4LI2A

Crystal structures of lgr4 and its complex with r-spondin1
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
422
structure length
422
Chain Sequence
PCPAPCACDLDGGADCSGKGLVTVPDGLSVFTHSLDLSMNNITKLPEGAFKGFPYLEELRLAGNDLSIIHPMALSGLKELKVLTLQNNQLKTVPSESLKGLVSLQSLRLDANHIVTVPEDSFEGLVQLRHLWLDDNSLTEVPIRPLSNLPSLQALTLALNKISHIPDYAFSNLSSLVVLHLHNNKIRTLGPHSFHGLDNLEALDLNYNNLIDFPDSIRSLPNLKELGFHSNSITIIPDGAFVKNPLLRTIHLYDNPLSFVGNSAFQNLSDLHFLIIRGASNVQWFPNLTGTNNLESLTLTGTKIRSIPIKFCQEQKMLRTLDLSYNEISALVGFEGCSSLEEVYLQNNQIQEVQNETFQGLAALRMLDLSRNRIHTIHKEAFVTLKALTNLDLSFNDLTAFPTAGLHGLNQLKLTGNPNFKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Leucine-rich repeat-containing G-protein coupled receptor 4
publication title Crystal structures of lgr4 and its complex with R-spondin1.
pubmed doi rcsb
source organism Xenopus (silurana) tropicalis
molecule tags Hormone receptor/signaling protein
total genus 102
structure length 422
sequence length 422
ec nomenclature
pdb deposition date 2013-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13855 LRR_8 Leucine rich repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 4li2A00
2WQXA 3CVRA 2FT3A 4Z8GA 1XECA 4H09A 3W3LA 5AZ5A 4MN8B 3ZYJA 2Z82A 4P91A 3RW7A 4LSAA 5IJDA 5IYXC 3CIYA 1M0ZA 1IO0A 4KT1A 3ZYOA 4EZGA 1FT8A 5AWBA 5LFNA 2Y5QA 2P1OB 4Q3IA 1DCEA 2OMXA 4R5CA 5D3IA 2ASTB 4FMZA 4WYKA 3UL7A 4BSRA 1LTXA 4RCAB 3M19A 4FS7A 3W3NA 2JQDA 1ZIWA 3RFJA 3ZYIA 5GMFA 4LI2A 5B4PA 4U08A 2V9SA 3ZYNA 2UZYA 1D0BA 2RA8A 4HQ1A 2WQUA 4QC0A 1XWDC 1YRGA 2OMVA 3VQ1A 2O6SA 3E3ZA 4LI1A 3UL9A 1M10B 1OGQA 3PMHG 4LSCA 1PGVA 1GWBA 1U0ND 4FDWA 2BNHA 4U09A 3VQ2A 3WPBA 4Y61B 3O6NA 3A79B 3G3BA 4J4LA 4IM6A 3C6OB 2P1NB 2V70A 5A5CA 1XEUA 2JE1A 4CP6A 1O6SA 4ARNA 3W3MA 5AWCA 4LSXA 4K17A 5HDHA 3WN4A 2Z63A 5AWDA 4ECOA 4J0MA 1OTOA 1A4YA 4U7LA 4AY9X 1XCDA 3WPCA 4ECNA 4KNGA 4V2CA 4LSXC 2O6RA 3RGXA 4Q3GA 4R6FA 3WPEA 4PQ8A 1OOKG 3FXIA 5B0TA 1K5DC 1M9SA 3OGKB 1M9LA 4R6AA 3E6JA 1K5GC 3WPHA 4RCWA 1QYYA 3ULAA 2P1PB 4XSQA 2IFGA 2OMTA 3JB9j 1WWLA 5GQRK 4FHOA 2CA6A 2OMYA 5CMNA 2Z64A 3E2JA 5GMHA 5GS0A 4OQTA 4BSUA 4RWTC 4Z94G 2WQVA 4QXEA 4GLPA 1SQ0B 4KXFB 1FQVA 4CC4A 3RFEA 2ASSB 4CNCA 3G39A 2Z7XB 2Z7XA 5IJBA 2OMWA 3P72A 2OMUA 2WQWA 4PEQB 4CC4C 1G9UA 3WPGA 4XOSA 5FTTB 3KJ4A 4V2EA 4L3AA 1O6TA 2ID5A 2R9UA 5GS2B 3RGZA 1OZNA 3RW6A 1XKUA 1KOHA 4R09A 5HZLB 5IJCA 4CILA 3G04C 5AWAA 4R6JA 4Z79A 1P8TA 2P1QB 4CNMA 2A0ZA 4U06A 4M7EC 1OTMA 1DS9A 3OGMB 4NKHA 3ULUA 4R6GA 4XGOA 4Z61C 2O6QA 2JE0A 3DZEA 4YEBB 3RFSA 4FD0A 2XOTA 4MQWX 4R58A 2Q4GW 3WPFA 3REZA 1H6TA 4V2DA 4R08A 4Z64C 4C2BB 3GOZA 3ULVA 3M18A 3BZ5A 4WP6A 4R0AA 1P9AG 4NKGA 2ELLA 2WFHA 3W3GA 2Z65A 4R07A 1JL5A 4QBZA 3WPIA 4AW4A 4I6JB 5CMPA 3W3KA 1W8AA 3OJAB 4P8SA 2V9TB 3C6NB 4PKIG 2Z62A 3OJAA 4FCGA 2Z66A 5GMGA 1P8VA 3RJ0A 4TZHA 1FS2A 4L3FA 4G8AA 2XWTC 1O6VA 2OMZA 3UL8A 2BEXA 5B0NA 1DFJI 4Q62A 4UFRA 4GT6A 3UN9A 4LXRA 3RIZA 3E4GA 3G06A 1A9NA 1KOOA 3W3JA 2Z81A 4C2AB 3SB4A 4LXSA 1H6UA 2P1MB 2RR6A 3OGLB 4M7EA 3TSRE 4BSSA 3O53A 3WPDA 4R5DA 3G3AA 4PERA 4PSJA 4BV4R 4ARRA 1Z7XW 2UZXA 3C6PB 4B8CD 1FO1A 1OTNA 3CIGA
chains in the Genus database with same CATH superfamily
2WQXA 3CVRA 2FT3A 4Z8GA 1XECA 4H09A 3W3LA 5AZ5A 4MN8B 3ZYJA 2Z82A 4P91A 3RW7A 4LSAA 5IJDA 5IYXC 3CIYA 1M0ZA 1IO0A 4KT1A 3ZYOA 4EZGA 1FT8A 5AWBA 5LFNA 2Y5QA 2P1OB 4Q3IA 1DCEA 2OMXA 4R5CA 5D3IA 2ASTB 4FMZA 4WYKA 3UL7A 4BSRA 1LTXA 4RCAB 3M19A 4FS7A 3W3NA 2JQDA 1ZIWA 3RFJA 3ZYIA 5GMFA 4LI2A 5B4PA 4U08A 2V9SA 3ZYNA 2UZYA 1D0BA 2RA8A 4HQ1A 2WQUA 4QC0A 1XWDC 1YRGA 2OMVA 3VQ1A 2O6SA 3E3ZA 4LI1A 3UL9A 1M10B 1OGQA 3PMHG 4LSCA 1PGVA 1GWBA 1U0ND 4FDWA 2BNHA 4U09A 3VQ2A 3WPBA 4Y61B 3O6NA 3A79B 3G3BA 4J4LA 4IM6A 3C6OB 2P1NB 2V70A 5A5CA 1XEUA 2JE1A 4CP6A 1O6SA 4ARNA 3W3MA 5AWCA 4LSXA 4K17A 5HDHA 3WN4A 2Z63A 5AWDA 4ECOA 4J0MA 1OTOA 1A4YA 4U7LA 4AY9X 1XCDA 3WPCA 4ECNA 4KNGA 4V2CA 4LSXC 2O6RA 3RGXA 4Q3GA 4R6FA 3WPEA 4PQ8A 1OOKG 3FXIA 5B0TA 1K5DC 1M9SA 3OGKB 1M9LA 4R6AA 3E6JA 1K5GC 3WPHA 4RCWA 1QYYA 3ULAA 2P1PB 4XSQA 2IFGA 2OMTA 3JB9j 1WWLA 5GQRK 4FHOA 2CA6A 2OMYA 5CMNA 2Z64A 3E2JA 5GMHA 5GS0A 4NZRM 4OQTA 4BSUA 4RWTC 4Z94G 2WQVA 4QXEA 4GLPA 1SQ0B 4KXFB 1FQVA 4CC4A 3RFEA 2ASSB 4CNCA 3G39A 2Z7XB 2Z7XA 5IJBA 2OMWA 3P72A 2OMUA 2WQWA 4PEQB 4CC4C 1G9UA 3WPGA 4XOSA 5FTTB 3KJ4A 4V2EA 4L3AA 1O6TA 2ID5A 2R9UA 5GS2B 3RGZA 1OZNA 3RW6A 1XKUA 1KOHA 4R09A 5HZLB 5IJCA 4CILA 3G04C 5AWAA 4R6JA 4Z79A 1P8TA 2P1QB 4CNMA 2A0ZA 4U06A 4M7EC 1OTMA 1DS9A 3OGMB 4NKHA 3ULUA 4R6GA 4XGOA 4Z61C 2O6QA 2JE0A 3DZEA 4YEBB 3RFSA 4FD0A 2XOTA 4MQWX 4R58A 2Q4GW 3WPFA 3REZA 1H6TA 4V2DA 4R08A 4Z64C 4C2BB 3GOZA 3ULVA 3M18A 3BZ5A 4WP6A 4R0AA 1P9AG 4NKGA 2ELLA 2WFHA 3W3GA 2Z65A 4R07A 1JL5A 4QBZA 3WPIA 4AW4A 4I6JB 5CMPA 3W3KA 1W8AA 3OJAB 4P8SA 2V9TB 3C6NB 4PKIG 2Z62A 3OJAA 4FCGA 2Z66A 5GMGA 1P8VA 3RJ0A 4TZHA 1FS2A 4L3FA 4G8AA 2XWTC 1O6VA 2OMZA 3UL8A 2BEXA 5B0NA 1DFJI 4Q62A 4UFRA 4GT6A 4NZTM 3UN9A 4LXRA 3RIZA 3E4GA 3G06A 1A9NA 1KOOA 3W3JA 2Z81A 4C2AB 3SB4A 4LXSA 1H6UA 2P1MB 2RR6A 3OGLB 4M7EA 3TSRE 4BSSA 3O53A 3WPDA 4R5DA 3G3AA 4PERA 4PSJA 4BV4R 4ARRA 1Z7XW 2UZXA 3C6PB 4B8CD 1FO1A 1OTNA 3CIGA
chains in the Genus database with same CATH topology
2WQXA 3CVRA 2FT3A 4Z8GA 1XECA 4H09A 3W3LA 5AZ5A 4MN8B 3ZYJA 2Z82A 4P91A 3RW7A 4LSAA 5IJDA 5IYXC 3CIYA 1M0ZA 1IO0A 4KT1A 3ZYOA 4EZGA 1FT8A 5AWBA 5LFNA 2Y5QA 2P1OB 4Q3IA 1DCEA 2OMXA 4R5CA 5D3IA 2ASTB 4FMZA 4WYKA 3UL7A 4BSRA 1LTXA 4RCAB 3M19A 4FS7A 3W3NA 2JQDA 1ZIWA 3RFJA 3ZYIA 5GMFA 4LI2A 5B4PA 4U08A 2V9SA 3ZYNA 2UZYA 1D0BA 2RA8A 4HQ1A 2WQUA 4QC0A 1XWDC 1YRGA 2OMVA 3VQ1A 2O6SA 3E3ZA 4LI1A 3UL9A 1M10B 1OGQA 3PMHG 4LSCA 1PGVA 1GWBA 1U0ND 4FDWA 2BNHA 4U09A 3VQ2A 3WPBA 4Y61B 3O6NA 3A79B 3G3BA 4J4LA 4IM6A 3C6OB 2P1NB 2V70A 5A5CA 1XEUA 2JE1A 4CP6A 1O6SA 4ARNA 3W3MA 5AWCA 4LSXA 4K17A 5HDHA 3WN4A 2Z63A 5AWDA 4ECOA 4J0MA 1OTOA 1A4YA 4U7LA 4AY9X 1XCDA 3WPCA 4ECNA 4KNGA 4V2CA 4LSXC 2O6RA 3RGXA 4Q3GA 4R6FA 3WPEA 4PQ8A 1OOKG 3FXIA 5B0TA 1K5DC 1M9SA 3OGKB 1M9LA 4R6AA 3E6JA 1K5GC 3WPHA 4RCWA 1QYYA 3ULAA 2P1PB 4XSQA 2IFGA 2OMTA 3JB9j 1WWLA 5GQRK 4FHOA 2CA6A 2OMYA 5CMNA 2Z64A 3E2JA 5GMHA 5GS0A 4OQTA 4BSUA 4RWTC 4Z94G 2WQVA 4QXEA 4GLPA 1SQ0B 4KXFB 1FQVA 4CC4A 3RFEA 2ASSB 4CNCA 3G39A 2Z7XB 2Z7XA 5IJBA 2OMWA 3P72A 2OMUA 2WQWA 4PEQB 4CC4C 1G9UA 3WPGA 4XOSA 5FTTB 3KJ4A 4V2EA 4L3AA 1O6TA 2ID5A 2R9UA 5GS2B 3RGZA 1OZNA 3RW6A 1XKUA 1KOHA 4R09A 5HZLB 5IJCA 4CILA 3G04C 5AWAA 4R6JA 4Z79A 1P8TA 2P1QB 4CNMA 2A0ZA 4U06A 4M7EC 1OTMA 1DS9A 3OGMB 4NKHA 3ULUA 4R6GA 4XGOA 4Z61C 2O6QA 2JE0A 3DZEA 4YEBB 3RFSA 4FD0A 2XOTA 4MQWX 4R58A 2Q4GW 3WPFA 3REZA 1H6TA 4V2DA 4R08A 4Z64C 4C2BB 3GOZA 3ULVA 3M18A 3BZ5A 4WP6A 4R0AA 1P9AG 4NKGA 2ELLA 2WFHA 3W3GA 2Z65A 4R07A 1JL5A 4QBZA 3WPIA 4AW4A 4I6JB 5CMPA 3W3KA 1W8AA 3OJAB 4P8SA 2V9TB 3C6NB 4PKIG 2Z62A 3OJAA 4FCGA 2Z66A 5GMGA 1P8VA 3RJ0A 4TZHA 1FS2A 4L3FA 4G8AA 2XWTC 1O6VA 2OMZA 3UL8A 2BEXA 5B0NA 1DFJI 4Q62A 4UFRA 4GT6A 3UN9A 4LXRA 3RIZA 3E4GA 3G06A 1A9NA 1KOOA 3W3JA 2Z81A 4C2AB 3SB4A 4LXSA 1H6UA 2P1MB 2RR6A 3OGLB 4M7EA 3TSRE 4BSSA 3O53A 3WPDA 4R5DA 3G3AA 4PERA 4PSJA 4BV4R 4ARRA 1Z7XW 2UZXA 3C6PB 4B8CD 1FO1A 1OTNA 3CIGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WQX A;  3CVR A;  2FT3 A;  4Z8G A;  1XEC A;  4H09 A;  3W3L A;  5AZ5 A;  4MN8 B;  3ZYJ A;  2Z82 A;  4P91 A;  3RW7 A;  4LSA A;  5IJD A;  5IYX C;  3CIY A;  1M0Z A;  1IO0 A;  4KT1 A;  3ZYO A;  4EZG A;  1FT8 A;  5AWB A;  5LFN A;  2Y5Q A;  2P1O B;  4Q3I A;  1DCE A;  2OMX A;  4R5C A;  5D3I A;  2AST B;  4FMZ A;  4WYK A;  3UL7 A;  4BSR A;  1LTX A;  4RCA B;  3M19 A;  4FS7 A;  3W3N A;  2JQD A;  1ZIW A;  3RFJ A;  3ZYI A;  5GMF A;  4LI2 A;  5B4P A;  4U08 A;  2V9S A;  3ZYN A;  2UZY A;  1D0B A;  2RA8 A;  4HQ1 A;  2WQU A;  4QC0 A;  1XWD C;  1YRG A;  2OMV A;  3VQ1 A;  2O6S A;  3E3Z A;  4LI1 A;  3UL9 A;  1M10 B;  1OGQ A;  3PMH G;  4LSC A;  1PGV A;  1GWB A;  1U0N D;  4FDW A;  2BNH A;  4U09 A;  3VQ2 A;  3WPB A;  4Y61 B;  3O6N A;  3A79 B;  3G3B A;  4J4L A;  4IM6 A;  3C6O B;  2P1N B;  2V70 A;  5A5C A;  1XEU A;  2JE1 A;  4CP6 A;  1O6S A;  4ARN A;  3W3M A;  5AWC A;  4LSX A;  4K17 A;  5HDH A;  3WN4 A;  2Z63 A;  5AWD A;  4ECO A;  4J0M A;  1OTO A;  1A4Y A;  4U7L A;  4AY9 X;  1XCD A;  3WPC A;  4ECN A;  4KNG A;  4V2C A;  4LSX C;  2O6R A;  3RGX A;  4Q3G A;  4R6F A;  3WPE A;  4PQ8 A;  1OOK G;  3FXI A;  5B0T A;  1K5D C;  1M9S A;  3OGK B;  1M9L A;  4R6A A;  3E6J A;  1K5G C;  3WPH A;  4RCW A;  1QYY A;  3ULA A;  2P1P B;  4XSQ A;  2IFG A;  2OMT A;  3JB9 j;  1WWL A;  5GQR K;  4FHO A;  2CA6 A;  2OMY A;  5CMN A;  2Z64 A;  3E2J A;  5GMH A;  5GS0 A;  4OQT A;  4BSU A;  4RWT C;  4Z94 G;  2WQV A;  4QXE A;  4GLP A;  1SQ0 B;  4KXF B;  1FQV A;  4CC4 A;  3RFE A;  2ASS B;  4CNC A;  3G39 A;  2Z7X B;  2Z7X A;  5IJB A;  2OMW A;  3P72 A;  2OMU A;  2WQW A;  4PEQ B;  4CC4 C;  1G9U A;  3WPG A;  4XOS A;  5FTT B;  3KJ4 A;  4V2E A;  4L3A A;  1O6T A;  2ID5 A;  2R9U A;  5GS2 B;  3RGZ A;  1OZN A;  3RW6 A;  1XKU A;  1KOH A;  4R09 A;  5HZL B;  5IJC A;  4CIL A;  3G04 C;  5AWA A;  4R6J A;  4Z79 A;  1P8T A;  2P1Q B;  4CNM A;  2A0Z A;  4U06 A;  4M7E C;  1OTM A;  1DS9 A;  3OGM B;  4NKH A;  3ULU A;  4R6G A;  4XGO A;  4Z61 C;  2O6Q A;  2JE0 A;  3DZE A;  4YEB B;  3RFS A;  4FD0 A;  2XOT A;  4MQW X;  4R58 A;  2Q4G W;  3WPF A;  3REZ A;  1H6T A;  4V2D A;  4R08 A;  4Z64 C;  4C2B B;  3GOZ A;  3ULV A;  3M18 A;  3BZ5 A;  4WP6 A;  4R0A A;  1P9A G;  4NKG A;  2ELL A;  2WFH A;  3W3G A;  2Z65 A;  4R07 A;  1JL5 A;  4QBZ A;  3WPI A;  4AW4 A;  4I6J B;  5CMP A;  3W3K A;  1W8A A;  3OJA B;  4P8S A;  2V9T B;  3C6N B;  4PKI G;  2Z62 A;  3OJA A;  4FCG A;  2Z66 A;  5GMG A;  1P8V A;  3RJ0 A;  4TZH A;  1FS2 A;  4L3F A;  4G8A A;  2XWT C;  1O6V A;  2OMZ A;  3UL8 A;  2BEX A;  5B0N A;  1DFJ I;  4Q62 A;  4UFR A;  4GT6 A;  3UN9 A;  4LXR A;  3RIZ A;  3E4G A;  3G06 A;  1A9N A;  1KOO A;  3W3J A;  2Z81 A;  4C2A B;  3SB4 A;  4LXS A;  1H6U A;  2P1M B;  2RR6 A;  3OGL B;  4M7E A;  3TSR E;  4BSS A;  3O53 A;  3WPD A;  4R5D A;  3G3A A;  4PER A;  4PSJ A;  4BV4 R;  4ARR A;  1Z7X W;  2UZX A;  3C6P B;  4B8C D;  1FO1 A;  1OTN A;  3CIG A; 
#chains in the Genus database with same CATH topology
 2WQX A;  3CVR A;  2FT3 A;  4Z8G A;  1XEC A;  4H09 A;  3W3L A;  5AZ5 A;  4MN8 B;  3ZYJ A;  2Z82 A;  4P91 A;  3RW7 A;  4LSA A;  5IJD A;  5IYX C;  3CIY A;  1M0Z A;  1IO0 A;  4KT1 A;  3ZYO A;  4EZG A;  1FT8 A;  5AWB A;  5LFN A;  2Y5Q A;  2P1O B;  4Q3I A;  1DCE A;  2OMX A;  4R5C A;  5D3I A;  2AST B;  4FMZ A;  4WYK A;  3UL7 A;  4BSR A;  1LTX A;  4RCA B;  3M19 A;  4FS7 A;  3W3N A;  2JQD A;  1ZIW A;  3RFJ A;  3ZYI A;  5GMF A;  4LI2 A;  5B4P A;  4U08 A;  2V9S A;  3ZYN A;  2UZY A;  1D0B A;  2RA8 A;  4HQ1 A;  2WQU A;  4QC0 A;  1XWD C;  1YRG A;  2OMV A;  3VQ1 A;  2O6S A;  3E3Z A;  4LI1 A;  3UL9 A;  1M10 B;  1OGQ A;  3PMH G;  4LSC A;  1PGV A;  1GWB A;  1U0N D;  4FDW A;  2BNH A;  4U09 A;  3VQ2 A;  3WPB A;  4Y61 B;  3O6N A;  3A79 B;  3G3B A;  4J4L A;  4IM6 A;  3C6O B;  2P1N B;  2V70 A;  5A5C A;  1XEU A;  2JE1 A;  4CP6 A;  1O6S A;  4ARN A;  3W3M A;  5AWC A;  4LSX A;  4K17 A;  5HDH A;  3WN4 A;  2Z63 A;  5AWD A;  4ECO A;  4J0M A;  1OTO A;  1A4Y A;  4U7L A;  4AY9 X;  1XCD A;  3WPC A;  4ECN A;  4KNG A;  4V2C A;  4LSX C;  2O6R A;  3RGX A;  4Q3G A;  4R6F A;  3WPE A;  4PQ8 A;  1OOK G;  3FXI A;  5B0T A;  1K5D C;  1M9S A;  3OGK B;  1M9L A;  4R6A A;  3E6J A;  1K5G C;  3WPH A;  4RCW A;  1QYY A;  3ULA A;  2P1P B;  4XSQ A;  2IFG A;  2OMT A;  3JB9 j;  1WWL A;  5GQR K;  4FHO A;  2CA6 A;  2OMY A;  5CMN A;  2Z64 A;  3E2J A;  5GMH A;  5GS0 A;  4NZR M;  4OQT A;  4BSU A;  4RWT C;  4Z94 G;  2WQV A;  4QXE A;  4GLP A;  1SQ0 B;  4KXF B;  1FQV A;  4CC4 A;  3RFE A;  2ASS B;  4CNC A;  3G39 A;  2Z7X B;  2Z7X A;  5IJB A;  2OMW A;  3P72 A;  2OMU A;  2WQW A;  4PEQ B;  4CC4 C;  1G9U A;  3WPG A;  4XOS A;  5FTT B;  3KJ4 A;  4V2E A;  4L3A A;  1O6T A;  2ID5 A;  2R9U A;  5GS2 B;  3RGZ A;  1OZN A;  3RW6 A;  1XKU A;  1KOH A;  4R09 A;  5HZL B;  5IJC A;  4CIL A;  3G04 C;  5AWA A;  4R6J A;  4Z79 A;  1P8T A;  2P1Q B;  4CNM A;  2A0Z A;  4U06 A;  4M7E C;  1OTM A;  1DS9 A;  3OGM B;  4NKH A;  3ULU A;  4R6G A;  4XGO A;  4Z61 C;  2O6Q A;  2JE0 A;  3DZE A;  4YEB B;  3RFS A;  4FD0 A;  2XOT A;  4MQW X;  4R58 A;  2Q4G W;  3WPF A;  3REZ A;  1H6T A;  4V2D A;  4R08 A;  4Z64 C;  4C2B B;  3GOZ A;  3ULV A;  3M18 A;  3BZ5 A;  4WP6 A;  4R0A A;  1P9A G;  4NKG A;  2ELL A;  2WFH A;  3W3G A;  2Z65 A;  4R07 A;  1JL5 A;  4QBZ A;  3WPI A;  4AW4 A;  4I6J B;  5CMP A;  3W3K A;  1W8A A;  3OJA B;  4P8S A;  2V9T B;  3C6N B;  4PKI G;  2Z62 A;  3OJA A;  4FCG A;  2Z66 A;  5GMG A;  1P8V A;  3RJ0 A;  4TZH A;  1FS2 A;  4L3F A;  4G8A A;  2XWT C;  1O6V A;  2OMZ A;  3UL8 A;  2BEX A;  5B0N A;  1DFJ I;  4Q62 A;  4UFR A;  4GT6 A;  4NZT M;  3UN9 A;  4LXR A;  3RIZ A;  3E4G A;  3G06 A;  1A9N A;  1KOO A;  3W3J A;  2Z81 A;  4C2A B;  3SB4 A;  4LXS A;  1H6U A;  2P1M B;  2RR6 A;  3OGL B;  4M7E A;  3TSR E;  4BSS A;  3O53 A;  3WPD A;  4R5D A;  3G3A A;  4PER A;  4PSJ A;  4BV4 R;  4ARR A;  1Z7X W;  2UZX A;  3C6P B;  4B8C D;  1FO1 A;  1OTN A;  3CIG A; 
#chains in the Genus database with same CATH homology
 2WQX A;  3CVR A;  2FT3 A;  4Z8G A;  1XEC A;  4H09 A;  3W3L A;  5AZ5 A;  4MN8 B;  3ZYJ A;  2Z82 A;  4P91 A;  3RW7 A;  4LSA A;  5IJD A;  5IYX C;  3CIY A;  1M0Z A;  1IO0 A;  4KT1 A;  3ZYO A;  4EZG A;  1FT8 A;  5AWB A;  5LFN A;  2Y5Q A;  2P1O B;  4Q3I A;  1DCE A;  2OMX A;  4R5C A;  5D3I A;  2AST B;  4FMZ A;  4WYK A;  3UL7 A;  4BSR A;  1LTX A;  4RCA B;  3M19 A;  4FS7 A;  3W3N A;  2JQD A;  1ZIW A;  3RFJ A;  3ZYI A;  5GMF A;  4LI2 A;  5B4P A;  4U08 A;  2V9S A;  3ZYN A;  2UZY A;  1D0B A;  2RA8 A;  4HQ1 A;  2WQU A;  4QC0 A;  1XWD C;  1YRG A;  2OMV A;  3VQ1 A;  2O6S A;  3E3Z A;  4LI1 A;  3UL9 A;  1M10 B;  1OGQ A;  3PMH G;  4LSC A;  1PGV A;  1GWB A;  1U0N D;  4FDW A;  2BNH A;  4U09 A;  3VQ2 A;  3WPB A;  4Y61 B;  3O6N A;  3A79 B;  3G3B A;  4J4L A;  4IM6 A;  3C6O B;  2P1N B;  2V70 A;  5A5C A;  1XEU A;  2JE1 A;  4CP6 A;  1O6S A;  4ARN A;  3W3M A;  5AWC A;  4LSX A;  4K17 A;  5HDH A;  3WN4 A;  2Z63 A;  5AWD A;  4ECO A;  4J0M A;  1OTO A;  1A4Y A;  4U7L A;  4AY9 X;  1XCD A;  3WPC A;  4ECN A;  4KNG A;  4V2C A;  4LSX C;  2O6R A;  3RGX A;  4Q3G A;  4R6F A;  3WPE A;  4PQ8 A;  1OOK G;  3FXI A;  5B0T A;  1K5D C;  1M9S A;  3OGK B;  1M9L A;  4R6A A;  3E6J A;  1K5G C;  3WPH A;  4RCW A;  1QYY A;  3ULA A;  2P1P B;  4XSQ A;  2IFG A;  2OMT A;  3JB9 j;  1WWL A;  5GQR K;  4FHO A;  2CA6 A;  2OMY A;  5CMN A;  2Z64 A;  3E2J A;  5GMH A;  5GS0 A;  4OQT A;  4BSU A;  4RWT C;  4Z94 G;  2WQV A;  4QXE A;  4GLP A;  1SQ0 B;  4KXF B;  1FQV A;  4CC4 A;  3RFE A;  2ASS B;  4CNC A;  3G39 A;  2Z7X B;  2Z7X A;  5IJB A;  2OMW A;  3P72 A;  2OMU A;  2WQW A;  4PEQ B;  4CC4 C;  1G9U A;  3WPG A;  4XOS A;  5FTT B;  3KJ4 A;  4V2E A;  4L3A A;  1O6T A;  2ID5 A;  2R9U A;  5GS2 B;  3RGZ A;  1OZN A;  3RW6 A;  1XKU A;  1KOH A;  4R09 A;  5HZL B;  5IJC A;  4CIL A;  3G04 C;  5AWA A;  4R6J A;  4Z79 A;  1P8T A;  2P1Q B;  4CNM A;  2A0Z A;  4U06 A;  4M7E C;  1OTM A;  1DS9 A;  3OGM B;  4NKH A;  3ULU A;  4R6G A;  4XGO A;  4Z61 C;  2O6Q A;  2JE0 A;  3DZE A;  4YEB B;  3RFS A;  4FD0 A;  2XOT A;  4MQW X;  4R58 A;  2Q4G W;  3WPF A;  3REZ A;  1H6T A;  4V2D A;  4R08 A;  4Z64 C;  4C2B B;  3GOZ A;  3ULV A;  3M18 A;  3BZ5 A;  4WP6 A;  4R0A A;  1P9A G;  4NKG A;  2ELL A;  2WFH A;  3W3G A;  2Z65 A;  4R07 A;  1JL5 A;  4QBZ A;  3WPI A;  4AW4 A;  4I6J B;  5CMP A;  3W3K A;  1W8A A;  3OJA B;  4P8S A;  2V9T B;  3C6N B;  4PKI G;  2Z62 A;  3OJA A;  4FCG A;  2Z66 A;  5GMG A;  1P8V A;  3RJ0 A;  4TZH A;  1FS2 A;  4L3F A;  4G8A A;  2XWT C;  1O6V A;  2OMZ A;  3UL8 A;  2BEX A;  5B0N A;  1DFJ I;  4Q62 A;  4UFR A;  4GT6 A;  3UN9 A;  4LXR A;  3RIZ A;  3E4G A;  3G06 A;  1A9N A;  1KOO A;  3W3J A;  2Z81 A;  4C2A B;  3SB4 A;  4LXS A;  1H6U A;  2P1M B;  2RR6 A;  3OGL B;  4M7E A;  3TSR E;  4BSS A;  3O53 A;  3WPD A;  4R5D A;  3G3A A;  4PER A;  4PSJ A;  4BV4 R;  4ARR A;  1Z7X W;  2UZX A;  3C6P B;  4B8C D;  1FO1 A;  1OTN A;  3CIG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...