4LI2A

Crystal structures of lgr4 and its complex with r-spondin1
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
422
structure length
422
Chain Sequence
PCPAPCACDLDGGADCSGKGLVTVPDGLSVFTHSLDLSMNNITKLPEGAFKGFPYLEELRLAGNDLSIIHPMALSGLKELKVLTLQNNQLKTVPSESLKGLVSLQSLRLDANHIVTVPEDSFEGLVQLRHLWLDDNSLTEVPIRPLSNLPSLQALTLALNKISHIPDYAFSNLSSLVVLHLHNNKIRTLGPHSFHGLDNLEALDLNYNNLIDFPDSIRSLPNLKELGFHSNSITIIPDGAFVKNPLLRTIHLYDNPLSFVGNSAFQNLSDLHFLIIRGASNVQWFPNLTGTNNLESLTLTGTKIRSIPIKFCQEQKMLRTLDLSYNEISALVGFEGCSSLEEVYLQNNQIQEVQNETFQGLAALRMLDLSRNRIHTIHKEAFVTLKALTNLDLSFNDLTAFPTAGLHGLNQLKLTGNPNFKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Leucine-rich repeat-containing G-protein coupled receptor 4
publication title Crystal structures of lgr4 and its complex with R-spondin1.
pubmed doi rcsb
source organism Xenopus (silurana) tropicalis
molecule tags Hormone receptor/signaling protein
total genus 102
structure length 422
sequence length 422
ec nomenclature
pdb deposition date 2013-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13855 LRR_8 Leucine rich repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 4li2A00
3ZYIA 4R07A 3UN9A 1G9UA 3CVRA 4Q3GA 2Z62A 2RR6A 2UZYA 3VQ1A 4Q3IA 1OTMA 4HQ1A 4R6GA 1OTOA 3RIZA 3RGZA 4AW4A 4GLPA 4V2CA 4Z79A 3G39A 2BNHA 5HDHA 3KJ4A 1K5DC 1P9AG 2Q4GW 1FO1A 5B0TA 4PEQB 2JE0A 2Z82A 3RW7A 1O6TA 2XWTC 2OMWA 2V9TB 5CMNA 3A79B 3WN4A 2JE1A 1GWBA 4R5DA 4XSQA 4LSXC 3GOZA 4U7LA 4P8SA 1M0ZA 4R6AA 1FS2A 5GS0A 4BSRA 4KT1A 1PGVA 3W3NA 2V9SA 1A9NA 4LI1A 4V2DA 2O6SA 3RFEA 1JL5A 3M18A 4Z94G 2JQDA 2OMTA 1KOOA 1Z7XW 4LSXA 1O6SA 3TSRE 3WPGA 1SQ0B 3W3JA 2FT3A 4U08A 3C6NB 4I6JB 2UZXA 4R08A 4BSSA 1M10B 3BZ5A 3PMHG 1FT8A 4QC0A 3RFJA 4ARRA 1OGQA 3G3AA 1XWDC 5CMPA 3P72A 4H09A 1WWLA 1W8AA 1P8TA 5GMHA 4R6FA 4XOSA 3O6NA 4NKHA 4Z8GA 4RCWA 5GMFA 2Z81A 3UL8A 1O6VA 3ULAA 5GS2B 4U06A 2OMYA 4PKIG 4BV4R 4FCGA 3DZEA 3G06A 5IYXC 2Y5QA 2Z7XB 3G04C 4Z61C 3RGXA 4Y61B 3RFSA 4ECNA 1YRGA 2WQWA 4M7EC 5IJCA 3SB4A 3UL7A 1QYYA 4WP6A 4AY9X 4R5CA 4WYKA 4OQTA 2O6QA 4QXEA 2P1NB 4FMZA 3WPEA 4R6JA 4LXSA 2ID5A 2P1MB 5AZ5A 4UFRA 2OMVA 1FQVA 3W3MA 2WQVA 4P91A 1M9LA 2V70A 2A0ZA 1LTXA 2WQUA 4J0MA 3E2JA 2ASSB 1ZIWA 5AWBA 3RW6A 3E3ZA 1KOHA 4LSAA 4GT6A 3OGMB 1H6UA 3ZYNA 4ECOA 3FXIA 3WPBA 1H6TA 2P1PB 4R0AA 1XCDA 1DFJI 3ULVA 4V2EA 5AWAA 4U09A 4YEBB 3OGKB 2O6RA 3OJAA 5HZLB 2OMXA 4R58A 4RCAB 5AWDA 2IFGA 2OMUA 1IO0A 2CA6A 1XECA 3M19A 5IJBA 4ARNA 3W3GA 3G3BA 2OMZA 5B0NA 2Z64A 4R09A 3JB9j 4PQ8A 3C6PB 1A4YA 3ZYJA 2XOTA 4XGOA 4MQWX 5D3IA 2P1QB 5FTTB 2R9UA 4CNCA 3WPHA 4IM6A 3ZYOA 3OGLB 3E6JA 3ULUA 3WPFA 4FHOA 3C6OB 1U0ND 4PERA 2RA8A 4LI2A 3E4GA 4QBZA 5B4PA 3UL9A 1P8VA 2Z65A 3VQ2A 4CILA 3OJAB 1OTNA 5LFNA 4NKGA 3RJ0A 1M9SA 4PSJA 2WQXA 3WPCA 4B8CD 4L3FA 4BSUA 4M7EA 1XEUA 4L3AA 4Q62A 2WFHA 5AWCA 5A5CA 1OOKG 2Z63A 3WPDA 4FD0A 3O53A 4G8AA 4C2AB 3WPIA 4LXRA 4J4LA 1OZNA 2Z66A 1D0BA 5IJDA 1DS9A 4LSCA 4C2BB 4RWTC 5GQRK 4EZGA 4CC4C 1XKUA 2ASTB 4FDWA 2ELLA 3REZA 4CP6A 2Z7XA 2P1OB 4Z64C 2BEXA 3CIGA 4FS7A 4KXFB 3W3KA 4KNGA 5GMGA 4CC4A 1K5GC 4CNMA 4K17A 3CIYA 4TZHA 4MN8B 3W3LA 1DCEA
chains in the Genus database with same CATH superfamily
3ZYIA 4R07A 3UN9A 1G9UA 3CVRA 4Q3GA 2Z62A 2RR6A 2UZYA 3VQ1A 4Q3IA 1OTMA 4HQ1A 4R6GA 1OTOA 3RIZA 3RGZA 4AW4A 4GLPA 4V2CA 4Z79A 3G39A 2BNHA 5HDHA 3KJ4A 1K5DC 1P9AG 2Q4GW 1FO1A 5B0TA 4PEQB 2JE0A 2Z82A 3RW7A 1O6TA 2XWTC 2OMWA 2V9TB 4NZTM 5CMNA 3A79B 3WN4A 2JE1A 1GWBA 4R5DA 4XSQA 4LSXC 3GOZA 4U7LA 4P8SA 1M0ZA 4R6AA 1FS2A 5GS0A 4BSRA 4KT1A 1PGVA 3W3NA 2V9SA 4LI1A 1A9NA 4V2DA 2O6SA 3RFEA 1JL5A 3M18A 4Z94G 2JQDA 2OMTA 1KOOA 1Z7XW 4LSXA 1O6SA 3TSRE 3WPGA 1SQ0B 3W3JA 2FT3A 4U08A 3C6NB 4I6JB 2UZXA 4R08A 4BSSA 1M10B 3BZ5A 3PMHG 1FT8A 4QC0A 3RFJA 4ARRA 1OGQA 3G3AA 1XWDC 5CMPA 3P72A 4H09A 1WWLA 1W8AA 1P8TA 5GMHA 4R6FA 4XOSA 3O6NA 4NKHA 4Z8GA 4RCWA 5GMFA 2Z81A 3UL8A 1O6VA 3ULAA 5GS2B 4U06A 2OMYA 4PKIG 4BV4R 4FCGA 3DZEA 3G06A 5IYXC 2Y5QA 2Z7XB 4Z61C 3G04C 3RGXA 4Y61B 3RFSA 4ECNA 1YRGA 2WQWA 4M7EC 5IJCA 3SB4A 3UL7A 1QYYA 4WP6A 4AY9X 4R5CA 4WYKA 4OQTA 2O6QA 4QXEA 2P1NB 4FMZA 3WPEA 4R6JA 4LXSA 2ID5A 2P1MB 5AZ5A 4UFRA 2OMVA 1FQVA 3W3MA 2WQVA 4P91A 1M9LA 2V70A 2A0ZA 1LTXA 2WQUA 4J0MA 3E2JA 2ASSB 1ZIWA 5AWBA 3RW6A 3E3ZA 1KOHA 4LSAA 4GT6A 3OGMB 1H6UA 3ZYNA 4ECOA 3FXIA 3WPBA 1H6TA 4NZRM 2P1PB 4R0AA 1XCDA 1DFJI 3ULVA 4V2EA 5AWAA 4U09A 4YEBB 3OGKB 2O6RA 3OJAA 5HZLB 2OMXA 4R58A 4RCAB 5AWDA 2IFGA 2OMUA 1IO0A 2CA6A 1XECA 3M19A 5IJBA 4ARNA 3W3GA 3G3BA 2OMZA 5B0NA 2Z64A 4R09A 3JB9j 4PQ8A 3C6PB 1A4YA 3ZYJA 2XOTA 4XGOA 4MQWX 5D3IA 2P1QB 5FTTB 2R9UA 4CNCA 3WPHA 4IM6A 3ZYOA 3OGLB 3E6JA 3ULUA 3WPFA 4FHOA 3C6OB 1U0ND 4PERA 2RA8A 4LI2A 3E4GA 4QBZA 5B4PA 3UL9A 1P8VA 2Z65A 3VQ2A 4CILA 3OJAB 1OTNA 5LFNA 4NKGA 3RJ0A 1M9SA 4PSJA 2WQXA 3WPCA 4B8CD 4L3FA 4BSUA 4M7EA 1XEUA 4L3AA 4Q62A 2WFHA 5AWCA 5A5CA 1OOKG 2Z63A 3WPDA 4FD0A 3O53A 4G8AA 4C2AB 3WPIA 4LXRA 4J4LA 1OZNA 2Z66A 1D0BA 5IJDA 1DS9A 4LSCA 4C2BB 4RWTC 5GQRK 4EZGA 4CC4C 1XKUA 2ASTB 4FDWA 2ELLA 3REZA 4CP6A 2Z7XA 2P1OB 4Z64C 2BEXA 3CIGA 4FS7A 4KXFB 3W3KA 4KNGA 5GMGA 4CC4A 1K5GC 4CNMA 4K17A 3CIYA 4TZHA 4MN8B 3W3LA 1DCEA
chains in the Genus database with same CATH topology
3ZYIA 4R07A 3UN9A 1G9UA 3CVRA 4Q3GA 2Z62A 2RR6A 2UZYA 3VQ1A 4Q3IA 1OTMA 4HQ1A 4R6GA 1OTOA 3RIZA 3RGZA 4AW4A 4GLPA 4V2CA 4Z79A 3G39A 2BNHA 5HDHA 3KJ4A 1K5DC 1P9AG 2Q4GW 1FO1A 5B0TA 4PEQB 2JE0A 2Z82A 3RW7A 1O6TA 2XWTC 2OMWA 2V9TB 5CMNA 3A79B 3WN4A 2JE1A 1GWBA 4R5DA 4XSQA 4LSXC 3GOZA 4U7LA 4P8SA 1M0ZA 4R6AA 1FS2A 5GS0A 4BSRA 4KT1A 1PGVA 3W3NA 2V9SA 1A9NA 4LI1A 4V2DA 2O6SA 3RFEA 1JL5A 3M18A 4Z94G 2JQDA 2OMTA 1KOOA 1Z7XW 4LSXA 1O6SA 3TSRE 3WPGA 1SQ0B 3W3JA 2FT3A 4U08A 3C6NB 4I6JB 2UZXA 4R08A 4BSSA 1M10B 3BZ5A 3PMHG 1FT8A 4QC0A 3RFJA 4ARRA 1OGQA 3G3AA 1XWDC 5CMPA 3P72A 4H09A 1WWLA 1W8AA 1P8TA 5GMHA 4R6FA 4XOSA 3O6NA 4NKHA 4Z8GA 4RCWA 5GMFA 2Z81A 3UL8A 1O6VA 3ULAA 5GS2B 4U06A 2OMYA 4PKIG 4BV4R 4FCGA 3DZEA 3G06A 5IYXC 2Y5QA 2Z7XB 3G04C 4Z61C 3RGXA 4Y61B 3RFSA 4ECNA 1YRGA 2WQWA 4M7EC 5IJCA 3SB4A 3UL7A 1QYYA 4WP6A 4AY9X 4R5CA 4WYKA 4OQTA 2O6QA 4QXEA 2P1NB 4FMZA 3WPEA 4R6JA 4LXSA 2ID5A 2P1MB 5AZ5A 4UFRA 2OMVA 1FQVA 3W3MA 2WQVA 4P91A 1M9LA 2V70A 2A0ZA 1LTXA 2WQUA 4J0MA 3E2JA 2ASSB 1ZIWA 5AWBA 3RW6A 3E3ZA 1KOHA 4LSAA 4GT6A 3OGMB 1H6UA 3ZYNA 4ECOA 3FXIA 3WPBA 1H6TA 2P1PB 4R0AA 1XCDA 1DFJI 3ULVA 4V2EA 5AWAA 4U09A 4YEBB 3OGKB 2O6RA 3OJAA 5HZLB 2OMXA 4R58A 4RCAB 5AWDA 2IFGA 2OMUA 1IO0A 2CA6A 1XECA 3M19A 5IJBA 4ARNA 3W3GA 3G3BA 2OMZA 5B0NA 2Z64A 4R09A 3JB9j 4PQ8A 3C6PB 1A4YA 3ZYJA 2XOTA 4XGOA 4MQWX 5D3IA 2P1QB 5FTTB 2R9UA 4CNCA 3WPHA 4IM6A 3ZYOA 3OGLB 3E6JA 3ULUA 3WPFA 4FHOA 3C6OB 1U0ND 4PERA 2RA8A 4LI2A 3E4GA 4QBZA 5B4PA 3UL9A 1P8VA 2Z65A 3VQ2A 4CILA 3OJAB 1OTNA 5LFNA 4NKGA 3RJ0A 1M9SA 4PSJA 2WQXA 3WPCA 4B8CD 4L3FA 4BSUA 4M7EA 1XEUA 4L3AA 4Q62A 2WFHA 5AWCA 5A5CA 1OOKG 2Z63A 3WPDA 4FD0A 3O53A 4G8AA 4C2AB 3WPIA 4LXRA 4J4LA 1OZNA 2Z66A 1D0BA 5IJDA 1DS9A 4LSCA 4C2BB 4RWTC 5GQRK 4EZGA 4CC4C 1XKUA 2ASTB 4FDWA 2ELLA 3REZA 4CP6A 2Z7XA 2P1OB 4Z64C 2BEXA 3CIGA 4FS7A 4KXFB 3W3KA 4KNGA 5GMGA 4CC4A 1K5GC 4CNMA 4K17A 3CIYA 4TZHA 4MN8B 3W3LA 1DCEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZYI A;  4R07 A;  3UN9 A;  1G9U A;  3CVR A;  4Q3G A;  2Z62 A;  2RR6 A;  2UZY A;  3VQ1 A;  4Q3I A;  1OTM A;  4HQ1 A;  4R6G A;  1OTO A;  3RIZ A;  3RGZ A;  4AW4 A;  4GLP A;  4V2C A;  4Z79 A;  3G39 A;  2BNH A;  5HDH A;  3KJ4 A;  1K5D C;  1P9A G;  2Q4G W;  1FO1 A;  5B0T A;  4PEQ B;  2JE0 A;  2Z82 A;  3RW7 A;  1O6T A;  2XWT C;  2OMW A;  2V9T B;  5CMN A;  3A79 B;  3WN4 A;  2JE1 A;  1GWB A;  4R5D A;  4XSQ A;  4LSX C;  3GOZ A;  4U7L A;  4P8S A;  1M0Z A;  4R6A A;  1FS2 A;  5GS0 A;  4BSR A;  4KT1 A;  1PGV A;  3W3N A;  2V9S A;  1A9N A;  4LI1 A;  4V2D A;  2O6S A;  3RFE A;  1JL5 A;  3M18 A;  4Z94 G;  2JQD A;  2OMT A;  1KOO A;  1Z7X W;  4LSX A;  1O6S A;  3TSR E;  3WPG A;  1SQ0 B;  3W3J A;  2FT3 A;  4U08 A;  3C6N B;  4I6J B;  2UZX A;  4R08 A;  4BSS A;  1M10 B;  3BZ5 A;  3PMH G;  1FT8 A;  4QC0 A;  3RFJ A;  4ARR A;  1OGQ A;  3G3A A;  1XWD C;  5CMP A;  3P72 A;  4H09 A;  1WWL A;  1W8A A;  1P8T A;  5GMH A;  4R6F A;  4XOS A;  3O6N A;  4NKH A;  4Z8G A;  4RCW A;  5GMF A;  2Z81 A;  3UL8 A;  1O6V A;  3ULA A;  5GS2 B;  4U06 A;  2OMY A;  4PKI G;  4BV4 R;  4FCG A;  3DZE A;  3G06 A;  5IYX C;  2Y5Q A;  2Z7X B;  3G04 C;  4Z61 C;  3RGX A;  4Y61 B;  3RFS A;  4ECN A;  1YRG A;  2WQW A;  4M7E C;  5IJC A;  3SB4 A;  3UL7 A;  1QYY A;  4WP6 A;  4AY9 X;  4R5C A;  4WYK A;  4OQT A;  2O6Q A;  4QXE A;  2P1N B;  4FMZ A;  3WPE A;  4R6J A;  4LXS A;  2ID5 A;  2P1M B;  5AZ5 A;  4UFR A;  2OMV A;  1FQV A;  3W3M A;  2WQV A;  4P91 A;  1M9L A;  2V70 A;  2A0Z A;  1LTX A;  2WQU A;  4J0M A;  3E2J A;  2ASS B;  1ZIW A;  5AWB A;  3RW6 A;  3E3Z A;  1KOH A;  4LSA A;  4GT6 A;  3OGM B;  1H6U A;  3ZYN A;  4ECO A;  3FXI A;  3WPB A;  1H6T A;  2P1P B;  4R0A A;  1XCD A;  1DFJ I;  3ULV A;  4V2E A;  5AWA A;  4U09 A;  4YEB B;  3OGK B;  2O6R A;  3OJA A;  5HZL B;  2OMX A;  4R58 A;  4RCA B;  5AWD A;  2IFG A;  2OMU A;  1IO0 A;  2CA6 A;  1XEC A;  3M19 A;  5IJB A;  4ARN A;  3W3G A;  3G3B A;  2OMZ A;  5B0N A;  2Z64 A;  4R09 A;  3JB9 j;  4PQ8 A;  3C6P B;  1A4Y A;  3ZYJ A;  2XOT A;  4XGO A;  4MQW X;  5D3I A;  2P1Q B;  5FTT B;  2R9U A;  4CNC A;  3WPH A;  4IM6 A;  3ZYO A;  3OGL B;  3E6J A;  3ULU A;  3WPF A;  4FHO A;  3C6O B;  1U0N D;  4PER A;  2RA8 A;  4LI2 A;  3E4G A;  4QBZ A;  5B4P A;  3UL9 A;  1P8V A;  2Z65 A;  3VQ2 A;  4CIL A;  3OJA B;  1OTN A;  5LFN A;  4NKG A;  3RJ0 A;  1M9S A;  4PSJ A;  2WQX A;  3WPC A;  4B8C D;  4L3F A;  4BSU A;  4M7E A;  1XEU A;  4L3A A;  4Q62 A;  2WFH A;  5AWC A;  5A5C A;  1OOK G;  2Z63 A;  3WPD A;  4FD0 A;  3O53 A;  4G8A A;  4C2A B;  3WPI A;  4LXR A;  4J4L A;  1OZN A;  2Z66 A;  1D0B A;  5IJD A;  1DS9 A;  4LSC A;  4C2B B;  4RWT C;  5GQR K;  4EZG A;  4CC4 C;  1XKU A;  2AST B;  4FDW A;  2ELL A;  3REZ A;  4CP6 A;  2Z7X A;  2P1O B;  4Z64 C;  2BEX A;  3CIG A;  4FS7 A;  4KXF B;  3W3K A;  4KNG A;  5GMG A;  4CC4 A;  1K5G C;  4CNM A;  4K17 A;  3CIY A;  4TZH A;  4MN8 B;  3W3L A;  1DCE A; 
#chains in the Genus database with same CATH topology
 3ZYI A;  4R07 A;  3UN9 A;  1G9U A;  3CVR A;  4Q3G A;  2Z62 A;  2RR6 A;  2UZY A;  3VQ1 A;  4Q3I A;  1OTM A;  4HQ1 A;  4R6G A;  1OTO A;  3RIZ A;  3RGZ A;  4AW4 A;  4GLP A;  4V2C A;  4Z79 A;  3G39 A;  2BNH A;  5HDH A;  3KJ4 A;  1K5D C;  1P9A G;  2Q4G W;  1FO1 A;  5B0T A;  4PEQ B;  2JE0 A;  2Z82 A;  3RW7 A;  1O6T A;  2XWT C;  2OMW A;  2V9T B;  4NZT M;  5CMN A;  3A79 B;  3WN4 A;  2JE1 A;  1GWB A;  4R5D A;  4XSQ A;  4LSX C;  3GOZ A;  4U7L A;  4P8S A;  1M0Z A;  4R6A A;  1FS2 A;  5GS0 A;  4BSR A;  4KT1 A;  1PGV A;  3W3N A;  2V9S A;  4LI1 A;  1A9N A;  4V2D A;  2O6S A;  3RFE A;  1JL5 A;  3M18 A;  4Z94 G;  2JQD A;  2OMT A;  1KOO A;  1Z7X W;  4LSX A;  1O6S A;  3TSR E;  3WPG A;  1SQ0 B;  3W3J A;  2FT3 A;  4U08 A;  3C6N B;  4I6J B;  2UZX A;  4R08 A;  4BSS A;  1M10 B;  3BZ5 A;  3PMH G;  1FT8 A;  4QC0 A;  3RFJ A;  4ARR A;  1OGQ A;  3G3A A;  1XWD C;  5CMP A;  3P72 A;  4H09 A;  1WWL A;  1W8A A;  1P8T A;  5GMH A;  4R6F A;  4XOS A;  3O6N A;  4NKH A;  4Z8G A;  4RCW A;  5GMF A;  2Z81 A;  3UL8 A;  1O6V A;  3ULA A;  5GS2 B;  4U06 A;  2OMY A;  4PKI G;  4BV4 R;  4FCG A;  3DZE A;  3G06 A;  5IYX C;  2Y5Q A;  2Z7X B;  4Z61 C;  3G04 C;  3RGX A;  4Y61 B;  3RFS A;  4ECN A;  1YRG A;  2WQW A;  4M7E C;  5IJC A;  3SB4 A;  3UL7 A;  1QYY A;  4WP6 A;  4AY9 X;  4R5C A;  4WYK A;  4OQT A;  2O6Q A;  4QXE A;  2P1N B;  4FMZ A;  3WPE A;  4R6J A;  4LXS A;  2ID5 A;  2P1M B;  5AZ5 A;  4UFR A;  2OMV A;  1FQV A;  3W3M A;  2WQV A;  4P91 A;  1M9L A;  2V70 A;  2A0Z A;  1LTX A;  2WQU A;  4J0M A;  3E2J A;  2ASS B;  1ZIW A;  5AWB A;  3RW6 A;  3E3Z A;  1KOH A;  4LSA A;  4GT6 A;  3OGM B;  1H6U A;  3ZYN A;  4ECO A;  3FXI A;  3WPB A;  1H6T A;  4NZR M;  2P1P B;  4R0A A;  1XCD A;  1DFJ I;  3ULV A;  4V2E A;  5AWA A;  4U09 A;  4YEB B;  3OGK B;  2O6R A;  3OJA A;  5HZL B;  2OMX A;  4R58 A;  4RCA B;  5AWD A;  2IFG A;  2OMU A;  1IO0 A;  2CA6 A;  1XEC A;  3M19 A;  5IJB A;  4ARN A;  3W3G A;  3G3B A;  2OMZ A;  5B0N A;  2Z64 A;  4R09 A;  3JB9 j;  4PQ8 A;  3C6P B;  1A4Y A;  3ZYJ A;  2XOT A;  4XGO A;  4MQW X;  5D3I A;  2P1Q B;  5FTT B;  2R9U A;  4CNC A;  3WPH A;  4IM6 A;  3ZYO A;  3OGL B;  3E6J A;  3ULU A;  3WPF A;  4FHO A;  3C6O B;  1U0N D;  4PER A;  2RA8 A;  4LI2 A;  3E4G A;  4QBZ A;  5B4P A;  3UL9 A;  1P8V A;  2Z65 A;  3VQ2 A;  4CIL A;  3OJA B;  1OTN A;  5LFN A;  4NKG A;  3RJ0 A;  1M9S A;  4PSJ A;  2WQX A;  3WPC A;  4B8C D;  4L3F A;  4BSU A;  4M7E A;  1XEU A;  4L3A A;  4Q62 A;  2WFH A;  5AWC A;  5A5C A;  1OOK G;  2Z63 A;  3WPD A;  4FD0 A;  3O53 A;  4G8A A;  4C2A B;  3WPI A;  4LXR A;  4J4L A;  1OZN A;  2Z66 A;  1D0B A;  5IJD A;  1DS9 A;  4LSC A;  4C2B B;  4RWT C;  5GQR K;  4EZG A;  4CC4 C;  1XKU A;  2AST B;  4FDW A;  2ELL A;  3REZ A;  4CP6 A;  2Z7X A;  2P1O B;  4Z64 C;  2BEX A;  3CIG A;  4FS7 A;  4KXF B;  3W3K A;  4KNG A;  5GMG A;  4CC4 A;  1K5G C;  4CNM A;  4K17 A;  3CIY A;  4TZH A;  4MN8 B;  3W3L A;  1DCE A; 
#chains in the Genus database with same CATH homology
 3ZYI A;  4R07 A;  3UN9 A;  1G9U A;  3CVR A;  4Q3G A;  2Z62 A;  2RR6 A;  2UZY A;  3VQ1 A;  4Q3I A;  1OTM A;  4HQ1 A;  4R6G A;  1OTO A;  3RIZ A;  3RGZ A;  4AW4 A;  4GLP A;  4V2C A;  4Z79 A;  3G39 A;  2BNH A;  5HDH A;  3KJ4 A;  1K5D C;  1P9A G;  2Q4G W;  1FO1 A;  5B0T A;  4PEQ B;  2JE0 A;  2Z82 A;  3RW7 A;  1O6T A;  2XWT C;  2OMW A;  2V9T B;  5CMN A;  3A79 B;  3WN4 A;  2JE1 A;  1GWB A;  4R5D A;  4XSQ A;  4LSX C;  3GOZ A;  4U7L A;  4P8S A;  1M0Z A;  4R6A A;  1FS2 A;  5GS0 A;  4BSR A;  4KT1 A;  1PGV A;  3W3N A;  2V9S A;  1A9N A;  4LI1 A;  4V2D A;  2O6S A;  3RFE A;  1JL5 A;  3M18 A;  4Z94 G;  2JQD A;  2OMT A;  1KOO A;  1Z7X W;  4LSX A;  1O6S A;  3TSR E;  3WPG A;  1SQ0 B;  3W3J A;  2FT3 A;  4U08 A;  3C6N B;  4I6J B;  2UZX A;  4R08 A;  4BSS A;  1M10 B;  3BZ5 A;  3PMH G;  1FT8 A;  4QC0 A;  3RFJ A;  4ARR A;  1OGQ A;  3G3A A;  1XWD C;  5CMP A;  3P72 A;  4H09 A;  1WWL A;  1W8A A;  1P8T A;  5GMH A;  4R6F A;  4XOS A;  3O6N A;  4NKH A;  4Z8G A;  4RCW A;  5GMF A;  2Z81 A;  3UL8 A;  1O6V A;  3ULA A;  5GS2 B;  4U06 A;  2OMY A;  4PKI G;  4BV4 R;  4FCG A;  3DZE A;  3G06 A;  5IYX C;  2Y5Q A;  2Z7X B;  3G04 C;  4Z61 C;  3RGX A;  4Y61 B;  3RFS A;  4ECN A;  1YRG A;  2WQW A;  4M7E C;  5IJC A;  3SB4 A;  3UL7 A;  1QYY A;  4WP6 A;  4AY9 X;  4R5C A;  4WYK A;  4OQT A;  2O6Q A;  4QXE A;  2P1N B;  4FMZ A;  3WPE A;  4R6J A;  4LXS A;  2ID5 A;  2P1M B;  5AZ5 A;  4UFR A;  2OMV A;  1FQV A;  3W3M A;  2WQV A;  4P91 A;  1M9L A;  2V70 A;  2A0Z A;  1LTX A;  2WQU A;  4J0M A;  3E2J A;  2ASS B;  1ZIW A;  5AWB A;  3RW6 A;  3E3Z A;  1KOH A;  4LSA A;  4GT6 A;  3OGM B;  1H6U A;  3ZYN A;  4ECO A;  3FXI A;  3WPB A;  1H6T A;  2P1P B;  4R0A A;  1XCD A;  1DFJ I;  3ULV A;  4V2E A;  5AWA A;  4U09 A;  4YEB B;  3OGK B;  2O6R A;  3OJA A;  5HZL B;  2OMX A;  4R58 A;  4RCA B;  5AWD A;  2IFG A;  2OMU A;  1IO0 A;  2CA6 A;  1XEC A;  3M19 A;  5IJB A;  4ARN A;  3W3G A;  3G3B A;  2OMZ A;  5B0N A;  2Z64 A;  4R09 A;  3JB9 j;  4PQ8 A;  3C6P B;  1A4Y A;  3ZYJ A;  2XOT A;  4XGO A;  4MQW X;  5D3I A;  2P1Q B;  5FTT B;  2R9U A;  4CNC A;  3WPH A;  4IM6 A;  3ZYO A;  3OGL B;  3E6J A;  3ULU A;  3WPF A;  4FHO A;  3C6O B;  1U0N D;  4PER A;  2RA8 A;  4LI2 A;  3E4G A;  4QBZ A;  5B4P A;  3UL9 A;  1P8V A;  2Z65 A;  3VQ2 A;  4CIL A;  3OJA B;  1OTN A;  5LFN A;  4NKG A;  3RJ0 A;  1M9S A;  4PSJ A;  2WQX A;  3WPC A;  4B8C D;  4L3F A;  4BSU A;  4M7E A;  1XEU A;  4L3A A;  4Q62 A;  2WFH A;  5AWC A;  5A5C A;  1OOK G;  2Z63 A;  3WPD A;  4FD0 A;  3O53 A;  4G8A A;  4C2A B;  3WPI A;  4LXR A;  4J4L A;  1OZN A;  2Z66 A;  1D0B A;  5IJD A;  1DS9 A;  4LSC A;  4C2B B;  4RWT C;  5GQR K;  4EZG A;  4CC4 C;  1XKU A;  2AST B;  4FDW A;  2ELL A;  3REZ A;  4CP6 A;  2Z7X A;  2P1O B;  4Z64 C;  2BEX A;  3CIG A;  4FS7 A;  4KXF B;  3W3K A;  4KNG A;  5GMG A;  4CC4 A;  1K5G C;  4CNM A;  4K17 A;  3CIY A;  4TZH A;  4MN8 B;  3W3L A;  1DCE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...