4XOSA 1P8TA 3CIYA 3M19A 2XOTA 4IM6A 2ASTB 3RJ0A 4RCWA 3G3AA 3GOZA 4FMZA 2A0ZA 4V2EA 3OGMB 3W3KA 3RIZA 3RGXA 1SQ0B 4QC0A 4LSCA 3JB9j 4Z94G 1A9NA 2WFHA 3OGLB 1DFJI 1DCEA 4I6JB 4R09A 2FT3A 5AZ5A 2Y5QA 5LFNA 4H09A 4GLPA 1H6UA 5AWAA 4ECOA 5HDHA 2P1MB 3WN4A 5GS0A 4FHOA 4Q62A 4R07A 3WPHA 2O6SA 3G39A 3KJ4A 3E2JA 3VQ2A 2RR6A 4R0AA 2WQUA 3E6JA 2OMVA 4RWTC 3E3ZA 4WYKA 1H6TA 1Z7XW 3RW7A 3BZ5A 3WPEA 1O6SA 4LI1A 3CVRA 2ASSB 4L3AA 3G04C 2RA8A 5D3IA 1XWDC 3WPFA 2OMWA 4ECNA 2Z64A 4Y61B 4U08A 4BSSA 2OMYA 1OGQA 3A79B 4R5CA 5CMNA 3REZA 4XGOA 4R6GA 4HQ1A 1G9UA 4J0MA 1W8AA 1PGVA 4LXRA 4LSXC 1XEUA 4EZGA
chains in the Genus database with same CATH topology
3ZYJA 4AY9X 1U0ND 1JL5A 3OJAB 5B0NA 5IJDA 3WPDA 2V9TB 1OOKG 2OMZA 2Q4GW 4U06A 4YEBB 4CNMA 2Z63A 1K5GC 3VQ1A 4AW4A 5GQRK 3RFJA 4Z8GA 2BEXA 5GMHA 3UL8A 3M18A 5AWCA 3W3NA 4LXSA 5GMGA 4R6JA 5A5CA 4R6FA 3RFEA 4LSXA 2O6QA 2XWTC 4RCAB 4TZHA 3ZYIA 3WPGA 2JE0A 1M9SA 1OZNA 4LSAA 1O6VA 1XKUA 2P1OB 4QBZA 4CILA 2ELLA 3O53A 4CC4C 1YRGA 4MQWX 2OMTA 4PEQB 4Q3GA 3RGZA 5GS2B 1FS2A 2WQWA 2R9UA 4LI2A 4MN8B 1GWBA 2Z66A 3RFSA 1D0BA 2WQVA 4WP6A 2P1QB 5AWBA 4R08A 3SB4A 5IYXC 4PKIG 1IO0A 3PMHG 3P72A 2JQDA 3WPCA 2UZXA 4UFRA 1K5DC 2V70A 1P9AG 4CC4A 2JE1A 3ULVA 4KNGA 4J4LA 3C6PB 1KOOA 3CIGA 3OGKB 5HZLB 1M9LA 4Z61C 1P8VA 4Q3IA 3E4GA 3RW6A 3G3BA 4V2CA 4M7EC 4CP6A 2WQXA 4PQ8A 1XCDA 1FQVA 4U7LA 4R5DA 2Z82A 2Z7XA 3C6NB 4KXFB 4C2AB 2OMUA 5IJCA 4FDWA 3ULUA 3OJAA 1ZIWA 4OQTA 2ID5A 3ULAA 1LTXA 5IJBA 4L3FA 4U09A 3W3GA 1WWLA 5B0TA 2P1NB 4K17A 3TSRE 4BSUA 4ARNA 1FT8A 4P91A 2Z62A 4M7EA 4NKHA 4V2DA 1FO1A 1XECA 1KOHA 3DZEA 2OMXA 4CNCA 5CMPA 3ZYOA 4R6AA 5GMFA 3WPIA 1O6TA 4PSJA 3WPBA 3ZYNA 4KT1A 1QYYA 4FS7A 3G06A 3C6OB 4NKGA 2BNHA 3UL9A 4B8CD 4FD0A 4FCGA 4ARRA 1A4YA 2CA6A 4BV4R 1OTOA 2IFGA 2P1PB 3UN9A 2Z81A 4Z79A 2UZYA 4R58A 4PERA 2Z65A 3W3JA 1OTMA 4Z64C 3UL7A 5B4PA 4XSQA 1DS9A 4C2BB 4QXEA 5FTTB 4P8SA 1M0ZA 1OTNA 4G8AA 2V9SA 2Z7XB 3O6NA 4GT6A 3W3LA 2O6RA 3FXIA 3W3MA 1M10B 4BSRA 5AWDA 4XOSA 1P8TA 3CIYA 3M19A 2XOTA 4IM6A 2ASTB 3RJ0A 4RCWA 3G3AA 3GOZA 4FMZA 2A0ZA 4V2EA 3OGMB 3W3KA 3RIZA 3RGXA 1SQ0B 4QC0A 4LSCA 3JB9j 4Z94G 1A9NA 2WFHA 3OGLB 1DFJI 1DCEA 4I6JB 4R09A 2FT3A 5AZ5A 2Y5QA 5LFNA 4H09A 4GLPA 1H6UA 5AWAA 4ECOA 5HDHA 2P1MB 3WN4A 5GS0A 4FHOA 4Q62A 4R07A 3WPHA 2O6SA 3G39A 3KJ4A 3E2JA 3VQ2A 2RR6A 4R0AA 2WQUA 3E6JA 2OMVA 4RWTC 3E3ZA 4WYKA 1H6TA 1Z7XW 3RW7A 3BZ5A 3WPEA 1O6SA 4LI1A 3CVRA 2ASSB 4L3AA 3G04C 2RA8A 5D3IA 1XWDC 3WPFA 2OMWA 4ECNA 2Z64A 4Y61B 4U08A 4BSSA 2OMYA 1OGQA 3A79B 4R5CA 5CMNA 3REZA 4XGOA 4R6GA 4HQ1A 1G9UA 4J0MA 1W8AA 1PGVA 4LXRA 4LSXC 1XEUA 4EZGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZYJ A;  4AY9 X;  1U0N D;  1JL5 A;  3OJA B;  5B0N A;  5IJD A;  3WPD A;  2V9T B;  1OOK G;  2OMZ A;  2Q4G W;  4U06 A;  4YEB B;  4CNM A;  2Z63 A;  1K5G C;  3VQ1 A;  4AW4 A;  5GQR K;  3RFJ A;  4Z8G A;  2BEX A;  5GMH A;  3UL8 A;  3M18 A;  5AWC A;  3W3N A;  4LXS A;  5GMG A;  4R6J A;  5A5C A;  4R6F A;  3RFE A;  4LSX A;  2O6Q A;  2XWT C;  4RCA B;  4TZH A;  3ZYI A;  3WPG A;  2JE0 A;  1M9S A;  1OZN A;  4LSA A;  1O6V A;  1XKU A;  2P1O B;  4QBZ A;  4CIL A;  2ELL A;  3O53 A;  4CC4 C;  1YRG A;  4MQW X;  2OMT A;  4PEQ B;  4Q3G A;  3RGZ A;  5GS2 B;  1FS2 A;  2WQW A;  2R9U A;  4LI2 A;  4MN8 B;  1GWB A;  2Z66 A;  3RFS A;  1D0B A;  2WQV A;  4WP6 A;  2P1Q B;  5AWB A;  4R08 A;  3SB4 A;  5IYX C;  4PKI G;  1IO0 A;  3PMH G;  3P72 A;  2JQD A;  3WPC A;  2UZX A;  4UFR A;  1K5D C;  2V70 A;  1P9A G;  4CC4 A;  2JE1 A;  3ULV A;  4KNG A;  4J4L A;  3C6P B;  1KOO A;  3CIG A;  3OGK B;  5HZL B;  1M9L A;  4Z61 C;  1P8V A;  4Q3I A;  3E4G A;  3RW6 A;  3G3B A;  4V2C A;  4M7E C;  4CP6 A;  2WQX A;  4PQ8 A;  1XCD A;  1FQV A;  4U7L A;  4R5D A;  2Z82 A;  2Z7X A;  3C6N B;  4KXF B;  4C2A B;  2OMU A;  5IJC A;  4FDW A;  3ULU A;  3OJA A;  1ZIW A;  4OQT A;  2ID5 A;  3ULA A;  1LTX A;  5IJB A;  4L3F A;  4U09 A;  3W3G A;  1WWL A;  5B0T A;  2P1N B;  4K17 A;  3TSR E;  4BSU A;  4ARN A;  1FT8 A;  4P91 A;  2Z62 A;  4M7E A;  4NKH A;  4V2D A;  1FO1 A;  1XEC A;  1KOH A;  3DZE A;  2OMX A;  4CNC A;  5CMP A;  3ZYO A;  4R6A A;  5GMF A;  3WPI A;  1O6T A;  4PSJ A;  3WPB A;  3ZYN A;  4KT1 A;  1QYY A;  4FS7 A;  3G06 A;  3C6O B;  4NKG A;  2BNH A;  3UL9 A;  4B8C D;  4FD0 A;  4FCG A;  4ARR A;  1A4Y A;  2CA6 A;  4BV4 R;  1OTO A;  2IFG A;  2P1P B;  3UN9 A;  2Z81 A;  4Z79 A;  2UZY A;  4R58 A;  4PER A;  2Z65 A;  3W3J A;  1OTM A;  4Z64 C;  3UL7 A;  5B4P A;  4XSQ A;  1DS9 A;  4C2B B;  4QXE A;  5FTT B;  4P8S A;  1M0Z A;  1OTN A;  4G8A A;  2V9S A;  2Z7X B;  3O6N A;  4GT6 A;  3W3L A;  2O6R A;  3FXI A;  3W3M A;  1M10 B;  4BSR A;  5AWD A;  4XOS A;  1P8T A;  3CIY A;  3M19 A;  2XOT A;  4IM6 A;  2AST B;  3RJ0 A;  4RCW A;  3G3A A;  3GOZ A;  4FMZ A;  2A0Z A;  4V2E A;  3OGM B;  3W3K A;  3RIZ A;  3RGX A;  1SQ0 B;  4QC0 A;  4LSC A;  3JB9 j;  4Z94 G;  1A9N A;  2WFH A;  3OGL B;  1DFJ I;  1DCE A;  4I6J B;  4R09 A;  2FT3 A;  5AZ5 A;  2Y5Q A;  5LFN A;  4H09 A;  4GLP A;  1H6U A;  5AWA A;  4ECO A;  5HDH A;  2P1M B;  3WN4 A;  5GS0 A;  4FHO A;  4Q62 A;  4R07 A;  3WPH A;  2O6S A;  3G39 A;  3KJ4 A;  3E2J A;  3VQ2 A;  2RR6 A;  4R0A A;  2WQU A;  3E6J A;  2OMV A;  4RWT C;  3E3Z A;  4WYK A;  1H6T A;  1Z7X W;  3RW7 A;  3BZ5 A;  3WPE A;  1O6S A;  4LI1 A;  3CVR A;  2ASS B;  4L3A A;  3G04 C;  2RA8 A;  5D3I A;  1XWD C;  3WPF A;  2OMW A;  4ECN A;  2Z64 A;  4Y61 B;  4U08 A;  4BSS A;  2OMY A;  1OGQ A;  3A79 B;  4R5C A;  5CMN A;  3REZ A;  4XGO A;  4R6G A;  4HQ1 A;  1G9U A;  4J0M A;  1W8A A;  1PGV A;  4LXR A;  4LSX C;  1XEU A;  4EZG A; 
#chains in the Genus database with same CATH topology
 3ZYJ A;  4AY9 X;  1U0N D;  1JL5 A;  3OJA B;  5B0N A;  5IJD A;  3WPD A;  2V9T B;  1OOK G;  2OMZ A;  2Q4G W;  4U06 A;  4YEB B;  4CNM A;  2Z63 A;  1K5G C;  3VQ1 A;  4AW4 A;  5GQR K;  3RFJ A;  4Z8G A;  2BEX A;  5GMH A;  3UL8 A;  3M18 A;  5AWC A;  3W3N A;  4LXS A;  5GMG A;  4R6J A;  5A5C A;  4R6F A;  3RFE A;  4LSX A;  2O6Q A;  2XWT C;  4RCA B;  4TZH A;  3ZYI A;  3WPG A;  2JE0 A;  1M9S A;  1OZN A;  4LSA A;  1O6V A;  1XKU A;  2P1O B;  4QBZ A;  4CIL A;  2ELL A;  3O53 A;  4CC4 C;  1YRG A;  4MQW X;  2OMT A;  4PEQ B;  4Q3G A;  3RGZ A;  5GS2 B;  1FS2 A;  2WQW A;  2R9U A;  4LI2 A;  4MN8 B;  1GWB A;  2Z66 A;  3RFS A;  1D0B A;  2WQV A;  4WP6 A;  2P1Q B;  5AWB A;  4R08 A;  3SB4 A;  5IYX C;  4PKI G;  1IO0 A;  3PMH G;  3P72 A;  2JQD A;  3WPC A;  2UZX A;  4UFR A;  1K5D C;  2V70 A;  1P9A G;  4CC4 A;  2JE1 A;  3ULV A;  4KNG A;  4J4L A;  4NZR M;  3C6P B;  1KOO A;  3CIG A;  3OGK B;  5HZL B;  1M9L A;  4Z61 C;  1P8V A;  4Q3I A;  3E4G A;  3RW6 A;  3G3B A;  4V2C A;  4M7E C;  4CP6 A;  2WQX A;  4PQ8 A;  1XCD A;  1FQV A;  4U7L A;  4R5D A;  2Z82 A;  2Z7X A;  3C6N B;  4KXF B;  4C2A B;  2OMU A;  5IJC A;  4FDW A;  3ULU A;  3OJA A;  1ZIW A;  4OQT A;  2ID5 A;  3ULA A;  1LTX A;  5IJB A;  4L3F A;  4U09 A;  3W3G A;  1WWL A;  5B0T A;  2P1N B;  4K17 A;  3TSR E;  4BSU A;  4ARN A;  1FT8 A;  4P91 A;  2Z62 A;  4NZT M;  4NKH A;  4M7E A;  4V2D A;  1FO1 A;  1XEC A;  1KOH A;  3DZE A;  2OMX A;  4CNC A;  5CMP A;  3ZYO A;  4R6A A;  5GMF A;  3WPI A;  1O6T A;  4PSJ A;  3WPB A;  3ZYN A;  4KT1 A;  1QYY A;  4FS7 A;  3G06 A;  3C6O B;  4NKG A;  2BNH A;  3UL9 A;  4B8C D;  4FD0 A;  4FCG A;  4ARR A;  1A4Y A;  2CA6 A;  4BV4 R;  1OTO A;  2IFG A;  2P1P B;  3UN9 A;  2Z81 A;  4Z79 A;  2UZY A;  4R58 A;  4PER A;  2Z65 A;  3W3J A;  1OTM A;  4Z64 C;  3UL7 A;  5B4P A;  4XSQ A;  1DS9 A;  4C2B B;  4QXE A;  5FTT B;  4P8S A;  1M0Z A;  1OTN A;  4G8A A;  2V9S A;  2Z7X B;  3O6N A;  4GT6 A;  3W3L A;  2O6R A;  3FXI A;  3W3M A;  1M10 B;  4BSR A;  5AWD A;  4XOS A;  1P8T A;  3CIY A;  3M19 A;  2XOT A;  4IM6 A;  2AST B;  3RJ0 A;  4RCW A;  3G3A A;  3GOZ A;  4FMZ A;  2A0Z A;  4V2E A;  3OGM B;  3W3K A;  3RIZ A;  3RGX A;  1SQ0 B;  4QC0 A;  4LSC A;  3JB9 j;  4Z94 G;  1A9N A;  2WFH A;  3OGL B;  1DFJ I;  1DCE A;  4I6J B;  4R09 A;  2FT3 A;  5AZ5 A;  2Y5Q A;  5LFN A;  4H09 A;  4GLP A;  1H6U A;  5AWA A;  4ECO A;  5HDH A;  2P1M B;  3WN4 A;  5GS0 A;  4FHO A;  4Q62 A;  4R07 A;  3WPH A;  2O6S A;  3G39 A;  3KJ4 A;  3E2J A;  3VQ2 A;  2RR6 A;  4R0A A;  2WQU A;  3E6J A;  2OMV A;  4RWT C;  3E3Z A;  4WYK A;  1H6T A;  1Z7X W;  3RW7 A;  3BZ5 A;  3WPE A;  1O6S A;  4LI1 A;  3CVR A;  2ASS B;  4L3A A;  3G04 C;  2RA8 A;  5D3I A;  1XWD C;  3WPF A;  2OMW A;  4ECN A;  2Z64 A;  4Y61 B;  4U08 A;  4BSS A;  2OMY A;  1OGQ A;  3A79 B;  4R5C A;  5CMN A;  3REZ A;  4XGO A;  4R6G A;  4HQ1 A;  1G9U A;  4J0M A;  1W8A A;  1PGV A;  4LXR A;  4LSX C;  1XEU A;  4EZG A; 
#chains in the Genus database with same CATH homology
 3ZYJ A;  4AY9 X;  1U0N D;  1JL5 A;  3OJA B;  5B0N A;  5IJD A;  3WPD A;  2V9T B;  1OOK G;  2OMZ A;  2Q4G W;  4U06 A;  4YEB B;  4CNM A;  2Z63 A;  1K5G C;  3VQ1 A;  4AW4 A;  5GQR K;  3RFJ A;  4Z8G A;  2BEX A;  5GMH A;  3UL8 A;  3M18 A;  5AWC A;  3W3N A;  4LXS A;  5GMG A;  4R6J A;  5A5C A;  4R6F A;  3RFE A;  4LSX A;  2O6Q A;  2XWT C;  4RCA B;  4TZH A;  3ZYI A;  3WPG A;  2JE0 A;  1M9S A;  1OZN A;  4LSA A;  1O6V A;  1XKU A;  2P1O B;  4QBZ A;  4CIL A;  2ELL A;  3O53 A;  4CC4 C;  1YRG A;  4MQW X;  2OMT A;  4PEQ B;  4Q3G A;  3RGZ A;  5GS2 B;  1FS2 A;  2WQW A;  2R9U A;  4LI2 A;  4MN8 B;  1GWB A;  2Z66 A;  3RFS A;  1D0B A;  2WQV A;  4WP6 A;  2P1Q B;  5AWB A;  4R08 A;  3SB4 A;  5IYX C;  4PKI G;  1IO0 A;  3PMH G;  3P72 A;  2JQD A;  3WPC A;  2UZX A;  4UFR A;  1K5D C;  2V70 A;  1P9A G;  4CC4 A;  2JE1 A;  3ULV A;  4KNG A;  4J4L A;  3C6P B;  1KOO A;  3CIG A;  3OGK B;  5HZL B;  1M9L A;  4Z61 C;  1P8V A;  4Q3I A;  3E4G A;  3RW6 A;  3G3B A;  4V2C A;  4M7E C;  4CP6 A;  2WQX A;  4PQ8 A;  1XCD A;  1FQV A;  4U7L A;  4R5D A;  2Z82 A;  2Z7X A;  3C6N B;  4KXF B;  4C2A B;  2OMU A;  5IJC A;  4FDW A;  3ULU A;  3OJA A;  1ZIW A;  4OQT A;  2ID5 A;  3ULA A;  1LTX A;  5IJB A;  4L3F A;  4U09 A;  3W3G A;  1WWL A;  5B0T A;  2P1N B;  4K17 A;  3TSR E;  4BSU A;  4ARN A;  1FT8 A;  4P91 A;  2Z62 A;  4M7E A;  4NKH A;  4V2D A;  1FO1 A;  1XEC A;  1KOH A;  3DZE A;  2OMX A;  4CNC A;  5CMP A;  3ZYO A;  4R6A A;  5GMF A;  3WPI A;  1O6T A;  4PSJ A;  3WPB A;  3ZYN A;  4KT1 A;  1QYY A;  4FS7 A;  3G06 A;  3C6O B;  4NKG A;  2BNH A;  3UL9 A;  4B8C D;  4FD0 A;  4FCG A;  4ARR A;  1A4Y A;  2CA6 A;  4BV4 R;  1OTO A;  2IFG A;  2P1P B;  3UN9 A;  2Z81 A;  4Z79 A;  2UZY A;  4R58 A;  4PER A;  2Z65 A;  3W3J A;  1OTM A;  4Z64 C;  3UL7 A;  5B4P A;  4XSQ A;  1DS9 A;  4C2B B;  4QXE A;  5FTT B;  4P8S A;  1M0Z A;  1OTN A;  4G8A A;  2V9S A;  2Z7X B;  3O6N A;  4GT6 A;  3W3L A;  2O6R A;  3FXI A;  3W3M A;  1M10 B;  4BSR A;  5AWD A;  4XOS A;  1P8T A;  3CIY A;  3M19 A;  2XOT A;  4IM6 A;  2AST B;  3RJ0 A;  4RCW A;  3G3A A;  3GOZ A;  4FMZ A;  2A0Z A;  4V2E A;  3OGM B;  3W3K A;  3RIZ A;  3RGX A;  1SQ0 B;  4QC0 A;  4LSC A;  3JB9 j;  4Z94 G;  1A9N A;  2WFH A;  3OGL B;  1DFJ I;  1DCE A;  4I6J B;  4R09 A;  2FT3 A;  5AZ5 A;  2Y5Q A;  5LFN A;  4H09 A;  4GLP A;  1H6U A;  5AWA A;  4ECO A;  5HDH A;  2P1M B;  3WN4 A;  5GS0 A;  4FHO A;  4Q62 A;  4R07 A;  3WPH A;  2O6S A;  3G39 A;  3KJ4 A;  3E2J A;  3VQ2 A;  2RR6 A;  4R0A A;  2WQU A;  3E6J A;  2OMV A;  4RWT C;  3E3Z A;  4WYK A;  1H6T A;  1Z7X W;  3RW7 A;  3BZ5 A;  3WPE A;  1O6S A;  4LI1 A;  3CVR A;  2ASS B;  4L3A A;  3G04 C;  2RA8 A;  5D3I A;  1XWD C;  3WPF A;  2OMW A;  4ECN A;  2Z64 A;  4Y61 B;  4U08 A;  4BSS A;  2OMY A;  1OGQ A;  3A79 B;  4R5C A;  5CMN A;  3REZ A;  4XGO A;  4R6G A;  4HQ1 A;  1G9U A;  4J0M A;  1W8A A;  1PGV A;  4LXR A;  4LSX C;  1XEU A;  4EZG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...