4Z64C

The plant peptide hormone receptor complex in arabidopsis
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
186
structure length
186
Chain Sequence
ANLEGDALHTLRVTLVDPNNVLQSWDPTLVNPCTWFHVTCNNENSVIRVDLGNAELSGHLVPELGVLKNLQYLELYSNNITGPIPSNLGDLTNLVSLDLYLNSFSGPIPESLGKLSKLRFLRLNNNSLTGSIPMSLTQITTLQVLDLSNNRLSGSVPDNGSFSLFTPISFANNLDLCGPVTSHPCP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hormone
molecule keywords Phytosulfokine receptor 1
publication title Allosteric receptor activation by the plant peptide hormone phytosulfokine
pubmed doi rcsb
source organism Arabidopsis thaliana
total genus 61
structure length 186
sequence length 186
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2015-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF08263 LRRNT_2 Leucine rich repeat N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 4z64C00
2FT3A 1XECA 3RFEA 3WPEA 1A4YA 1M10B 3CVRA 1PGVA 3PMHG 4NKGA 4GLPA 4C2AB 3WPBA 4M7EA 3WPFA 4WYKA 1LTXA 4ECOA 3UL8A 3VQ1A 2Z66A 2XOTA 4TZHA 3WPCA 4OQTA 2UZYA 4V2DA 2RA8A 4Z61C 3RW7A 3W3MA 5GMGA 4Z8GA 1SQ0B 4LXSA 2BEXA 3C6PB 4Q3IA 3GOZA 3G3AA 4Z64C 4EZGA 3E6JA 4XGOA 4K17A 3UN9A 5IJDA 2OMWA 5GS2B 4HQ1A 2ID5A 3WPGA 4U06A 4PEQB 3P72A 3RFSA 3ULAA 4RCWA 1D0BA 5B0NA 1O6SA 4KNGA 2JE0A 3UL9A 3WPDA 2XWTC 1M0ZA 3A79B 4Q3GA 2JE1A 2R9UA 4FMZA 4XSQA 5AWCA 3O6NA 1KOOA 1FQVA 5B4PA 4FCGA 2P1OB 2Z82A 4ARRA 1XEUA 4C2BB 1M9LA 2Z7XA 3KJ4A 4R6FA 2WQWA 2ELLA 4R08A 4KT1A 3WPIA 1GWBA 3ULVA 2OMYA 4ECNA 4J4LA 1JL5A 1OZNA 4FS7A 4RCAB 1YRGA 4R5CA 1XKUA 2ASSB 1DFJI 5GQRK 3M19A 3G39A 5HDHA 3RW6A 5CMPA 4R07A 4GT6A 3E2JA 1ZIWA 5IJBA 2ASTB 4PQ8A 5AWDA 2A0ZA 2Z7XB 3DZEA 4BSUA 2P1PB 4XOSA 3W3NA 4CC4C 4B8CD 3OGMB 4PSJA 5B0TA 2RR6A 2Z81A 4QC0A 1IO0A 4MQWX 4R0AA 1FS2A 4R6AA 4AW4A 2O6RA 4Z94G 4CNCA 3G3BA 1U0ND 3RJ0A 4J0MA 1O6TA 4I6JB 4U7LA 5HZLB 4H09A 4M7EC 2OMTA 3VQ2A 4V2CA 4LI1A 1K5DC 4R6JA 3WN4A 2Z62A 4QXEA 5AWAA 2V70A 5FTTB 4PERA 3UL7A 3RIZA 4IM6A 5IJCA 1DCEA 4FDWA 3O53A 1O6VA 4BSRA 1XCDA 4L3AA 1A9NA 2BNHA 2IFGA 2UZXA 5GS0A 2OMXA 4U09A 1QYYA 1OTMA 3M18A 5LFNA 3C6OB 3W3JA 4PKIG 5IYXC 5GMHA 1FT8A 3W3GA 2CA6A 3RFJA 3W3KA 1OGQA 5GMFA 3ZYOA 4KXFB 1OOKG 3G04C 3ULUA 3SB4A 2Z64A 2JQDA 4Z79A 2Z63A 4L3FA 3OJAA 4BSSA 2WQXA 1XWDC 4G8AA 2V9TB 4LSCA 3TSRE 4FD0A 3E3ZA 4RWTC 5AZ5A 5CMNA 4CNMA 1OTOA 1P9AG 4MN8B 4R6GA 1H6UA 4LI2A 2WFHA 4LXRA 2WQUA 1P8TA 2O6SA 2OMUA 3ZYNA 1M9SA 3BZ5A 2O6QA 4LSXA 4BV4R 4R5DA 4CP6A 4Q62A 3ZYIA 2P1NB 3E4GA 4P8SA 3CIYA 3OGLB 3FXIA 3WPHA 4YEBB 4FHOA 5D3IA 4NKHA 1Z7XW 4U08A 1K5GC 3OJAB 1P8VA 4ARNA 1OTNA 4QBZA 4AY9X 1FO1A 1G9UA 2Y5QA 3CIGA 4Y61B 1KOHA 4P91A 2OMZA 3C6NB 3JB9j 3RGZA 4R58A 4LSAA 1DS9A 2OMVA 3OGKB 3RGXA 1H6TA 3ZYJA 1W8AA 2Z65A 2P1MB 3W3LA 4V2EA 3G06A 2V9SA 4CC4A 2WQVA 2P1QB 4R09A 1WWLA 3REZA 4UFRA 5A5CA 4WP6A 4CILA 4LSXC 2Q4GW 5AWBA
chains in the Genus database with same CATH superfamily
2FT3A 1XECA 3RFEA 3WPEA 1A4YA 1M10B 3CVRA 1PGVA 3PMHG 4NKGA 4GLPA 4C2AB 3WPBA 4M7EA 3WPFA 4WYKA 1LTXA 4ECOA 3UL8A 3VQ1A 2Z66A 2XOTA 4TZHA 3WPCA 4OQTA 2UZYA 4V2DA 2RA8A 4Z61C 3RW7A 3W3MA 5GMGA 4Z8GA 1SQ0B 4LXSA 2BEXA 3C6PB 4Q3IA 3GOZA 3G3AA 4NZRM 4Z64C 4EZGA 3E6JA 4XGOA 4K17A 3UN9A 5IJDA 2OMWA 5GS2B 4HQ1A 2ID5A 3WPGA 4U06A 4PEQB 3P72A 3RFSA 3ULAA 4RCWA 1D0BA 5B0NA 1O6SA 4KNGA 2JE0A 3UL9A 3WPDA 2XWTC 1M0ZA 3A79B 4Q3GA 2JE1A 2R9UA 4FMZA 4XSQA 5AWCA 3O6NA 1KOOA 1FQVA 5B4PA 4FCGA 2P1OB 2Z82A 4ARRA 1XEUA 4C2BB 1M9LA 2Z7XA 3KJ4A 4R6FA 2WQWA 2ELLA 4R08A 4KT1A 3WPIA 1GWBA 3ULVA 2OMYA 4ECNA 4J4LA 1JL5A 1OZNA 4FS7A 4RCAB 1YRGA 4R5CA 1XKUA 2ASSB 1DFJI 5GQRK 3M19A 3G39A 5HDHA 3RW6A 5CMPA 4R07A 4GT6A 3E2JA 1ZIWA 5IJBA 2ASTB 4PQ8A 5AWDA 2A0ZA 2Z7XB 3DZEA 4BSUA 2P1PB 4XOSA 3W3NA 4CC4C 4B8CD 3OGMB 4PSJA 5B0TA 2RR6A 2Z81A 4QC0A 1IO0A 4MQWX 4R0AA 1FS2A 4R6AA 4AW4A 2O6RA 4Z94G 4CNCA 3G3BA 1U0ND 3RJ0A 4J0MA 1O6TA 4I6JB 4NZTM 4U7LA 5HZLB 4H09A 4M7EC 2OMTA 3VQ2A 4V2CA 4LI1A 1K5DC 4R6JA 3WN4A 2Z62A 4QXEA 5AWAA 2V70A 5FTTB 4PERA 3UL7A 3RIZA 4IM6A 5IJCA 1DCEA 4FDWA 3O53A 1O6VA 4BSRA 1XCDA 4L3AA 1A9NA 2BNHA 2IFGA 2UZXA 5GS0A 2OMXA 4U09A 1QYYA 1OTMA 3M18A 5LFNA 3C6OB 3W3JA 4PKIG 5IYXC 5GMHA 1FT8A 3W3GA 2CA6A 3RFJA 3W3KA 1OGQA 5GMFA 3ZYOA 4KXFB 1OOKG 3G04C 3ULUA 3SB4A 2Z64A 2JQDA 4Z79A 2Z63A 4L3FA 3OJAA 4BSSA 2WQXA 1XWDC 4G8AA 2V9TB 4LSCA 3TSRE 4FD0A 3E3ZA 4RWTC 5AZ5A 5CMNA 4CNMA 1OTOA 1P9AG 4MN8B 4R6GA 1H6UA 4LI2A 2WFHA 4LXRA 2WQUA 1P8TA 2O6SA 2OMUA 3ZYNA 1M9SA 3BZ5A 2O6QA 4LSXA 4BV4R 4R5DA 4CP6A 4Q62A 3ZYIA 2P1NB 3E4GA 4P8SA 3CIYA 3OGLB 3FXIA 3WPHA 4YEBB 4FHOA 5D3IA 4NKHA 1Z7XW 4U08A 1K5GC 3OJAB 1P8VA 4ARNA 1OTNA 4QBZA 4AY9X 1FO1A 1G9UA 2Y5QA 3CIGA 4Y61B 1KOHA 4P91A 2OMZA 3C6NB 3JB9j 3RGZA 4R58A 4LSAA 1DS9A 2OMVA 3OGKB 3RGXA 1H6TA 3ZYJA 1W8AA 2Z65A 2P1MB 3W3LA 4V2EA 3G06A 2V9SA 4CC4A 2WQVA 2P1QB 4R09A 1WWLA 3REZA 4UFRA 5A5CA 4WP6A 4CILA 4LSXC 2Q4GW 5AWBA
chains in the Genus database with same CATH topology
2FT3A 1XECA 3RFEA 3WPEA 1A4YA 1M10B 3CVRA 1PGVA 3PMHG 4NKGA 4GLPA 4C2AB 3WPBA 4M7EA 3WPFA 4WYKA 1LTXA 4ECOA 3UL8A 3VQ1A 2Z66A 2XOTA 4TZHA 3WPCA 4OQTA 2UZYA 4V2DA 2RA8A 4Z61C 3RW7A 3W3MA 5GMGA 4Z8GA 1SQ0B 4LXSA 2BEXA 3C6PB 4Q3IA 3GOZA 3G3AA 4Z64C 4EZGA 3E6JA 4XGOA 4K17A 3UN9A 5IJDA 2OMWA 5GS2B 4HQ1A 2ID5A 3WPGA 4U06A 4PEQB 3P72A 3RFSA 3ULAA 4RCWA 1D0BA 5B0NA 1O6SA 4KNGA 2JE0A 3UL9A 3WPDA 2XWTC 1M0ZA 3A79B 4Q3GA 2JE1A 2R9UA 4FMZA 4XSQA 5AWCA 3O6NA 1KOOA 1FQVA 5B4PA 4FCGA 2P1OB 2Z82A 4ARRA 1XEUA 4C2BB 1M9LA 2Z7XA 3KJ4A 4R6FA 2WQWA 2ELLA 4R08A 4KT1A 3WPIA 1GWBA 3ULVA 2OMYA 4ECNA 4J4LA 1JL5A 1OZNA 4FS7A 4RCAB 1YRGA 4R5CA 1XKUA 2ASSB 1DFJI 5GQRK 3M19A 3G39A 5HDHA 3RW6A 5CMPA 4R07A 4GT6A 3E2JA 1ZIWA 5IJBA 2ASTB 4PQ8A 5AWDA 2A0ZA 2Z7XB 3DZEA 4BSUA 2P1PB 4XOSA 3W3NA 4CC4C 4B8CD 3OGMB 4PSJA 5B0TA 2RR6A 2Z81A 4QC0A 1IO0A 4MQWX 4R0AA 1FS2A 4R6AA 4AW4A 2O6RA 4Z94G 4CNCA 3G3BA 1U0ND 3RJ0A 4J0MA 1O6TA 4I6JB 4U7LA 5HZLB 4H09A 4M7EC 2OMTA 3VQ2A 4V2CA 4LI1A 1K5DC 4R6JA 3WN4A 2Z62A 4QXEA 5AWAA 2V70A 5FTTB 4PERA 3UL7A 3RIZA 4IM6A 5IJCA 1DCEA 4FDWA 3O53A 1O6VA 4BSRA 1XCDA 4L3AA 1A9NA 2BNHA 2IFGA 2UZXA 5GS0A 2OMXA 4U09A 1QYYA 1OTMA 3M18A 5LFNA 3C6OB 3W3JA 4PKIG 5IYXC 5GMHA 1FT8A 3W3GA 2CA6A 3RFJA 3W3KA 1OGQA 5GMFA 3ZYOA 4KXFB 1OOKG 3G04C 3ULUA 3SB4A 2Z64A 2JQDA 4Z79A 2Z63A 4L3FA 3OJAA 4BSSA 2WQXA 1XWDC 4G8AA 2V9TB 4LSCA 3TSRE 4FD0A 3E3ZA 4RWTC 5AZ5A 5CMNA 4CNMA 1OTOA 1P9AG 4MN8B 4R6GA 1H6UA 4LI2A 2WFHA 4LXRA 2WQUA 1P8TA 2O6SA 2OMUA 3ZYNA 1M9SA 3BZ5A 2O6QA 4LSXA 4BV4R 4R5DA 4CP6A 4Q62A 3ZYIA 2P1NB 3E4GA 4P8SA 3CIYA 3OGLB 3FXIA 3WPHA 4YEBB 4FHOA 5D3IA 4NKHA 1Z7XW 4U08A 1K5GC 3OJAB 1P8VA 4ARNA 1OTNA 4QBZA 4AY9X 1FO1A 1G9UA 2Y5QA 3CIGA 4Y61B 1KOHA 4P91A 2OMZA 3C6NB 3JB9j 3RGZA 4R58A 4LSAA 1DS9A 2OMVA 3OGKB 3RGXA 1H6TA 3ZYJA 1W8AA 2Z65A 2P1MB 3W3LA 4V2EA 3G06A 2V9SA 4CC4A 2WQVA 2P1QB 4R09A 1WWLA 3REZA 4UFRA 5A5CA 4WP6A 4CILA 4LSXC 2Q4GW 5AWBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FT3 A;  1XEC A;  3RFE A;  3WPE A;  1A4Y A;  1M10 B;  3CVR A;  1PGV A;  3PMH G;  4NKG A;  4GLP A;  4C2A B;  3WPB A;  4M7E A;  3WPF A;  4WYK A;  1LTX A;  4ECO A;  3UL8 A;  3VQ1 A;  2Z66 A;  2XOT A;  4TZH A;  3WPC A;  4OQT A;  2UZY A;  4V2D A;  2RA8 A;  4Z61 C;  3RW7 A;  3W3M A;  5GMG A;  4Z8G A;  1SQ0 B;  4LXS A;  2BEX A;  3C6P B;  4Q3I A;  3GOZ A;  3G3A A;  4Z64 C;  4EZG A;  3E6J A;  4XGO A;  4K17 A;  3UN9 A;  5IJD A;  2OMW A;  5GS2 B;  4HQ1 A;  2ID5 A;  3WPG A;  4U06 A;  4PEQ B;  3P72 A;  3RFS A;  3ULA A;  4RCW A;  1D0B A;  5B0N A;  1O6S A;  4KNG A;  2JE0 A;  3UL9 A;  3WPD A;  2XWT C;  1M0Z A;  3A79 B;  4Q3G A;  2JE1 A;  2R9U A;  4FMZ A;  4XSQ A;  5AWC A;  3O6N A;  1KOO A;  1FQV A;  5B4P A;  4FCG A;  2P1O B;  2Z82 A;  4ARR A;  1XEU A;  4C2B B;  1M9L A;  2Z7X A;  3KJ4 A;  4R6F A;  2WQW A;  2ELL A;  4R08 A;  4KT1 A;  3WPI A;  1GWB A;  3ULV A;  2OMY A;  4ECN A;  4J4L A;  1JL5 A;  1OZN A;  4FS7 A;  4RCA B;  1YRG A;  4R5C A;  1XKU A;  2ASS B;  1DFJ I;  5GQR K;  3M19 A;  3G39 A;  5HDH A;  3RW6 A;  5CMP A;  4R07 A;  4GT6 A;  3E2J A;  1ZIW A;  5IJB A;  2AST B;  4PQ8 A;  5AWD A;  2A0Z A;  2Z7X B;  3DZE A;  4BSU A;  2P1P B;  4XOS A;  3W3N A;  4CC4 C;  4B8C D;  3OGM B;  4PSJ A;  5B0T A;  2RR6 A;  2Z81 A;  4QC0 A;  1IO0 A;  4MQW X;  4R0A A;  1FS2 A;  4R6A A;  4AW4 A;  2O6R A;  4Z94 G;  4CNC A;  3G3B A;  1U0N D;  3RJ0 A;  4J0M A;  1O6T A;  4I6J B;  4U7L A;  5HZL B;  4H09 A;  4M7E C;  2OMT A;  3VQ2 A;  4V2C A;  4LI1 A;  1K5D C;  4R6J A;  3WN4 A;  2Z62 A;  4QXE A;  5AWA A;  2V70 A;  5FTT B;  4PER A;  3UL7 A;  3RIZ A;  4IM6 A;  5IJC A;  1DCE A;  4FDW A;  3O53 A;  1O6V A;  4BSR A;  1XCD A;  4L3A A;  1A9N A;  2BNH A;  2IFG A;  2UZX A;  5GS0 A;  2OMX A;  4U09 A;  1QYY A;  1OTM A;  3M18 A;  5LFN A;  3C6O B;  3W3J A;  4PKI G;  5IYX C;  5GMH A;  1FT8 A;  3W3G A;  2CA6 A;  3RFJ A;  3W3K A;  1OGQ A;  5GMF A;  3ZYO A;  4KXF B;  1OOK G;  3G04 C;  3ULU A;  3SB4 A;  2Z64 A;  2JQD A;  4Z79 A;  2Z63 A;  4L3F A;  3OJA A;  4BSS A;  2WQX A;  1XWD C;  4G8A A;  2V9T B;  4LSC A;  3TSR E;  4FD0 A;  3E3Z A;  4RWT C;  5AZ5 A;  5CMN A;  4CNM A;  1OTO A;  1P9A G;  4MN8 B;  4R6G A;  1H6U A;  4LI2 A;  2WFH A;  4LXR A;  2WQU A;  1P8T A;  2O6S A;  2OMU A;  3ZYN A;  1M9S A;  3BZ5 A;  2O6Q A;  4LSX A;  4BV4 R;  4R5D A;  4CP6 A;  4Q62 A;  3ZYI A;  2P1N B;  3E4G A;  4P8S A;  3CIY A;  3OGL B;  3FXI A;  3WPH A;  4YEB B;  4FHO A;  5D3I A;  4NKH A;  1Z7X W;  4U08 A;  1K5G C;  3OJA B;  1P8V A;  4ARN A;  1OTN A;  4QBZ A;  4AY9 X;  1FO1 A;  1G9U A;  2Y5Q A;  3CIG A;  4Y61 B;  1KOH A;  4P91 A;  2OMZ A;  3C6N B;  3JB9 j;  3RGZ A;  4R58 A;  4LSA A;  1DS9 A;  2OMV A;  3OGK B;  3RGX A;  1H6T A;  3ZYJ A;  1W8A A;  2Z65 A;  2P1M B;  3W3L A;  4V2E A;  3G06 A;  2V9S A;  4CC4 A;  2WQV A;  2P1Q B;  4R09 A;  1WWL A;  3REZ A;  4UFR A;  5A5C A;  4WP6 A;  4CIL A;  4LSX C;  2Q4G W;  5AWB A; 
#chains in the Genus database with same CATH topology
 2FT3 A;  1XEC A;  3RFE A;  3WPE A;  1A4Y A;  1M10 B;  3CVR A;  1PGV A;  3PMH G;  4NKG A;  4GLP A;  4C2A B;  3WPB A;  4M7E A;  3WPF A;  4WYK A;  1LTX A;  4ECO A;  3UL8 A;  3VQ1 A;  2Z66 A;  2XOT A;  4TZH A;  3WPC A;  4OQT A;  2UZY A;  4V2D A;  2RA8 A;  4Z61 C;  3RW7 A;  3W3M A;  5GMG A;  4Z8G A;  1SQ0 B;  4LXS A;  2BEX A;  3C6P B;  4Q3I A;  3GOZ A;  3G3A A;  4NZR M;  4Z64 C;  4EZG A;  3E6J A;  4XGO A;  4K17 A;  3UN9 A;  5IJD A;  2OMW A;  5GS2 B;  4HQ1 A;  2ID5 A;  3WPG A;  4U06 A;  4PEQ B;  3P72 A;  3RFS A;  3ULA A;  4RCW A;  1D0B A;  5B0N A;  1O6S A;  4KNG A;  2JE0 A;  3UL9 A;  3WPD A;  2XWT C;  1M0Z A;  3A79 B;  4Q3G A;  2JE1 A;  2R9U A;  4FMZ A;  4XSQ A;  5AWC A;  3O6N A;  1KOO A;  1FQV A;  5B4P A;  4FCG A;  2P1O B;  2Z82 A;  4ARR A;  1XEU A;  4C2B B;  1M9L A;  2Z7X A;  3KJ4 A;  4R6F A;  2WQW A;  2ELL A;  4R08 A;  4KT1 A;  3WPI A;  1GWB A;  3ULV A;  2OMY A;  4ECN A;  4J4L A;  1JL5 A;  1OZN A;  4FS7 A;  4RCA B;  1YRG A;  4R5C A;  1XKU A;  2ASS B;  1DFJ I;  5GQR K;  3M19 A;  3G39 A;  5HDH A;  3RW6 A;  5CMP A;  4R07 A;  4GT6 A;  3E2J A;  1ZIW A;  5IJB A;  2AST B;  4PQ8 A;  5AWD A;  2A0Z A;  2Z7X B;  3DZE A;  4BSU A;  2P1P B;  4XOS A;  3W3N A;  4CC4 C;  4B8C D;  3OGM B;  4PSJ A;  5B0T A;  2RR6 A;  2Z81 A;  4QC0 A;  1IO0 A;  4MQW X;  4R0A A;  1FS2 A;  4R6A A;  4AW4 A;  2O6R A;  4Z94 G;  4CNC A;  3G3B A;  1U0N D;  3RJ0 A;  4J0M A;  1O6T A;  4I6J B;  4NZT M;  4U7L A;  5HZL B;  4H09 A;  4M7E C;  2OMT A;  3VQ2 A;  4V2C A;  4LI1 A;  1K5D C;  4R6J A;  3WN4 A;  2Z62 A;  4QXE A;  5AWA A;  2V70 A;  5FTT B;  4PER A;  3UL7 A;  3RIZ A;  4IM6 A;  5IJC A;  1DCE A;  4FDW A;  3O53 A;  1O6V A;  4BSR A;  1XCD A;  4L3A A;  1A9N A;  2BNH A;  2IFG A;  2UZX A;  5GS0 A;  2OMX A;  4U09 A;  1QYY A;  1OTM A;  3M18 A;  5LFN A;  3C6O B;  3W3J A;  4PKI G;  5IYX C;  5GMH A;  1FT8 A;  3W3G A;  2CA6 A;  3RFJ A;  3W3K A;  1OGQ A;  5GMF A;  3ZYO A;  4KXF B;  1OOK G;  3G04 C;  3ULU A;  3SB4 A;  2Z64 A;  2JQD A;  4Z79 A;  2Z63 A;  4L3F A;  3OJA A;  4BSS A;  2WQX A;  1XWD C;  4G8A A;  2V9T B;  4LSC A;  3TSR E;  4FD0 A;  3E3Z A;  4RWT C;  5AZ5 A;  5CMN A;  4CNM A;  1OTO A;  1P9A G;  4MN8 B;  4R6G A;  1H6U A;  4LI2 A;  2WFH A;  4LXR A;  2WQU A;  1P8T A;  2O6S A;  2OMU A;  3ZYN A;  1M9S A;  3BZ5 A;  2O6Q A;  4LSX A;  4BV4 R;  4R5D A;  4CP6 A;  4Q62 A;  3ZYI A;  2P1N B;  3E4G A;  4P8S A;  3CIY A;  3OGL B;  3FXI A;  3WPH A;  4YEB B;  4FHO A;  5D3I A;  4NKH A;  1Z7X W;  4U08 A;  1K5G C;  3OJA B;  1P8V A;  4ARN A;  1OTN A;  4QBZ A;  4AY9 X;  1FO1 A;  1G9U A;  2Y5Q A;  3CIG A;  4Y61 B;  1KOH A;  4P91 A;  2OMZ A;  3C6N B;  3JB9 j;  3RGZ A;  4R58 A;  4LSA A;  1DS9 A;  2OMV A;  3OGK B;  3RGX A;  1H6T A;  3ZYJ A;  1W8A A;  2Z65 A;  2P1M B;  3W3L A;  4V2E A;  3G06 A;  2V9S A;  4CC4 A;  2WQV A;  2P1Q B;  4R09 A;  1WWL A;  3REZ A;  4UFR A;  5A5C A;  4WP6 A;  4CIL A;  4LSX C;  2Q4G W;  5AWB A; 
#chains in the Genus database with same CATH homology
 2FT3 A;  1XEC A;  3RFE A;  3WPE A;  1A4Y A;  1M10 B;  3CVR A;  1PGV A;  3PMH G;  4NKG A;  4GLP A;  4C2A B;  3WPB A;  4M7E A;  3WPF A;  4WYK A;  1LTX A;  4ECO A;  3UL8 A;  3VQ1 A;  2Z66 A;  2XOT A;  4TZH A;  3WPC A;  4OQT A;  2UZY A;  4V2D A;  2RA8 A;  4Z61 C;  3RW7 A;  3W3M A;  5GMG A;  4Z8G A;  1SQ0 B;  4LXS A;  2BEX A;  3C6P B;  4Q3I A;  3GOZ A;  3G3A A;  4Z64 C;  4EZG A;  3E6J A;  4XGO A;  4K17 A;  3UN9 A;  5IJD A;  2OMW A;  5GS2 B;  4HQ1 A;  2ID5 A;  3WPG A;  4U06 A;  4PEQ B;  3P72 A;  3RFS A;  3ULA A;  4RCW A;  1D0B A;  5B0N A;  1O6S A;  4KNG A;  2JE0 A;  3UL9 A;  3WPD A;  2XWT C;  1M0Z A;  3A79 B;  4Q3G A;  2JE1 A;  2R9U A;  4FMZ A;  4XSQ A;  5AWC A;  3O6N A;  1KOO A;  1FQV A;  5B4P A;  4FCG A;  2P1O B;  2Z82 A;  4ARR A;  1XEU A;  4C2B B;  1M9L A;  2Z7X A;  3KJ4 A;  4R6F A;  2WQW A;  2ELL A;  4R08 A;  4KT1 A;  3WPI A;  1GWB A;  3ULV A;  2OMY A;  4ECN A;  4J4L A;  1JL5 A;  1OZN A;  4FS7 A;  4RCA B;  1YRG A;  4R5C A;  1XKU A;  2ASS B;  1DFJ I;  5GQR K;  3M19 A;  3G39 A;  5HDH A;  3RW6 A;  5CMP A;  4R07 A;  4GT6 A;  3E2J A;  1ZIW A;  5IJB A;  2AST B;  4PQ8 A;  5AWD A;  2A0Z A;  2Z7X B;  3DZE A;  4BSU A;  2P1P B;  4XOS A;  3W3N A;  4CC4 C;  4B8C D;  3OGM B;  4PSJ A;  5B0T A;  2RR6 A;  2Z81 A;  4QC0 A;  1IO0 A;  4MQW X;  4R0A A;  1FS2 A;  4R6A A;  4AW4 A;  2O6R A;  4Z94 G;  4CNC A;  3G3B A;  1U0N D;  3RJ0 A;  4J0M A;  1O6T A;  4I6J B;  4U7L A;  5HZL B;  4H09 A;  4M7E C;  2OMT A;  3VQ2 A;  4V2C A;  4LI1 A;  1K5D C;  4R6J A;  3WN4 A;  2Z62 A;  4QXE A;  5AWA A;  2V70 A;  5FTT B;  4PER A;  3UL7 A;  3RIZ A;  4IM6 A;  5IJC A;  1DCE A;  4FDW A;  3O53 A;  1O6V A;  4BSR A;  1XCD A;  4L3A A;  1A9N A;  2BNH A;  2IFG A;  2UZX A;  5GS0 A;  2OMX A;  4U09 A;  1QYY A;  1OTM A;  3M18 A;  5LFN A;  3C6O B;  3W3J A;  4PKI G;  5IYX C;  5GMH A;  1FT8 A;  3W3G A;  2CA6 A;  3RFJ A;  3W3K A;  1OGQ A;  5GMF A;  3ZYO A;  4KXF B;  1OOK G;  3G04 C;  3ULU A;  3SB4 A;  2Z64 A;  2JQD A;  4Z79 A;  2Z63 A;  4L3F A;  3OJA A;  4BSS A;  2WQX A;  1XWD C;  4G8A A;  2V9T B;  4LSC A;  3TSR E;  4FD0 A;  3E3Z A;  4RWT C;  5AZ5 A;  5CMN A;  4CNM A;  1OTO A;  1P9A G;  4MN8 B;  4R6G A;  1H6U A;  4LI2 A;  2WFH A;  4LXR A;  2WQU A;  1P8T A;  2O6S A;  2OMU A;  3ZYN A;  1M9S A;  3BZ5 A;  2O6Q A;  4LSX A;  4BV4 R;  4R5D A;  4CP6 A;  4Q62 A;  3ZYI A;  2P1N B;  3E4G A;  4P8S A;  3CIY A;  3OGL B;  3FXI A;  3WPH A;  4YEB B;  4FHO A;  5D3I A;  4NKH A;  1Z7X W;  4U08 A;  1K5G C;  3OJA B;  1P8V A;  4ARN A;  1OTN A;  4QBZ A;  4AY9 X;  1FO1 A;  1G9U A;  2Y5Q A;  3CIG A;  4Y61 B;  1KOH A;  4P91 A;  2OMZ A;  3C6N B;  3JB9 j;  3RGZ A;  4R58 A;  4LSA A;  1DS9 A;  2OMV A;  3OGK B;  3RGX A;  1H6T A;  3ZYJ A;  1W8A A;  2Z65 A;  2P1M B;  3W3L A;  4V2E A;  3G06 A;  2V9S A;  4CC4 A;  2WQV A;  2P1Q B;  4R09 A;  1WWL A;  3REZ A;  4UFR A;  5A5C A;  4WP6 A;  4CIL A;  4LSX C;  2Q4G W;  5AWB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...