4LI2A

Crystal structures of lgr4 and its complex with r-spondin1
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
422
structure length
422
Chain Sequence
PCPAPCACDLDGGADCSGKGLVTVPDGLSVFTHSLDLSMNNITKLPEGAFKGFPYLEELRLAGNDLSIIHPMALSGLKELKVLTLQNNQLKTVPSESLKGLVSLQSLRLDANHIVTVPEDSFEGLVQLRHLWLDDNSLTEVPIRPLSNLPSLQALTLALNKISHIPDYAFSNLSSLVVLHLHNNKIRTLGPHSFHGLDNLEALDLNYNNLIDFPDSIRSLPNLKELGFHSNSITIIPDGAFVKNPLLRTIHLYDNPLSFVGNSAFQNLSDLHFLIIRGASNVQWFPNLTGTNNLESLTLTGTKIRSIPIKFCQEQKMLRTLDLSYNEISALVGFEGCSSLEEVYLQNNQIQEVQNETFQGLAALRMLDLSRNRIHTIHKEAFVTLKALTNLDLSFNDLTAFPTAGLHGLNQLKLTGNPNFKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hormone receptor/signaling protein
molecule keywords Leucine-rich repeat-containing G-protein coupled receptor 4
publication title Crystal structures of lgr4 and its complex with R-spondin1.
pubmed doi rcsb
source organism Xenopus (silurana) tropicalis
total genus 102
structure length 422
sequence length 422
ec nomenclature
pdb deposition date 2013-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13855 LRR_8 Leucine rich repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 4li2A00
2ASTB 4PKIG 2Z62A 4K17A 3RFJA 2R9UA 2WQUA 1SQ0B 4PQ8A 5CMPA 4FDWA 2UZXA 2FT3A 1O6TA 1OGQA 4L3AA 4CP6A 4BSRA 3G04C 4U7LA 4BV4R 3O6NA 1FT8A 1D0BA 4KT1A 3RW6A 3RJ0A 4NKHA 3O53A 2Y5QA 4LSXC 4Y61B 1A4YA 1FO1A 3WPBA 1M0ZA 4I6JB 5HDHA 3WPDA 1H6UA 1XEUA 3REZA 1Z7XW 1FQVA 1K5DC 2V9SA 1O6VA 3RFSA 3E3ZA 2Z63A 4FS7A 4R6JA 3W3JA 3GOZA 4Q62A 2CA6A 3P72A 2P1MB 3DZEA 5A5CA 4Z61C 3C6OB 4CNMA 1XKUA 4R6FA 4BSSA 1QYYA 3UN9A 1W8AA 2RR6A 4CILA 3WPGA 5IJDA 3A79B 4C2AB 4MQWX 1DS9A 4U06A 5AWDA 4FMZA 3CIYA 1P9AG 3WPIA 3RGZA 2O6QA 2Z65A 1OOKG 3C6PB 3VQ1A 4QBZA 3OGMB 4B8CD 4Z79A 4XGOA 1PGVA 2ASSB 4H09A 2V9TB 3WPFA 1XCDA 5AWCA 5B0NA 4PERA 3WPEA 4R0AA 3PMHG 1KOHA 2WFHA 4R5DA 1OTMA 5IJBA 2OMXA 3G3AA 4UFRA 4J0MA 1P8VA 3W3LA 4LXSA 4FHOA 4AY9X 2A0ZA 4M7EC 3OGLB 3UL8A 2JQDA 4M7EA 1A9NA 4GT6A 4WP6A 2BNHA 4R6AA 2Z82A 4LSXA 3RIZA 3C6NB 3ZYOA 2JE1A 4P8SA 4R07A 1YRGA 2OMUA 2O6RA 3OGKB 4Z8GA 1XWDC 4FD0A 3CIGA 2Z64A 3WPHA 4PSJA 1OZNA 4EZGA 2IFGA 2ELLA 3UL7A 4ARRA 3FXIA 4KXFB 4IM6A 3OJAB 1WWLA 2OMZA 3BZ5A 4R5CA 5GMGA 3UL9A 1DFJI 4V2DA 4WYKA 3SB4A 4ARNA 5GQRK 4G8AA 4KNGA 1JL5A 2OMVA 4V2CA 2O6SA 5GMFA 3ULVA 2XWTC 1K5GC 1FS2A 2P1QB 4AW4A 2Z66A 4YEBB 5GS0A 1IO0A 2WQWA 4PEQB 4GLPA 3WN4A 2P1NB 2OMWA 4R09A 2Z7XB 5GMHA 3JB9j 4U09A 2BEXA 5IJCA 3E2JA 4RCWA 4Z64C 4LSCA 1U0ND 4C2BB 4R08A 3ZYIA 4QC0A 2RA8A 4Z94G 4TZHA 4XOSA 3ZYJA 4XSQA 3G06A 2Z81A 1XECA 4RWTC 1OTNA 4LSAA 5LFNA 4R58A 4ECOA 4Q3IA 1O6SA 4HQ1A 1ZIWA 3E6JA 5B4PA 5AWBA 4LI1A 4U08A 5AWAA 1KOOA 4V2EA 3W3KA 2OMTA 5D3IA 4MN8B 3WPCA 4J4LA 1LTXA 4FCGA 5B0TA 3KJ4A 4NKGA 2WQXA 2XOTA 2V70A 2P1OB 1M9LA 3OJAA 3M19A 3ULUA 3W3NA 3RGXA 5FTTB 5IYXC 1OTOA 3RW7A 3W3GA 4ECNA 2OMYA 1DCEA 2JE0A 1H6TA 4BSUA 4LI2A 2WQVA 4OQTA 3VQ2A 4P91A 4RCAB 1GWBA 1M10B 3E4GA 1P8TA 5CMNA 2ID5A 3G39A 3ULAA 4QXEA 3RFEA 5HZLB 3W3MA 3M18A 4L3FA 3CVRA 4LXRA 3G3BA 4CC4C 5GS2B 2P1PB 2Z7XA 2UZYA 4CC4A 4R6GA 2Q4GW 4CNCA 1G9UA 4Q3GA 3TSRE 3ZYNA 5AZ5A 1M9SA
chains in the Genus database with same CATH superfamily
2ASTB 4PKIG 2Z62A 4K17A 3RFJA 2R9UA 2WQUA 1SQ0B 4PQ8A 5CMPA 4FDWA 2UZXA 2FT3A 1O6TA 1OGQA 4L3AA 4CP6A 4BSRA 3G04C 4U7LA 4BV4R 3O6NA 1FT8A 1D0BA 4KT1A 3RW6A 3RJ0A 4NKHA 3O53A 2Y5QA 4LSXC 4Y61B 1A4YA 1FO1A 3WPBA 1M0ZA 4I6JB 5HDHA 3WPDA 1H6UA 1XEUA 3REZA 1Z7XW 1FQVA 1K5DC 2V9SA 1O6VA 3RFSA 3E3ZA 2Z63A 4FS7A 4R6JA 3W3JA 3GOZA 4Q62A 2CA6A 3P72A 2P1MB 3DZEA 5A5CA 4Z61C 3C6OB 4CNMA 1XKUA 4R6FA 4BSSA 1QYYA 3UN9A 1W8AA 2RR6A 4CILA 3WPGA 5IJDA 3A79B 4C2AB 4MQWX 1DS9A 4U06A 5AWDA 4FMZA 3CIYA 1P9AG 3WPIA 3RGZA 2O6QA 2Z65A 1OOKG 3C6PB 3VQ1A 4QBZA 3OGMB 4B8CD 4Z79A 4XGOA 1PGVA 2ASSB 4H09A 2V9TB 3WPFA 1XCDA 5AWCA 5B0NA 4PERA 3WPEA 4R0AA 3PMHG 1KOHA 2WFHA 4R5DA 1OTMA 5IJBA 2OMXA 3G3AA 4UFRA 4J0MA 1P8VA 3W3LA 4LXSA 4FHOA 4AY9X 2A0ZA 4M7EC 3OGLB 3UL8A 2JQDA 4M7EA 1A9NA 4GT6A 4WP6A 2BNHA 4R6AA 2Z82A 4LSXA 3RIZA 3C6NB 3ZYOA 2JE1A 4P8SA 4R07A 1YRGA 2OMUA 2O6RA 3OGKB 4Z8GA 1XWDC 4FD0A 3CIGA 2Z64A 3WPHA 4PSJA 1OZNA 4EZGA 2IFGA 2ELLA 3UL7A 4ARRA 3FXIA 4KXFB 4IM6A 3OJAB 1WWLA 2OMZA 3BZ5A 4R5CA 5GMGA 3UL9A 1DFJI 4V2DA 4WYKA 3SB4A 4ARNA 5GQRK 4G8AA 4KNGA 1JL5A 2OMVA 4V2CA 4NZTM 2O6SA 5GMFA 3ULVA 2XWTC 1K5GC 1FS2A 2P1QB 4AW4A 2Z66A 4YEBB 5GS0A 1IO0A 2WQWA 4PEQB 4GLPA 3WN4A 2P1NB 2OMWA 4NZRM 4R09A 2Z7XB 5GMHA 3JB9j 4U09A 2BEXA 5IJCA 3E2JA 4RCWA 4Z64C 4LSCA 1U0ND 4C2BB 4R08A 3ZYIA 4QC0A 2RA8A 4Z94G 4TZHA 4XOSA 3ZYJA 4XSQA 3G06A 2Z81A 1XECA 4RWTC 1OTNA 4LSAA 5LFNA 4R58A 4ECOA 4Q3IA 1O6SA 4HQ1A 1ZIWA 3E6JA 5B4PA 5AWBA 4LI1A 4U08A 5AWAA 1KOOA 4V2EA 3W3KA 2OMTA 5D3IA 4MN8B 3WPCA 4J4LA 1LTXA 4FCGA 5B0TA 3KJ4A 4NKGA 2WQXA 2XOTA 2V70A 2P1OB 1M9LA 3OJAA 3M19A 3ULUA 3W3NA 3RGXA 5FTTB 5IYXC 1OTOA 3RW7A 3W3GA 4ECNA 2OMYA 1DCEA 2JE0A 1H6TA 4BSUA 4LI2A 2WQVA 4OQTA 3VQ2A 4P91A 4RCAB 1GWBA 1M10B 3E4GA 1P8TA 5CMNA 2ID5A 3G39A 3ULAA 4QXEA 3RFEA 5HZLB 3W3MA 3M18A 4L3FA 3CVRA 4LXRA 3G3BA 4CC4C 5GS2B 2P1PB 2Z7XA 2UZYA 4CC4A 4R6GA 2Q4GW 4CNCA 1G9UA 4Q3GA 3TSRE 3ZYNA 5AZ5A 1M9SA
chains in the Genus database with same CATH topology
2ASTB 4PKIG 2Z62A 4K17A 3RFJA 2R9UA 2WQUA 1SQ0B 4PQ8A 5CMPA 4FDWA 2UZXA 2FT3A 1O6TA 1OGQA 4L3AA 4CP6A 4BSRA 3G04C 4U7LA 4BV4R 3O6NA 1FT8A 1D0BA 4KT1A 3RW6A 3RJ0A 4NKHA 3O53A 2Y5QA 4LSXC 4Y61B 1A4YA 1FO1A 3WPBA 1M0ZA 4I6JB 5HDHA 3WPDA 1H6UA 1XEUA 3REZA 1Z7XW 1FQVA 1K5DC 2V9SA 1O6VA 3RFSA 3E3ZA 2Z63A 4FS7A 4R6JA 3W3JA 3GOZA 4Q62A 2CA6A 3P72A 2P1MB 3DZEA 5A5CA 4Z61C 3C6OB 4CNMA 1XKUA 4R6FA 4BSSA 1QYYA 3UN9A 1W8AA 2RR6A 4CILA 3WPGA 5IJDA 3A79B 4C2AB 4MQWX 1DS9A 4U06A 5AWDA 4FMZA 3CIYA 1P9AG 3WPIA 3RGZA 2O6QA 2Z65A 1OOKG 3C6PB 3VQ1A 4QBZA 3OGMB 4B8CD 4Z79A 4XGOA 1PGVA 2ASSB 4H09A 2V9TB 3WPFA 1XCDA 5AWCA 5B0NA 4PERA 3WPEA 4R0AA 3PMHG 1KOHA 2WFHA 4R5DA 1OTMA 5IJBA 2OMXA 3G3AA 4UFRA 4J0MA 1P8VA 3W3LA 4LXSA 4FHOA 4AY9X 2A0ZA 4M7EC 3OGLB 3UL8A 2JQDA 4M7EA 1A9NA 4GT6A 4WP6A 2BNHA 4R6AA 2Z82A 4LSXA 3RIZA 3C6NB 3ZYOA 2JE1A 4P8SA 4R07A 1YRGA 2OMUA 2O6RA 3OGKB 4Z8GA 1XWDC 4FD0A 3CIGA 2Z64A 3WPHA 4PSJA 1OZNA 4EZGA 2IFGA 2ELLA 3UL7A 4ARRA 3FXIA 4KXFB 4IM6A 3OJAB 1WWLA 2OMZA 3BZ5A 4R5CA 5GMGA 3UL9A 1DFJI 4V2DA 4WYKA 3SB4A 4ARNA 5GQRK 4G8AA 4KNGA 1JL5A 2OMVA 4V2CA 2O6SA 5GMFA 3ULVA 2XWTC 1K5GC 1FS2A 2P1QB 4AW4A 2Z66A 4YEBB 5GS0A 1IO0A 2WQWA 4PEQB 4GLPA 3WN4A 2P1NB 2OMWA 4R09A 2Z7XB 5GMHA 3JB9j 4U09A 2BEXA 5IJCA 3E2JA 4RCWA 4Z64C 4LSCA 1U0ND 4C2BB 4R08A 3ZYIA 4QC0A 2RA8A 4Z94G 4TZHA 4XOSA 3ZYJA 4XSQA 3G06A 2Z81A 1XECA 4RWTC 1OTNA 4LSAA 5LFNA 4R58A 4ECOA 4Q3IA 1O6SA 4HQ1A 1ZIWA 3E6JA 5B4PA 5AWBA 4LI1A 4U08A 5AWAA 1KOOA 4V2EA 3W3KA 2OMTA 5D3IA 4MN8B 3WPCA 4J4LA 1LTXA 4FCGA 5B0TA 3KJ4A 4NKGA 2WQXA 2XOTA 2V70A 2P1OB 1M9LA 3OJAA 3M19A 3ULUA 3W3NA 3RGXA 5FTTB 5IYXC 1OTOA 3RW7A 3W3GA 4ECNA 2OMYA 1DCEA 2JE0A 1H6TA 4BSUA 4LI2A 2WQVA 4OQTA 3VQ2A 4P91A 4RCAB 1GWBA 1M10B 3E4GA 1P8TA 5CMNA 2ID5A 3G39A 3ULAA 4QXEA 3RFEA 5HZLB 3W3MA 3M18A 4L3FA 3CVRA 4LXRA 3G3BA 4CC4C 5GS2B 2P1PB 2Z7XA 2UZYA 4CC4A 4R6GA 2Q4GW 4CNCA 1G9UA 4Q3GA 3TSRE 3ZYNA 5AZ5A 1M9SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AST B;  4PKI G;  2Z62 A;  4K17 A;  3RFJ A;  2R9U A;  2WQU A;  1SQ0 B;  4PQ8 A;  5CMP A;  4FDW A;  2UZX A;  2FT3 A;  1O6T A;  1OGQ A;  4L3A A;  4CP6 A;  4BSR A;  3G04 C;  4U7L A;  4BV4 R;  3O6N A;  1FT8 A;  1D0B A;  4KT1 A;  3RW6 A;  3RJ0 A;  4NKH A;  3O53 A;  2Y5Q A;  4LSX C;  4Y61 B;  1A4Y A;  1FO1 A;  3WPB A;  1M0Z A;  4I6J B;  5HDH A;  3WPD A;  1H6U A;  1XEU A;  3REZ A;  1Z7X W;  1FQV A;  1K5D C;  2V9S A;  1O6V A;  3RFS A;  3E3Z A;  2Z63 A;  4FS7 A;  4R6J A;  3W3J A;  3GOZ A;  4Q62 A;  2CA6 A;  3P72 A;  2P1M B;  3DZE A;  5A5C A;  4Z61 C;  3C6O B;  4CNM A;  1XKU A;  4R6F A;  4BSS A;  1QYY A;  3UN9 A;  1W8A A;  2RR6 A;  4CIL A;  3WPG A;  5IJD A;  3A79 B;  4C2A B;  4MQW X;  1DS9 A;  4U06 A;  5AWD A;  4FMZ A;  3CIY A;  1P9A G;  3WPI A;  3RGZ A;  2O6Q A;  2Z65 A;  1OOK G;  3C6P B;  3VQ1 A;  4QBZ A;  3OGM B;  4B8C D;  4Z79 A;  4XGO A;  1PGV A;  2ASS B;  4H09 A;  2V9T B;  3WPF A;  1XCD A;  5AWC A;  5B0N A;  4PER A;  3WPE A;  4R0A A;  3PMH G;  1KOH A;  2WFH A;  4R5D A;  1OTM A;  5IJB A;  2OMX A;  3G3A A;  4UFR A;  4J0M A;  1P8V A;  3W3L A;  4LXS A;  4FHO A;  4AY9 X;  2A0Z A;  4M7E C;  3OGL B;  3UL8 A;  2JQD A;  4M7E A;  1A9N A;  4GT6 A;  4WP6 A;  2BNH A;  4R6A A;  2Z82 A;  4LSX A;  3RIZ A;  3C6N B;  3ZYO A;  2JE1 A;  4P8S A;  4R07 A;  1YRG A;  2OMU A;  2O6R A;  3OGK B;  4Z8G A;  1XWD C;  4FD0 A;  3CIG A;  2Z64 A;  3WPH A;  4PSJ A;  1OZN A;  4EZG A;  2IFG A;  2ELL A;  3UL7 A;  4ARR A;  3FXI A;  4KXF B;  4IM6 A;  3OJA B;  1WWL A;  2OMZ A;  3BZ5 A;  4R5C A;  5GMG A;  3UL9 A;  1DFJ I;  4V2D A;  4WYK A;  3SB4 A;  4ARN A;  5GQR K;  4G8A A;  4KNG A;  1JL5 A;  2OMV A;  4V2C A;  2O6S A;  5GMF A;  3ULV A;  2XWT C;  1K5G C;  1FS2 A;  2P1Q B;  4AW4 A;  2Z66 A;  4YEB B;  5GS0 A;  1IO0 A;  2WQW A;  4PEQ B;  4GLP A;  3WN4 A;  2P1N B;  2OMW A;  4R09 A;  2Z7X B;  5GMH A;  3JB9 j;  4U09 A;  2BEX A;  5IJC A;  3E2J A;  4RCW A;  4Z64 C;  4LSC A;  1U0N D;  4C2B B;  4R08 A;  3ZYI A;  4QC0 A;  2RA8 A;  4Z94 G;  4TZH A;  4XOS A;  3ZYJ A;  4XSQ A;  3G06 A;  2Z81 A;  1XEC A;  4RWT C;  1OTN A;  4LSA A;  5LFN A;  4R58 A;  4ECO A;  4Q3I A;  1O6S A;  4HQ1 A;  1ZIW A;  3E6J A;  5B4P A;  5AWB A;  4LI1 A;  4U08 A;  5AWA A;  1KOO A;  4V2E A;  3W3K A;  2OMT A;  5D3I A;  4MN8 B;  3WPC A;  4J4L A;  1LTX A;  4FCG A;  5B0T A;  3KJ4 A;  4NKG A;  2WQX A;  2XOT A;  2V70 A;  2P1O B;  1M9L A;  3OJA A;  3M19 A;  3ULU A;  3W3N A;  3RGX A;  5FTT B;  5IYX C;  1OTO A;  3RW7 A;  3W3G A;  4ECN A;  2OMY A;  1DCE A;  2JE0 A;  1H6T A;  4BSU A;  4LI2 A;  2WQV A;  4OQT A;  3VQ2 A;  4P91 A;  4RCA B;  1GWB A;  1M10 B;  3E4G A;  1P8T A;  5CMN A;  2ID5 A;  3G39 A;  3ULA A;  4QXE A;  3RFE A;  5HZL B;  3W3M A;  3M18 A;  4L3F A;  3CVR A;  4LXR A;  3G3B A;  4CC4 C;  5GS2 B;  2P1P B;  2Z7X A;  2UZY A;  4CC4 A;  4R6G A;  2Q4G W;  4CNC A;  1G9U A;  4Q3G A;  3TSR E;  3ZYN A;  5AZ5 A;  1M9S A; 
#chains in the Genus database with same CATH topology
 2AST B;  4PKI G;  2Z62 A;  4K17 A;  3RFJ A;  2R9U A;  2WQU A;  1SQ0 B;  4PQ8 A;  5CMP A;  4FDW A;  2UZX A;  2FT3 A;  1O6T A;  1OGQ A;  4L3A A;  4CP6 A;  4BSR A;  3G04 C;  4U7L A;  4BV4 R;  3O6N A;  1FT8 A;  1D0B A;  4KT1 A;  3RW6 A;  3RJ0 A;  4NKH A;  3O53 A;  2Y5Q A;  4LSX C;  4Y61 B;  1A4Y A;  1FO1 A;  3WPB A;  1M0Z A;  4I6J B;  5HDH A;  3WPD A;  1H6U A;  1XEU A;  3REZ A;  1Z7X W;  1FQV A;  1K5D C;  2V9S A;  1O6V A;  3RFS A;  3E3Z A;  2Z63 A;  4FS7 A;  4R6J A;  3W3J A;  3GOZ A;  4Q62 A;  2CA6 A;  3P72 A;  2P1M B;  3DZE A;  5A5C A;  4Z61 C;  3C6O B;  4CNM A;  1XKU A;  4R6F A;  4BSS A;  1QYY A;  3UN9 A;  1W8A A;  2RR6 A;  4CIL A;  3WPG A;  5IJD A;  3A79 B;  4C2A B;  4MQW X;  1DS9 A;  4U06 A;  5AWD A;  4FMZ A;  3CIY A;  1P9A G;  3WPI A;  3RGZ A;  2O6Q A;  2Z65 A;  1OOK G;  3C6P B;  3VQ1 A;  4QBZ A;  3OGM B;  4B8C D;  4Z79 A;  4XGO A;  1PGV A;  2ASS B;  4H09 A;  2V9T B;  3WPF A;  1XCD A;  5AWC A;  5B0N A;  4PER A;  3WPE A;  4R0A A;  3PMH G;  1KOH A;  2WFH A;  4R5D A;  1OTM A;  5IJB A;  2OMX A;  3G3A A;  4UFR A;  4J0M A;  1P8V A;  3W3L A;  4LXS A;  4FHO A;  4AY9 X;  2A0Z A;  4M7E C;  3OGL B;  3UL8 A;  2JQD A;  4M7E A;  1A9N A;  4GT6 A;  4WP6 A;  2BNH A;  4R6A A;  2Z82 A;  4LSX A;  3RIZ A;  3C6N B;  3ZYO A;  2JE1 A;  4P8S A;  4R07 A;  1YRG A;  2OMU A;  2O6R A;  3OGK B;  4Z8G A;  1XWD C;  4FD0 A;  3CIG A;  2Z64 A;  3WPH A;  4PSJ A;  1OZN A;  4EZG A;  2IFG A;  2ELL A;  3UL7 A;  4ARR A;  3FXI A;  4KXF B;  4IM6 A;  3OJA B;  1WWL A;  2OMZ A;  3BZ5 A;  4R5C A;  5GMG A;  3UL9 A;  1DFJ I;  4V2D A;  4WYK A;  3SB4 A;  4ARN A;  5GQR K;  4G8A A;  4KNG A;  1JL5 A;  2OMV A;  4V2C A;  4NZT M;  2O6S A;  5GMF A;  3ULV A;  2XWT C;  1K5G C;  1FS2 A;  2P1Q B;  4AW4 A;  2Z66 A;  4YEB B;  5GS0 A;  1IO0 A;  2WQW A;  4PEQ B;  4GLP A;  3WN4 A;  2P1N B;  2OMW A;  4NZR M;  4R09 A;  2Z7X B;  5GMH A;  3JB9 j;  4U09 A;  2BEX A;  5IJC A;  3E2J A;  4RCW A;  4Z64 C;  4LSC A;  1U0N D;  4C2B B;  4R08 A;  3ZYI A;  4QC0 A;  2RA8 A;  4Z94 G;  4TZH A;  4XOS A;  3ZYJ A;  4XSQ A;  3G06 A;  2Z81 A;  1XEC A;  4RWT C;  1OTN A;  4LSA A;  5LFN A;  4R58 A;  4ECO A;  4Q3I A;  1O6S A;  4HQ1 A;  1ZIW A;  3E6J A;  5B4P A;  5AWB A;  4LI1 A;  4U08 A;  5AWA A;  1KOO A;  4V2E A;  3W3K A;  2OMT A;  5D3I A;  4MN8 B;  3WPC A;  4J4L A;  1LTX A;  4FCG A;  5B0T A;  3KJ4 A;  4NKG A;  2WQX A;  2XOT A;  2V70 A;  2P1O B;  1M9L A;  3OJA A;  3M19 A;  3ULU A;  3W3N A;  3RGX A;  5FTT B;  5IYX C;  1OTO A;  3RW7 A;  3W3G A;  4ECN A;  2OMY A;  1DCE A;  2JE0 A;  1H6T A;  4BSU A;  4LI2 A;  2WQV A;  4OQT A;  3VQ2 A;  4P91 A;  4RCA B;  1GWB A;  1M10 B;  3E4G A;  1P8T A;  5CMN A;  2ID5 A;  3G39 A;  3ULA A;  4QXE A;  3RFE A;  5HZL B;  3W3M A;  3M18 A;  4L3F A;  3CVR A;  4LXR A;  3G3B A;  4CC4 C;  5GS2 B;  2P1P B;  2Z7X A;  2UZY A;  4CC4 A;  4R6G A;  2Q4G W;  4CNC A;  1G9U A;  4Q3G A;  3TSR E;  3ZYN A;  5AZ5 A;  1M9S A; 
#chains in the Genus database with same CATH homology
 2AST B;  4PKI G;  2Z62 A;  4K17 A;  3RFJ A;  2R9U A;  2WQU A;  1SQ0 B;  4PQ8 A;  5CMP A;  4FDW A;  2UZX A;  2FT3 A;  1O6T A;  1OGQ A;  4L3A A;  4CP6 A;  4BSR A;  3G04 C;  4U7L A;  4BV4 R;  3O6N A;  1FT8 A;  1D0B A;  4KT1 A;  3RW6 A;  3RJ0 A;  4NKH A;  3O53 A;  2Y5Q A;  4LSX C;  4Y61 B;  1A4Y A;  1FO1 A;  3WPB A;  1M0Z A;  4I6J B;  5HDH A;  3WPD A;  1H6U A;  1XEU A;  3REZ A;  1Z7X W;  1FQV A;  1K5D C;  2V9S A;  1O6V A;  3RFS A;  3E3Z A;  2Z63 A;  4FS7 A;  4R6J A;  3W3J A;  3GOZ A;  4Q62 A;  2CA6 A;  3P72 A;  2P1M B;  3DZE A;  5A5C A;  4Z61 C;  3C6O B;  4CNM A;  1XKU A;  4R6F A;  4BSS A;  1QYY A;  3UN9 A;  1W8A A;  2RR6 A;  4CIL A;  3WPG A;  5IJD A;  3A79 B;  4C2A B;  4MQW X;  1DS9 A;  4U06 A;  5AWD A;  4FMZ A;  3CIY A;  1P9A G;  3WPI A;  3RGZ A;  2O6Q A;  2Z65 A;  1OOK G;  3C6P B;  3VQ1 A;  4QBZ A;  3OGM B;  4B8C D;  4Z79 A;  4XGO A;  1PGV A;  2ASS B;  4H09 A;  2V9T B;  3WPF A;  1XCD A;  5AWC A;  5B0N A;  4PER A;  3WPE A;  4R0A A;  3PMH G;  1KOH A;  2WFH A;  4R5D A;  1OTM A;  5IJB A;  2OMX A;  3G3A A;  4UFR A;  4J0M A;  1P8V A;  3W3L A;  4LXS A;  4FHO A;  4AY9 X;  2A0Z A;  4M7E C;  3OGL B;  3UL8 A;  2JQD A;  4M7E A;  1A9N A;  4GT6 A;  4WP6 A;  2BNH A;  4R6A A;  2Z82 A;  4LSX A;  3RIZ A;  3C6N B;  3ZYO A;  2JE1 A;  4P8S A;  4R07 A;  1YRG A;  2OMU A;  2O6R A;  3OGK B;  4Z8G A;  1XWD C;  4FD0 A;  3CIG A;  2Z64 A;  3WPH A;  4PSJ A;  1OZN A;  4EZG A;  2IFG A;  2ELL A;  3UL7 A;  4ARR A;  3FXI A;  4KXF B;  4IM6 A;  3OJA B;  1WWL A;  2OMZ A;  3BZ5 A;  4R5C A;  5GMG A;  3UL9 A;  1DFJ I;  4V2D A;  4WYK A;  3SB4 A;  4ARN A;  5GQR K;  4G8A A;  4KNG A;  1JL5 A;  2OMV A;  4V2C A;  2O6S A;  5GMF A;  3ULV A;  2XWT C;  1K5G C;  1FS2 A;  2P1Q B;  4AW4 A;  2Z66 A;  4YEB B;  5GS0 A;  1IO0 A;  2WQW A;  4PEQ B;  4GLP A;  3WN4 A;  2P1N B;  2OMW A;  4R09 A;  2Z7X B;  5GMH A;  3JB9 j;  4U09 A;  2BEX A;  5IJC A;  3E2J A;  4RCW A;  4Z64 C;  4LSC A;  1U0N D;  4C2B B;  4R08 A;  3ZYI A;  4QC0 A;  2RA8 A;  4Z94 G;  4TZH A;  4XOS A;  3ZYJ A;  4XSQ A;  3G06 A;  2Z81 A;  1XEC A;  4RWT C;  1OTN A;  4LSA A;  5LFN A;  4R58 A;  4ECO A;  4Q3I A;  1O6S A;  4HQ1 A;  1ZIW A;  3E6J A;  5B4P A;  5AWB A;  4LI1 A;  4U08 A;  5AWA A;  1KOO A;  4V2E A;  3W3K A;  2OMT A;  5D3I A;  4MN8 B;  3WPC A;  4J4L A;  1LTX A;  4FCG A;  5B0T A;  3KJ4 A;  4NKG A;  2WQX A;  2XOT A;  2V70 A;  2P1O B;  1M9L A;  3OJA A;  3M19 A;  3ULU A;  3W3N A;  3RGX A;  5FTT B;  5IYX C;  1OTO A;  3RW7 A;  3W3G A;  4ECN A;  2OMY A;  1DCE A;  2JE0 A;  1H6T A;  4BSU A;  4LI2 A;  2WQV A;  4OQT A;  3VQ2 A;  4P91 A;  4RCA B;  1GWB A;  1M10 B;  3E4G A;  1P8T A;  5CMN A;  2ID5 A;  3G39 A;  3ULA A;  4QXE A;  3RFE A;  5HZL B;  3W3M A;  3M18 A;  4L3F A;  3CVR A;  4LXR A;  3G3B A;  4CC4 C;  5GS2 B;  2P1P B;  2Z7X A;  2UZY A;  4CC4 A;  4R6G A;  2Q4G W;  4CNC A;  1G9U A;  4Q3G A;  3TSR E;  3ZYN A;  5AZ5 A;  1M9S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...