2O6RA

Structural diversity of the hagfish variable lymphocyte receptors b61
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
177
structure length
177
Chain Sequence
CPSRCSCSGTEIRCNSKGLTSVPTGIPSSATRLELESNKLQSLPHGVFDKLTQLTKLSLSQNQIQSLPDGVFDKLTKLTILYLHENKLQSLPNGVFDKLTQLKELALDTNQLKSVPDGIFDRLTSLQKIWLHTNPWDCSCPRIDYLSRWLNKNSQKEQGSAKCSGSGKPVRSIICPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural diversity of the hagfish variable lymphocyte receptors
pubmed doi rcsb
source organism Eptatretus burgeri
molecule tags Immune system
molecule keywords Variable lymphocyte receptor B
total genus 53
structure length 177
sequence length 177
ec nomenclature
pdb deposition date 2006-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13855 LRR_8 Leucine rich repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 2o6rA00
4PERA 5IJBA 2RR6A 3W3JA 1JL5A 3M18A 1DCEA 4AY9X 1YRGA 4Z64C 4WP6A 4HQ1A 3E2JA 5LFNA 3SB4A 1KOHA 3UL7A 2JE1A 2P1PB 4C2BB 4R07A 3WPIA 3WPCA 4U06A 2ASSB 3TSRE 1D0BA 3OJAB 3UL8A 1IO0A 4LI1A 4R58A 2P1OB 4QBZA 2WQXA 1O6VA 2OMZA 2WQWA 3W3LA 5AZ5A 4B8CD 1W8AA 3G06A 2BEXA 4PSJA 4M7EC 4CC4C 4R6AA 2OMWA 2OMUA 5AWCA 5GMFA 3CVRA 3G3BA 3CIYA 4QC0A 5AWBA 1O6TA 4ARNA 4L3FA 3ULVA 2XWTC 4MQWX 1FT8A 4LSXC 1OGQA 2Z65A 4V2DA 3RW7A 4XGOA 2OMVA 4BV4R 1XCDA 3W3KA 4R6FA 2V70A 3ULAA 2Z64A 4TZHA 2ASTB 4EZGA 2WQUA 5IYXC 3ULUA 2Z63A 4RCWA 1M9LA 5AWAA 2WQVA 4LSXA 2V9SA 1A4YA 4FS7A 4J4LA 3OGLB 4RWTC 3ZYNA 2OMTA 1K5DC 2JQDA 2O6RA 3GOZA 3W3NA 3P72A 3BZ5A 3O53A 4OQTA 2Q4GW 1G9UA 4U7LA 3RFEA 2Z62A 2XOTA 3E3ZA 4AW4A 3G3AA 4BSSA 5HDHA 3W3MA 3JB9j 3OJAA 4FD0A 4ECOA 1FQVA 2IFGA 2ID5A 3WPBA 3WN4A 4ARRA 4GLPA 5A5CA 2O6SA 1P8TA 4BSUA 2Z82A 2BNHA 4R6GA 4R5DA 3RFSA 3WPFA 2Y5QA 4L3AA 4RCAB 2OMYA 3RFJA 4YEBB 1GWBA 4FHOA 1H6UA 4IM6A 5D3IA 3OGKB 4FMZA 1XECA 4C2AB 3PMHG 3RGXA 2V9TB 3ZYOA 4CC4A 2A0ZA 2WFHA 2ELLA 2P1NB 4R5CA 1QYYA 2Z66A 3VQ2A 1M9SA 4CILA 3RIZA 4Q3GA 4Z61C 1PGVA 4QXEA 4PKIG 4BSRA 1DS9A 4I6JB 3C6PB 1FO1A 3FXIA 5GS0A 1KOOA 3C6OB 3RJ0A 4UFRA 1ZIWA 5B0TA 2FT3A 4NKHA 2UZYA 1DFJI 5HZLB 1OTOA 5CMNA 4CNMA 4LXSA 3WPDA 4ECNA 4GT6A 1LTXA 2UZXA 5B4PA 1M10B 1FS2A 3G04C 4R08A 3WPEA 4FCGA 1XKUA 3G39A 4Z94G 5B0NA 3WPGA 1OOKG 1OTMA 3RGZA 2O6QA 2CA6A 1U0ND 4PEQB 4XSQA 4Y61B 3REZA 4V2EA 3OGMB 3O6NA 5IJDA 3VQ1A 4KNGA 1P9AG 3UL9A 4FDWA 4M7EA 1OTNA 4U09A 3E6JA 5GQRK 4XOSA 1WWLA 2Z7XA 3E4GA 4R0AA 1SQ0B 4Q62A 4WYKA 5FTTB 4Z8GA 2P1QB 3M19A 4NKGA 1OZNA 2R9UA 1XWDC 2RA8A 5CMPA 4P91A 4P8SA 4Q3IA 4U08A 3UN9A 4R09A 3CIGA 1M0ZA 4KXFB 3A79B 4LSCA 3KJ4A 5AWDA 5GMGA 1O6SA 1XEUA 4PQ8A 3ZYJA 2OMXA 2Z7XB 4G8AA 4CP6A 4R6JA 4J0MA 1Z7XW 3W3GA 1K5GC 4LSAA 1P8VA 5GS2B 3RW6A 4KT1A 3C6NB 5IJCA 4H09A 4Z79A 3DZEA 4LXRA 2P1MB 3WPHA 1A9NA 5GMHA 3ZYIA 4V2CA 1H6TA 2JE0A 4MN8B 4K17A 4CNCA 4LI2A 2Z81A
chains in the Genus database with same CATH superfamily
4PERA 5IJBA 2RR6A 3W3JA 1JL5A 3M18A 1DCEA 4AY9X 1YRGA 4Z64C 4WP6A 4HQ1A 3E2JA 5LFNA 3SB4A 1KOHA 3UL7A 2JE1A 2P1PB 4C2BB 4R07A 3WPIA 3WPCA 4U06A 2ASSB 3TSRE 1D0BA 3OJAB 3UL8A 1IO0A 4LI1A 4R58A 2P1OB 4QBZA 2WQXA 1O6VA 2OMZA 2WQWA 3W3LA 5AZ5A 4B8CD 1W8AA 3G06A 2BEXA 4PSJA 4M7EC 4CC4C 4R6AA 2OMWA 2OMUA 5AWCA 5GMFA 3CVRA 3G3BA 3CIYA 4QC0A 5AWBA 1O6TA 4ARNA 4L3FA 3ULVA 2XWTC 4MQWX 1FT8A 4LSXC 1OGQA 2Z65A 4V2DA 3RW7A 4XGOA 2OMVA 4BV4R 1XCDA 3W3KA 4R6FA 2V70A 3ULAA 2Z64A 4TZHA 2ASTB 4EZGA 2WQUA 5IYXC 3ULUA 2Z63A 4RCWA 1M9LA 5AWAA 2WQVA 4LSXA 2V9SA 1A4YA 4FS7A 4J4LA 3OGLB 4RWTC 3ZYNA 2OMTA 1K5DC 2JQDA 2O6RA 3GOZA 3W3NA 3P72A 3BZ5A 3O53A 4OQTA 2Q4GW 1G9UA 4U7LA 3RFEA 2Z62A 2XOTA 3E3ZA 4AW4A 3G3AA 4BSSA 5HDHA 3W3MA 3JB9j 3OJAA 4FD0A 4ECOA 1FQVA 2IFGA 2ID5A 3WPBA 3WN4A 4ARRA 4GLPA 5A5CA 2O6SA 1P8TA 4BSUA 2Z82A 2BNHA 4R6GA 4R5DA 3RFSA 3WPFA 2Y5QA 4L3AA 4RCAB 2OMYA 3RFJA 4YEBB 1GWBA 4FHOA 1H6UA 4IM6A 5D3IA 3OGKB 4FMZA 1XECA 4C2AB 3PMHG 3RGXA 2V9TB 3ZYOA 4CC4A 2A0ZA 2WFHA 2ELLA 2P1NB 4R5CA 1QYYA 2Z66A 3VQ2A 1M9SA 4CILA 3RIZA 4Q3GA 4Z61C 1PGVA 4QXEA 4PKIG 4BSRA 1DS9A 4I6JB 3C6PB 1FO1A 3FXIA 5GS0A 1KOOA 3C6OB 3RJ0A 4UFRA 1ZIWA 5B0TA 2FT3A 4NKHA 2UZYA 1DFJI 5HZLB 1OTOA 5CMNA 4CNMA 4LXSA 3WPDA 4ECNA 4GT6A 1LTXA 2UZXA 5B4PA 1M10B 1FS2A 3G04C 4R08A 3WPEA 4FCGA 1XKUA 3G39A 4Z94G 5B0NA 3WPGA 1OOKG 1OTMA 3RGZA 2O6QA 2CA6A 1U0ND 4PEQB 4XSQA 4Y61B 3REZA 4V2EA 3OGMB 3O6NA 5IJDA 3VQ1A 4KNGA 1P9AG 3UL9A 4FDWA 4M7EA 1OTNA 4U09A 3E6JA 5GQRK 4XOSA 1WWLA 2Z7XA 3E4GA 4R0AA 1SQ0B 4Q62A 4WYKA 5FTTB 4Z8GA 2P1QB 3M19A 4NKGA 1OZNA 2R9UA 1XWDC 2RA8A 5CMPA 4P91A 4P8SA 4Q3IA 4U08A 4NZRM 3UN9A 4R09A 3CIGA 1M0ZA 4KXFB 3A79B 4LSCA 3KJ4A 5AWDA 5GMGA 1O6SA 1XEUA 4PQ8A 3ZYJA 2OMXA 2Z7XB 4G8AA 4CP6A 4R6JA 4J0MA 1Z7XW 3W3GA 1K5GC 4LSAA 1P8VA 5GS2B 3RW6A 4NZTM 4KT1A 3C6NB 5IJCA 4H09A 4Z79A 3DZEA 4LXRA 2P1MB 3WPHA 1A9NA 5GMHA 3ZYIA 4V2CA 1H6TA 2JE0A 4MN8B 4K17A 4CNCA 4LI2A 2Z81A
chains in the Genus database with same CATH topology
4PERA 5IJBA 2RR6A 3W3JA 1JL5A 3M18A 1DCEA 4AY9X 1YRGA 4Z64C 4WP6A 4HQ1A 3E2JA 5LFNA 3SB4A 1KOHA 3UL7A 2JE1A 2P1PB 4C2BB 4R07A 3WPIA 3WPCA 4U06A 2ASSB 3TSRE 1D0BA 3OJAB 3UL8A 1IO0A 4LI1A 4R58A 2P1OB 4QBZA 2WQXA 1O6VA 2OMZA 2WQWA 3W3LA 5AZ5A 4B8CD 1W8AA 3G06A 2BEXA 4PSJA 4M7EC 4CC4C 4R6AA 2OMWA 2OMUA 5AWCA 5GMFA 3CVRA 3G3BA 3CIYA 4QC0A 5AWBA 1O6TA 4ARNA 4L3FA 3ULVA 2XWTC 4MQWX 1FT8A 4LSXC 1OGQA 2Z65A 4V2DA 3RW7A 4XGOA 2OMVA 4BV4R 1XCDA 3W3KA 4R6FA 2V70A 3ULAA 2Z64A 4TZHA 2ASTB 4EZGA 2WQUA 5IYXC 3ULUA 2Z63A 4RCWA 1M9LA 5AWAA 2WQVA 4LSXA 2V9SA 1A4YA 4FS7A 4J4LA 3OGLB 4RWTC 3ZYNA 2OMTA 1K5DC 2JQDA 2O6RA 3GOZA 3W3NA 3P72A 3BZ5A 3O53A 4OQTA 2Q4GW 1G9UA 4U7LA 3RFEA 2Z62A 2XOTA 3E3ZA 4AW4A 3G3AA 4BSSA 5HDHA 3W3MA 3JB9j 3OJAA 4FD0A 4ECOA 1FQVA 2IFGA 2ID5A 3WPBA 3WN4A 4ARRA 4GLPA 5A5CA 2O6SA 1P8TA 4BSUA 2Z82A 2BNHA 4R6GA 4R5DA 3RFSA 3WPFA 2Y5QA 4L3AA 4RCAB 2OMYA 3RFJA 4YEBB 1GWBA 4FHOA 1H6UA 4IM6A 5D3IA 3OGKB 4FMZA 1XECA 4C2AB 3PMHG 3RGXA 2V9TB 3ZYOA 4CC4A 2A0ZA 2WFHA 2ELLA 2P1NB 4R5CA 1QYYA 2Z66A 3VQ2A 1M9SA 4CILA 3RIZA 4Q3GA 4Z61C 1PGVA 4QXEA 4PKIG 4BSRA 1DS9A 4I6JB 3C6PB 1FO1A 3FXIA 5GS0A 1KOOA 3C6OB 3RJ0A 4UFRA 1ZIWA 5B0TA 2FT3A 4NKHA 2UZYA 1DFJI 5HZLB 1OTOA 5CMNA 4CNMA 4LXSA 3WPDA 4ECNA 4GT6A 1LTXA 2UZXA 5B4PA 1M10B 1FS2A 3G04C 4R08A 3WPEA 4FCGA 1XKUA 3G39A 4Z94G 5B0NA 3WPGA 1OOKG 1OTMA 3RGZA 2O6QA 2CA6A 1U0ND 4PEQB 4XSQA 4Y61B 3REZA 4V2EA 3OGMB 3O6NA 5IJDA 3VQ1A 4KNGA 1P9AG 3UL9A 4FDWA 4M7EA 1OTNA 4U09A 3E6JA 5GQRK 4XOSA 1WWLA 2Z7XA 3E4GA 4R0AA 1SQ0B 4Q62A 4WYKA 5FTTB 4Z8GA 2P1QB 3M19A 4NKGA 1OZNA 2R9UA 1XWDC 2RA8A 5CMPA 4P91A 4P8SA 4Q3IA 4U08A 3UN9A 4R09A 3CIGA 1M0ZA 4KXFB 3A79B 4LSCA 3KJ4A 5AWDA 5GMGA 1O6SA 1XEUA 4PQ8A 3ZYJA 2OMXA 2Z7XB 4G8AA 4CP6A 4R6JA 4J0MA 1Z7XW 3W3GA 1K5GC 4LSAA 1P8VA 5GS2B 3RW6A 4KT1A 3C6NB 5IJCA 4H09A 4Z79A 3DZEA 4LXRA 2P1MB 3WPHA 1A9NA 5GMHA 3ZYIA 4V2CA 1H6TA 2JE0A 4MN8B 4K17A 4CNCA 4LI2A 2Z81A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PER A;  5IJB A;  2RR6 A;  3W3J A;  1JL5 A;  3M18 A;  1DCE A;  4AY9 X;  1YRG A;  4Z64 C;  4WP6 A;  4HQ1 A;  3E2J A;  5LFN A;  3SB4 A;  1KOH A;  3UL7 A;  2JE1 A;  2P1P B;  4C2B B;  4R07 A;  3WPI A;  3WPC A;  4U06 A;  2ASS B;  3TSR E;  1D0B A;  3OJA B;  3UL8 A;  1IO0 A;  4LI1 A;  4R58 A;  2P1O B;  4QBZ A;  2WQX A;  1O6V A;  2OMZ A;  2WQW A;  3W3L A;  5AZ5 A;  4B8C D;  1W8A A;  3G06 A;  2BEX A;  4PSJ A;  4M7E C;  4CC4 C;  4R6A A;  2OMW A;  2OMU A;  5AWC A;  5GMF A;  3CVR A;  3G3B A;  3CIY A;  4QC0 A;  5AWB A;  1O6T A;  4ARN A;  4L3F A;  3ULV A;  2XWT C;  4MQW X;  1FT8 A;  4LSX C;  1OGQ A;  2Z65 A;  4V2D A;  3RW7 A;  4XGO A;  2OMV A;  4BV4 R;  1XCD A;  3W3K A;  4R6F A;  2V70 A;  3ULA A;  2Z64 A;  4TZH A;  2AST B;  4EZG A;  2WQU A;  5IYX C;  3ULU A;  2Z63 A;  4RCW A;  1M9L A;  5AWA A;  2WQV A;  4LSX A;  2V9S A;  1A4Y A;  4FS7 A;  4J4L A;  3OGL B;  4RWT C;  3ZYN A;  2OMT A;  1K5D C;  2JQD A;  2O6R A;  3GOZ A;  3W3N A;  3P72 A;  3BZ5 A;  3O53 A;  4OQT A;  2Q4G W;  1G9U A;  4U7L A;  3RFE A;  2Z62 A;  2XOT A;  3E3Z A;  4AW4 A;  3G3A A;  4BSS A;  5HDH A;  3W3M A;  3JB9 j;  3OJA A;  4FD0 A;  4ECO A;  1FQV A;  2IFG A;  2ID5 A;  3WPB A;  3WN4 A;  4ARR A;  4GLP A;  5A5C A;  2O6S A;  1P8T A;  4BSU A;  2Z82 A;  2BNH A;  4R6G A;  4R5D A;  3RFS A;  3WPF A;  2Y5Q A;  4L3A A;  4RCA B;  2OMY A;  3RFJ A;  4YEB B;  1GWB A;  4FHO A;  1H6U A;  4IM6 A;  5D3I A;  3OGK B;  4FMZ A;  1XEC A;  4C2A B;  3PMH G;  3RGX A;  2V9T B;  3ZYO A;  4CC4 A;  2A0Z A;  2WFH A;  2ELL A;  2P1N B;  4R5C A;  1QYY A;  2Z66 A;  3VQ2 A;  1M9S A;  4CIL A;  3RIZ A;  4Q3G A;  4Z61 C;  1PGV A;  4QXE A;  4PKI G;  4BSR A;  1DS9 A;  4I6J B;  3C6P B;  1FO1 A;  3FXI A;  5GS0 A;  1KOO A;  3C6O B;  3RJ0 A;  4UFR A;  1ZIW A;  5B0T A;  2FT3 A;  4NKH A;  2UZY A;  1DFJ I;  5HZL B;  1OTO A;  5CMN A;  4CNM A;  4LXS A;  3WPD A;  4ECN A;  4GT6 A;  1LTX A;  2UZX A;  5B4P A;  1M10 B;  1FS2 A;  3G04 C;  4R08 A;  3WPE A;  4FCG A;  1XKU A;  3G39 A;  4Z94 G;  5B0N A;  3WPG A;  1OOK G;  1OTM A;  3RGZ A;  2O6Q A;  2CA6 A;  1U0N D;  4PEQ B;  4XSQ A;  4Y61 B;  3REZ A;  4V2E A;  3OGM B;  3O6N A;  5IJD A;  3VQ1 A;  4KNG A;  1P9A G;  3UL9 A;  4FDW A;  4M7E A;  1OTN A;  4U09 A;  3E6J A;  5GQR K;  4XOS A;  1WWL A;  2Z7X A;  3E4G A;  4R0A A;  1SQ0 B;  4Q62 A;  4WYK A;  5FTT B;  4Z8G A;  2P1Q B;  3M19 A;  4NKG A;  1OZN A;  2R9U A;  1XWD C;  2RA8 A;  5CMP A;  4P91 A;  4P8S A;  4Q3I A;  4U08 A;  3UN9 A;  4R09 A;  3CIG A;  1M0Z A;  4KXF B;  3A79 B;  4LSC A;  3KJ4 A;  5AWD A;  5GMG A;  1O6S A;  1XEU A;  4PQ8 A;  3ZYJ A;  2OMX A;  2Z7X B;  4G8A A;  4CP6 A;  4R6J A;  4J0M A;  1Z7X W;  3W3G A;  1K5G C;  4LSA A;  1P8V A;  5GS2 B;  3RW6 A;  4KT1 A;  3C6N B;  5IJC A;  4H09 A;  4Z79 A;  3DZE A;  4LXR A;  2P1M B;  3WPH A;  1A9N A;  5GMH A;  3ZYI A;  4V2C A;  1H6T A;  2JE0 A;  4MN8 B;  4K17 A;  4CNC A;  4LI2 A;  2Z81 A; 
#chains in the Genus database with same CATH topology
 4PER A;  5IJB A;  2RR6 A;  3W3J A;  1JL5 A;  3M18 A;  1DCE A;  4AY9 X;  1YRG A;  4Z64 C;  4WP6 A;  4HQ1 A;  3E2J A;  5LFN A;  3SB4 A;  1KOH A;  3UL7 A;  2JE1 A;  2P1P B;  4C2B B;  4R07 A;  3WPI A;  3WPC A;  4U06 A;  2ASS B;  3TSR E;  1D0B A;  3OJA B;  3UL8 A;  1IO0 A;  4LI1 A;  4R58 A;  2P1O B;  4QBZ A;  2WQX A;  1O6V A;  2OMZ A;  2WQW A;  3W3L A;  5AZ5 A;  4B8C D;  1W8A A;  3G06 A;  2BEX A;  4PSJ A;  4M7E C;  4CC4 C;  4R6A A;  2OMW A;  2OMU A;  5AWC A;  5GMF A;  3CVR A;  3G3B A;  3CIY A;  4QC0 A;  5AWB A;  1O6T A;  4ARN A;  4L3F A;  3ULV A;  2XWT C;  4MQW X;  1FT8 A;  4LSX C;  1OGQ A;  2Z65 A;  4V2D A;  3RW7 A;  4XGO A;  2OMV A;  4BV4 R;  1XCD A;  3W3K A;  4R6F A;  2V70 A;  3ULA A;  2Z64 A;  4TZH A;  2AST B;  4EZG A;  2WQU A;  5IYX C;  3ULU A;  2Z63 A;  4RCW A;  1M9L A;  5AWA A;  2WQV A;  4LSX A;  2V9S A;  1A4Y A;  4FS7 A;  4J4L A;  3OGL B;  4RWT C;  3ZYN A;  2OMT A;  1K5D C;  2JQD A;  2O6R A;  3GOZ A;  3W3N A;  3P72 A;  3BZ5 A;  3O53 A;  4OQT A;  2Q4G W;  1G9U A;  4U7L A;  3RFE A;  2Z62 A;  2XOT A;  3E3Z A;  4AW4 A;  3G3A A;  4BSS A;  5HDH A;  3W3M A;  3JB9 j;  3OJA A;  4FD0 A;  4ECO A;  1FQV A;  2IFG A;  2ID5 A;  3WPB A;  3WN4 A;  4ARR A;  4GLP A;  5A5C A;  2O6S A;  1P8T A;  4BSU A;  2Z82 A;  2BNH A;  4R6G A;  4R5D A;  3RFS A;  3WPF A;  2Y5Q A;  4L3A A;  4RCA B;  2OMY A;  3RFJ A;  4YEB B;  1GWB A;  4FHO A;  1H6U A;  4IM6 A;  5D3I A;  3OGK B;  4FMZ A;  1XEC A;  4C2A B;  3PMH G;  3RGX A;  2V9T B;  3ZYO A;  4CC4 A;  2A0Z A;  2WFH A;  2ELL A;  2P1N B;  4R5C A;  1QYY A;  2Z66 A;  3VQ2 A;  1M9S A;  4CIL A;  3RIZ A;  4Q3G A;  4Z61 C;  1PGV A;  4QXE A;  4PKI G;  4BSR A;  1DS9 A;  4I6J B;  3C6P B;  1FO1 A;  3FXI A;  5GS0 A;  1KOO A;  3C6O B;  3RJ0 A;  4UFR A;  1ZIW A;  5B0T A;  2FT3 A;  4NKH A;  2UZY A;  1DFJ I;  5HZL B;  1OTO A;  5CMN A;  4CNM A;  4LXS A;  3WPD A;  4ECN A;  4GT6 A;  1LTX A;  2UZX A;  5B4P A;  1M10 B;  1FS2 A;  3G04 C;  4R08 A;  3WPE A;  4FCG A;  1XKU A;  3G39 A;  4Z94 G;  5B0N A;  3WPG A;  1OOK G;  1OTM A;  3RGZ A;  2O6Q A;  2CA6 A;  1U0N D;  4PEQ B;  4XSQ A;  4Y61 B;  3REZ A;  4V2E A;  3OGM B;  3O6N A;  5IJD A;  3VQ1 A;  4KNG A;  1P9A G;  3UL9 A;  4FDW A;  4M7E A;  1OTN A;  4U09 A;  3E6J A;  5GQR K;  4XOS A;  1WWL A;  2Z7X A;  3E4G A;  4R0A A;  1SQ0 B;  4Q62 A;  4WYK A;  5FTT B;  4Z8G A;  2P1Q B;  3M19 A;  4NKG A;  1OZN A;  2R9U A;  1XWD C;  2RA8 A;  5CMP A;  4P91 A;  4P8S A;  4Q3I A;  4U08 A;  4NZR M;  3UN9 A;  4R09 A;  3CIG A;  1M0Z A;  4KXF B;  3A79 B;  4LSC A;  3KJ4 A;  5AWD A;  5GMG A;  1O6S A;  1XEU A;  4PQ8 A;  3ZYJ A;  2OMX A;  2Z7X B;  4G8A A;  4CP6 A;  4R6J A;  4J0M A;  1Z7X W;  3W3G A;  1K5G C;  4LSA A;  1P8V A;  5GS2 B;  3RW6 A;  4NZT M;  4KT1 A;  3C6N B;  5IJC A;  4H09 A;  4Z79 A;  3DZE A;  4LXR A;  2P1M B;  3WPH A;  1A9N A;  5GMH A;  3ZYI A;  4V2C A;  1H6T A;  2JE0 A;  4MN8 B;  4K17 A;  4CNC A;  4LI2 A;  2Z81 A; 
#chains in the Genus database with same CATH homology
 4PER A;  5IJB A;  2RR6 A;  3W3J A;  1JL5 A;  3M18 A;  1DCE A;  4AY9 X;  1YRG A;  4Z64 C;  4WP6 A;  4HQ1 A;  3E2J A;  5LFN A;  3SB4 A;  1KOH A;  3UL7 A;  2JE1 A;  2P1P B;  4C2B B;  4R07 A;  3WPI A;  3WPC A;  4U06 A;  2ASS B;  3TSR E;  1D0B A;  3OJA B;  3UL8 A;  1IO0 A;  4LI1 A;  4R58 A;  2P1O B;  4QBZ A;  2WQX A;  1O6V A;  2OMZ A;  2WQW A;  3W3L A;  5AZ5 A;  4B8C D;  1W8A A;  3G06 A;  2BEX A;  4PSJ A;  4M7E C;  4CC4 C;  4R6A A;  2OMW A;  2OMU A;  5AWC A;  5GMF A;  3CVR A;  3G3B A;  3CIY A;  4QC0 A;  5AWB A;  1O6T A;  4ARN A;  4L3F A;  3ULV A;  2XWT C;  4MQW X;  1FT8 A;  4LSX C;  1OGQ A;  2Z65 A;  4V2D A;  3RW7 A;  4XGO A;  2OMV A;  4BV4 R;  1XCD A;  3W3K A;  4R6F A;  2V70 A;  3ULA A;  2Z64 A;  4TZH A;  2AST B;  4EZG A;  2WQU A;  5IYX C;  3ULU A;  2Z63 A;  4RCW A;  1M9L A;  5AWA A;  2WQV A;  4LSX A;  2V9S A;  1A4Y A;  4FS7 A;  4J4L A;  3OGL B;  4RWT C;  3ZYN A;  2OMT A;  1K5D C;  2JQD A;  2O6R A;  3GOZ A;  3W3N A;  3P72 A;  3BZ5 A;  3O53 A;  4OQT A;  2Q4G W;  1G9U A;  4U7L A;  3RFE A;  2Z62 A;  2XOT A;  3E3Z A;  4AW4 A;  3G3A A;  4BSS A;  5HDH A;  3W3M A;  3JB9 j;  3OJA A;  4FD0 A;  4ECO A;  1FQV A;  2IFG A;  2ID5 A;  3WPB A;  3WN4 A;  4ARR A;  4GLP A;  5A5C A;  2O6S A;  1P8T A;  4BSU A;  2Z82 A;  2BNH A;  4R6G A;  4R5D A;  3RFS A;  3WPF A;  2Y5Q A;  4L3A A;  4RCA B;  2OMY A;  3RFJ A;  4YEB B;  1GWB A;  4FHO A;  1H6U A;  4IM6 A;  5D3I A;  3OGK B;  4FMZ A;  1XEC A;  4C2A B;  3PMH G;  3RGX A;  2V9T B;  3ZYO A;  4CC4 A;  2A0Z A;  2WFH A;  2ELL A;  2P1N B;  4R5C A;  1QYY A;  2Z66 A;  3VQ2 A;  1M9S A;  4CIL A;  3RIZ A;  4Q3G A;  4Z61 C;  1PGV A;  4QXE A;  4PKI G;  4BSR A;  1DS9 A;  4I6J B;  3C6P B;  1FO1 A;  3FXI A;  5GS0 A;  1KOO A;  3C6O B;  3RJ0 A;  4UFR A;  1ZIW A;  5B0T A;  2FT3 A;  4NKH A;  2UZY A;  1DFJ I;  5HZL B;  1OTO A;  5CMN A;  4CNM A;  4LXS A;  3WPD A;  4ECN A;  4GT6 A;  1LTX A;  2UZX A;  5B4P A;  1M10 B;  1FS2 A;  3G04 C;  4R08 A;  3WPE A;  4FCG A;  1XKU A;  3G39 A;  4Z94 G;  5B0N A;  3WPG A;  1OOK G;  1OTM A;  3RGZ A;  2O6Q A;  2CA6 A;  1U0N D;  4PEQ B;  4XSQ A;  4Y61 B;  3REZ A;  4V2E A;  3OGM B;  3O6N A;  5IJD A;  3VQ1 A;  4KNG A;  1P9A G;  3UL9 A;  4FDW A;  4M7E A;  1OTN A;  4U09 A;  3E6J A;  5GQR K;  4XOS A;  1WWL A;  2Z7X A;  3E4G A;  4R0A A;  1SQ0 B;  4Q62 A;  4WYK A;  5FTT B;  4Z8G A;  2P1Q B;  3M19 A;  4NKG A;  1OZN A;  2R9U A;  1XWD C;  2RA8 A;  5CMP A;  4P91 A;  4P8S A;  4Q3I A;  4U08 A;  3UN9 A;  4R09 A;  3CIG A;  1M0Z A;  4KXF B;  3A79 B;  4LSC A;  3KJ4 A;  5AWD A;  5GMG A;  1O6S A;  1XEU A;  4PQ8 A;  3ZYJ A;  2OMX A;  2Z7X B;  4G8A A;  4CP6 A;  4R6J A;  4J0M A;  1Z7X W;  3W3G A;  1K5G C;  4LSA A;  1P8V A;  5GS2 B;  3RW6 A;  4KT1 A;  3C6N B;  5IJC A;  4H09 A;  4Z79 A;  3DZE A;  4LXR A;  2P1M B;  3WPH A;  1A9N A;  5GMH A;  3ZYI A;  4V2C A;  1H6T A;  2JE0 A;  4MN8 B;  4K17 A;  4CNC A;  4LI2 A;  2Z81 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...