1XCDA

Dimeric bovine tissue-extracted decorin, crystal form 1
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
305
structure length
305
Chain Sequence
GPVCPFRCQCHLRVVQCSDLGLEKVPKDLPPDTALLDLQNNKITEIKDGDFKNLKNLHTLILINNKISKISPGAFAPLVKLERLYLSKNQLKELPEKMPKTLQELRVHENEITKVRKSVFNGLNQMIVVELGTNPLKSSGIENGAFQGMKKLSYIRIADTNITTIPQGLPPSLTELHLDGNKITKVDAASLKGLNNLAKLGLSFNSISAVDNGSLANTPHLRELHLNNNKLVKVPGGLADHKYIQVVYLHNNNISAIGSNDFCPPGYNTKKASYSGVSLFSNPVQYWEIQPSTFRCVYVRAAVQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein
molecule keywords Decorin
publication title Crystal structure of the dimeric protein core of decorin, the archetypal small leucine-rich repeat proteoglycan
pubmed doi rcsb
total genus 105
structure length 305
sequence length 305
ec nomenclature
pdb deposition date 2004-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01462 LRRNT Leucine rich repeat N-terminal domain
A PF13855 LRR_8 Leucine rich repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 1xcdA00
2JE1A 2O6RA 1KOOA 1XCDA 4ECNA 4Z94G 3M18A 4XOSA 3RW7A 4FHOA 3WN4A 4ARNA 5GQRK 3VQ1A 3M19A 2Z62A 1OTMA 3WPIA 3ULAA 4ECOA 1IO0A 3WPFA 4J4LA 1OOKG 4R58A 1P9AG 4FCGA 5A5CA 5GS0A 2OMXA 3A79B 3WPDA 5GMHA 4IM6A 3SB4A 4OQTA 4M7EA 4H09A 4PQ8A 3ZYOA 1OZNA 3E4GA 4R07A 2OMZA 4Q3IA 1G9UA 4L3AA 3W3NA 1K5GC 3UL7A 3DZEA 4FDWA 4C2AB 1H6UA 3RFEA 5AZ5A 3RGZA 2OMUA 3RGXA 2IFGA 3ULVA 4B8CD 5AWBA 1OTNA 3RW6A 4U08A 1XWDC 4KXFB 3W3KA 3ZYIA 2P1OB 2Z65A 4LSXC 5AWCA 4C2BB 5IJBA 5D3IA 1P8VA 1O6SA 2Z63A 2ELLA 5LFNA 4CILA 2WQWA 4U7LA 4KT1A 2A0ZA 2Q4GW 2V9TB 1XKUA 2Y5QA 2FT3A 3ULUA 3WPCA 4CNMA 2RR6A 4R5DA 2OMYA 3OJAB 5IJCA 2WQUA 2V9SA 1GWBA 2Z66A 4WP6A 1OGQA 5GMGA 2R9UA 5HZLB 4U06A 3GOZA 4LI1A 4P8SA 4XSQA 4Y61B 3UL8A 4R6GA 3W3MA 4V2EA 2Z64A 3KJ4A 4Q62A 1M9LA 3WPHA 3RFJA 2P1QB 4AY9X 4R5CA 5IJDA 2Z7XB 4R08A 3G3BA 1PGVA 2XWTC 4P91A 4RCWA 1XEUA 4Z61C 1DFJI 3O53A 1DCEA 4MN8B 4NKGA 5AWAA 4PKIG 4FS7A 4WYKA 4LSXA 4AW4A 1FS2A 1W8AA 4YEBB 3E3ZA 5GS2B 5IYXC 2WQXA 4LXRA 1O6TA 4I6JB 2BEXA 2WQVA 3WPEA 4LSAA 2P1MB 4BV4R 1M9SA 4MQWX 4GT6A 4CC4C 1WWLA 2UZXA 3G39A 1FO1A 2Z81A 4V2DA 3RFSA 4RWTC 1H6TA 1LTXA 2O6SA 3RJ0A 4Z79A 3O6NA 4R09A 2O6QA 3BZ5A 3C6PB 4QC0A 4NKHA 3TSRE 1SQ0B 3G3AA 4R6JA 3VQ2A 5B0NA 4V2CA 2JQDA 1JL5A 3W3JA 4R6FA 1KOHA 3WPBA 2ASTB 3RIZA 2CA6A 4BSRA 4LSCA 4CP6A 3ZYJA 4GLPA 4KNGA 2Z7XA 2OMVA 3OGKB 5HDHA 5B0TA 4HQ1A 1U0ND 3WPGA 3PMHG 2WFHA 4R0AA 2RA8A 3W3LA 4Z64C 1QYYA 5GMFA 4ARRA 1ZIWA 2UZYA 3JB9j 2BNHA 2ASSB 2ID5A 3CVRA 3E2JA 4J0MA 4TZHA 3REZA 2JE0A 1M10B 1YRGA 1OTOA 1M0ZA 1Z7XW 1FQVA 3C6OB 4L3FA 5B4PA 4UFRA 4R6AA 4BSSA 4BSUA 4QXEA 4Z8GA 1D0BA 5AWDA 3G06A 4FMZA 4Q3GA 1A9NA 4G8AA 4CC4A 1DS9A 4M7EC 3ZYNA 1O6VA 3CIGA 4EZGA 3UL9A 4PSJA 3UN9A 4XGOA 5CMPA 4PEQB 3OGMB 2OMWA 4PERA 3P72A 1XECA 1A4YA 4FD0A 3E6JA 2V70A 5CMNA 4CNCA 2P1PB 3C6NB 2Z82A 3FXIA 2XOTA 2P1NB 2OMTA 3OJAA 3W3GA 1P8TA 3CIYA 3OGLB 1K5DC 4K17A 5FTTB 4LI2A 4QBZA 1FT8A 4LXSA 4U09A 4RCAB 3G04C
chains in the Genus database with same CATH superfamily
2JE1A 2O6RA 1KOOA 1XCDA 4ECNA 4Z94G 3M18A 4XOSA 3RW7A 4FHOA 3WN4A 4ARNA 5GQRK 3VQ1A 3M19A 2Z62A 1OTMA 3WPIA 3ULAA 4ECOA 1IO0A 3WPFA 4J4LA 1OOKG 4R58A 1P9AG 4FCGA 5A5CA 5GS0A 2OMXA 3A79B 3WPDA 5GMHA 4IM6A 3SB4A 4OQTA 4M7EA 4H09A 4PQ8A 3ZYOA 1OZNA 3E4GA 4R07A 2OMZA 4Q3IA 1G9UA 4L3AA 3W3NA 1K5GC 3UL7A 3DZEA 4FDWA 4C2AB 1H6UA 3RFEA 5AZ5A 3RGZA 2OMUA 3RGXA 2IFGA 3ULVA 4B8CD 5AWBA 1OTNA 3RW6A 4U08A 1XWDC 4KXFB 3W3KA 3ZYIA 2P1OB 2Z65A 4LSXC 5AWCA 4C2BB 5IJBA 5D3IA 1P8VA 1O6SA 2Z63A 2ELLA 5LFNA 4CILA 2WQWA 4U7LA 4KT1A 2A0ZA 2Q4GW 2V9TB 1XKUA 2Y5QA 2FT3A 3ULUA 3WPCA 4CNMA 2RR6A 4R5DA 2OMYA 3OJAB 5IJCA 2WQUA 2V9SA 1GWBA 2Z66A 4WP6A 1OGQA 5GMGA 2R9UA 5HZLB 4U06A 3GOZA 4LI1A 4P8SA 4XSQA 4Y61B 3UL8A 4R6GA 3W3MA 4V2EA 2Z64A 3KJ4A 4Q62A 1M9LA 3WPHA 3RFJA 2P1QB 4AY9X 4R5CA 5IJDA 2Z7XB 4R08A 3G3BA 1PGVA 2XWTC 4P91A 4RCWA 1XEUA 4Z61C 1DFJI 3O53A 1DCEA 4MN8B 4NKGA 5AWAA 4PKIG 4FS7A 4WYKA 4LSXA 4AW4A 1FS2A 1W8AA 4YEBB 3E3ZA 5GS2B 5IYXC 2WQXA 4LXRA 1O6TA 4I6JB 2BEXA 2WQVA 3WPEA 4LSAA 2P1MB 4BV4R 1M9SA 4MQWX 4GT6A 4CC4C 1WWLA 2UZXA 3G39A 1FO1A 2Z81A 4NZTM 4V2DA 3RFSA 4RWTC 1H6TA 1LTXA 2O6SA 3RJ0A 4Z79A 3O6NA 4R09A 2O6QA 3BZ5A 3C6PB 4QC0A 4NKHA 3TSRE 1SQ0B 3G3AA 4R6JA 3VQ2A 5B0NA 4V2CA 2JQDA 1JL5A 3W3JA 4R6FA 1KOHA 3WPBA 2ASTB 3RIZA 2CA6A 4BSRA 4LSCA 4CP6A 3ZYJA 4GLPA 4KNGA 2Z7XA 2OMVA 3OGKB 5HDHA 5B0TA 4HQ1A 1U0ND 3WPGA 3PMHG 2WFHA 4R0AA 2RA8A 3W3LA 4Z64C 1QYYA 5GMFA 4ARRA 1ZIWA 2UZYA 3JB9j 2BNHA 2ASSB 2ID5A 3CVRA 3E2JA 4J0MA 4TZHA 3REZA 2JE0A 1M10B 1YRGA 1OTOA 1M0ZA 1Z7XW 1FQVA 3C6OB 4L3FA 5B4PA 4UFRA 4R6AA 4BSSA 4BSUA 4QXEA 4Z8GA 1D0BA 5AWDA 3G06A 4FMZA 4Q3GA 1A9NA 4G8AA 4CC4A 1DS9A 4M7EC 3ZYNA 1O6VA 3CIGA 4NZRM 4EZGA 3UL9A 4PSJA 3UN9A 4XGOA 5CMPA 4PEQB 3OGMB 2OMWA 4PERA 3P72A 1XECA 1A4YA 4FD0A 3E6JA 2V70A 5CMNA 4CNCA 2P1PB 3C6NB 2Z82A 3FXIA 2XOTA 2P1NB 2OMTA 3OJAA 3W3GA 1P8TA 3CIYA 3OGLB 1K5DC 4K17A 5FTTB 4LI2A 4QBZA 1FT8A 4LXSA 4U09A 4RCAB 3G04C
chains in the Genus database with same CATH topology
2JE1A 2O6RA 1KOOA 1XCDA 4ECNA 4Z94G 3M18A 4XOSA 3RW7A 4FHOA 3WN4A 4ARNA 5GQRK 3VQ1A 3M19A 2Z62A 1OTMA 3WPIA 3ULAA 4ECOA 1IO0A 3WPFA 4J4LA 1OOKG 4R58A 1P9AG 4FCGA 5A5CA 5GS0A 2OMXA 3A79B 3WPDA 5GMHA 4IM6A 3SB4A 4OQTA 4M7EA 4H09A 4PQ8A 3ZYOA 1OZNA 3E4GA 4R07A 2OMZA 4Q3IA 1G9UA 4L3AA 3W3NA 1K5GC 3UL7A 3DZEA 4FDWA 4C2AB 1H6UA 3RFEA 5AZ5A 3RGZA 2OMUA 3RGXA 2IFGA 3ULVA 4B8CD 5AWBA 1OTNA 3RW6A 4U08A 1XWDC 4KXFB 3W3KA 3ZYIA 2P1OB 2Z65A 4LSXC 5AWCA 4C2BB 5IJBA 5D3IA 1P8VA 1O6SA 2Z63A 2ELLA 5LFNA 4CILA 2WQWA 4U7LA 4KT1A 2A0ZA 2Q4GW 2V9TB 1XKUA 2Y5QA 2FT3A 3ULUA 3WPCA 4CNMA 2RR6A 4R5DA 2OMYA 3OJAB 5IJCA 2WQUA 2V9SA 1GWBA 2Z66A 4WP6A 1OGQA 5GMGA 2R9UA 5HZLB 4U06A 3GOZA 4LI1A 4P8SA 4XSQA 4Y61B 3UL8A 4R6GA 3W3MA 4V2EA 2Z64A 3KJ4A 4Q62A 1M9LA 3WPHA 3RFJA 2P1QB 4AY9X 4R5CA 5IJDA 2Z7XB 4R08A 3G3BA 1PGVA 2XWTC 4P91A 4RCWA 1XEUA 4Z61C 1DFJI 3O53A 1DCEA 4MN8B 4NKGA 5AWAA 4PKIG 4FS7A 4WYKA 4LSXA 4AW4A 1FS2A 1W8AA 4YEBB 3E3ZA 5GS2B 5IYXC 2WQXA 4LXRA 1O6TA 4I6JB 2BEXA 2WQVA 3WPEA 4LSAA 2P1MB 4BV4R 1M9SA 4MQWX 4GT6A 4CC4C 1WWLA 2UZXA 3G39A 1FO1A 2Z81A 4V2DA 3RFSA 4RWTC 1H6TA 1LTXA 2O6SA 3RJ0A 4Z79A 3O6NA 4R09A 2O6QA 3BZ5A 3C6PB 4QC0A 4NKHA 3TSRE 1SQ0B 3G3AA 4R6JA 3VQ2A 5B0NA 4V2CA 2JQDA 1JL5A 3W3JA 4R6FA 1KOHA 3WPBA 2ASTB 3RIZA 2CA6A 4BSRA 4LSCA 4CP6A 3ZYJA 4GLPA 4KNGA 2Z7XA 2OMVA 3OGKB 5HDHA 5B0TA 4HQ1A 1U0ND 3WPGA 3PMHG 2WFHA 4R0AA 2RA8A 3W3LA 4Z64C 1QYYA 5GMFA 4ARRA 1ZIWA 2UZYA 3JB9j 2BNHA 2ASSB 2ID5A 3CVRA 3E2JA 4J0MA 4TZHA 3REZA 2JE0A 1M10B 1YRGA 1OTOA 1M0ZA 1Z7XW 1FQVA 3C6OB 4L3FA 5B4PA 4UFRA 4R6AA 4BSSA 4BSUA 4QXEA 4Z8GA 1D0BA 5AWDA 3G06A 4FMZA 4Q3GA 1A9NA 4G8AA 4CC4A 1DS9A 4M7EC 3ZYNA 1O6VA 3CIGA 4EZGA 3UL9A 4PSJA 3UN9A 4XGOA 5CMPA 4PEQB 3OGMB 2OMWA 4PERA 3P72A 1XECA 1A4YA 4FD0A 3E6JA 2V70A 5CMNA 4CNCA 2P1PB 3C6NB 2Z82A 3FXIA 2XOTA 2P1NB 2OMTA 3OJAA 3W3GA 1P8TA 3CIYA 3OGLB 1K5DC 4K17A 5FTTB 4LI2A 4QBZA 1FT8A 4LXSA 4U09A 4RCAB 3G04C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JE1 A;  2O6R A;  1KOO A;  1XCD A;  4ECN A;  4Z94 G;  3M18 A;  4XOS A;  3RW7 A;  4FHO A;  3WN4 A;  4ARN A;  5GQR K;  3VQ1 A;  3M19 A;  2Z62 A;  1OTM A;  3WPI A;  3ULA A;  4ECO A;  1IO0 A;  3WPF A;  4J4L A;  1OOK G;  4R58 A;  1P9A G;  4FCG A;  5A5C A;  5GS0 A;  2OMX A;  3A79 B;  3WPD A;  5GMH A;  4IM6 A;  3SB4 A;  4OQT A;  4M7E A;  4H09 A;  4PQ8 A;  3ZYO A;  1OZN A;  3E4G A;  4R07 A;  2OMZ A;  4Q3I A;  1G9U A;  4L3A A;  3W3N A;  1K5G C;  3UL7 A;  3DZE A;  4FDW A;  4C2A B;  1H6U A;  3RFE A;  5AZ5 A;  3RGZ A;  2OMU A;  3RGX A;  2IFG A;  3ULV A;  4B8C D;  5AWB A;  1OTN A;  3RW6 A;  4U08 A;  1XWD C;  4KXF B;  3W3K A;  3ZYI A;  2P1O B;  2Z65 A;  4LSX C;  5AWC A;  4C2B B;  5IJB A;  5D3I A;  1P8V A;  1O6S A;  2Z63 A;  2ELL A;  5LFN A;  4CIL A;  2WQW A;  4U7L A;  4KT1 A;  2A0Z A;  2Q4G W;  2V9T B;  1XKU A;  2Y5Q A;  2FT3 A;  3ULU A;  3WPC A;  4CNM A;  2RR6 A;  4R5D A;  2OMY A;  3OJA B;  5IJC A;  2WQU A;  2V9S A;  1GWB A;  2Z66 A;  4WP6 A;  1OGQ A;  5GMG A;  2R9U A;  5HZL B;  4U06 A;  3GOZ A;  4LI1 A;  4P8S A;  4XSQ A;  4Y61 B;  3UL8 A;  4R6G A;  3W3M A;  4V2E A;  2Z64 A;  3KJ4 A;  4Q62 A;  1M9L A;  3WPH A;  3RFJ A;  2P1Q B;  4AY9 X;  4R5C A;  5IJD A;  2Z7X B;  4R08 A;  3G3B A;  1PGV A;  2XWT C;  4P91 A;  4RCW A;  1XEU A;  4Z61 C;  1DFJ I;  3O53 A;  1DCE A;  4MN8 B;  4NKG A;  5AWA A;  4PKI G;  4FS7 A;  4WYK A;  4LSX A;  4AW4 A;  1FS2 A;  1W8A A;  4YEB B;  3E3Z A;  5GS2 B;  5IYX C;  2WQX A;  4LXR A;  1O6T A;  4I6J B;  2BEX A;  2WQV A;  3WPE A;  4LSA A;  2P1M B;  4BV4 R;  1M9S A;  4MQW X;  4GT6 A;  4CC4 C;  1WWL A;  2UZX A;  3G39 A;  1FO1 A;  2Z81 A;  4V2D A;  3RFS A;  4RWT C;  1H6T A;  1LTX A;  2O6S A;  3RJ0 A;  4Z79 A;  3O6N A;  4R09 A;  2O6Q A;  3BZ5 A;  3C6P B;  4QC0 A;  4NKH A;  3TSR E;  1SQ0 B;  3G3A A;  4R6J A;  3VQ2 A;  5B0N A;  4V2C A;  2JQD A;  1JL5 A;  3W3J A;  4R6F A;  1KOH A;  3WPB A;  2AST B;  3RIZ A;  2CA6 A;  4BSR A;  4LSC A;  4CP6 A;  3ZYJ A;  4GLP A;  4KNG A;  2Z7X A;  2OMV A;  3OGK B;  5HDH A;  5B0T A;  4HQ1 A;  1U0N D;  3WPG A;  3PMH G;  2WFH A;  4R0A A;  2RA8 A;  3W3L A;  4Z64 C;  1QYY A;  5GMF A;  4ARR A;  1ZIW A;  2UZY A;  3JB9 j;  2BNH A;  2ASS B;  2ID5 A;  3CVR A;  3E2J A;  4J0M A;  4TZH A;  3REZ A;  2JE0 A;  1M10 B;  1YRG A;  1OTO A;  1M0Z A;  1Z7X W;  1FQV A;  3C6O B;  4L3F A;  5B4P A;  4UFR A;  4R6A A;  4BSS A;  4BSU A;  4QXE A;  4Z8G A;  1D0B A;  5AWD A;  3G06 A;  4FMZ A;  4Q3G A;  1A9N A;  4G8A A;  4CC4 A;  1DS9 A;  4M7E C;  3ZYN A;  1O6V A;  3CIG A;  4EZG A;  3UL9 A;  4PSJ A;  3UN9 A;  4XGO A;  5CMP A;  4PEQ B;  3OGM B;  2OMW A;  4PER A;  3P72 A;  1XEC A;  1A4Y A;  4FD0 A;  3E6J A;  2V70 A;  5CMN A;  4CNC A;  2P1P B;  3C6N B;  2Z82 A;  3FXI A;  2XOT A;  2P1N B;  2OMT A;  3OJA A;  3W3G A;  1P8T A;  3CIY A;  3OGL B;  1K5D C;  4K17 A;  5FTT B;  4LI2 A;  4QBZ A;  1FT8 A;  4LXS A;  4U09 A;  4RCA B;  3G04 C; 
#chains in the Genus database with same CATH topology
 2JE1 A;  2O6R A;  1KOO A;  1XCD A;  4ECN A;  4Z94 G;  3M18 A;  4XOS A;  3RW7 A;  4FHO A;  3WN4 A;  4ARN A;  5GQR K;  3VQ1 A;  3M19 A;  2Z62 A;  1OTM A;  3WPI A;  3ULA A;  4ECO A;  1IO0 A;  3WPF A;  4J4L A;  1OOK G;  4R58 A;  1P9A G;  4FCG A;  5A5C A;  5GS0 A;  2OMX A;  3A79 B;  3WPD A;  5GMH A;  4IM6 A;  3SB4 A;  4OQT A;  4M7E A;  4H09 A;  4PQ8 A;  3ZYO A;  1OZN A;  3E4G A;  4R07 A;  2OMZ A;  4Q3I A;  1G9U A;  4L3A A;  3W3N A;  1K5G C;  3UL7 A;  3DZE A;  4FDW A;  4C2A B;  1H6U A;  3RFE A;  5AZ5 A;  3RGZ A;  2OMU A;  3RGX A;  2IFG A;  3ULV A;  4B8C D;  5AWB A;  1OTN A;  3RW6 A;  4U08 A;  1XWD C;  4KXF B;  3W3K A;  3ZYI A;  2P1O B;  2Z65 A;  4LSX C;  5AWC A;  4C2B B;  5IJB A;  5D3I A;  1P8V A;  1O6S A;  2Z63 A;  2ELL A;  5LFN A;  4CIL A;  2WQW A;  4U7L A;  4KT1 A;  2A0Z A;  2Q4G W;  2V9T B;  1XKU A;  2Y5Q A;  2FT3 A;  3ULU A;  3WPC A;  4CNM A;  2RR6 A;  4R5D A;  2OMY A;  3OJA B;  5IJC A;  2WQU A;  2V9S A;  1GWB A;  2Z66 A;  4WP6 A;  1OGQ A;  5GMG A;  2R9U A;  5HZL B;  4U06 A;  3GOZ A;  4LI1 A;  4P8S A;  4XSQ A;  4Y61 B;  3UL8 A;  4R6G A;  3W3M A;  4V2E A;  2Z64 A;  3KJ4 A;  4Q62 A;  1M9L A;  3WPH A;  3RFJ A;  2P1Q B;  4AY9 X;  4R5C A;  5IJD A;  2Z7X B;  4R08 A;  3G3B A;  1PGV A;  2XWT C;  4P91 A;  4RCW A;  1XEU A;  4Z61 C;  1DFJ I;  3O53 A;  1DCE A;  4MN8 B;  4NKG A;  5AWA A;  4PKI G;  4FS7 A;  4WYK A;  4LSX A;  4AW4 A;  1FS2 A;  1W8A A;  4YEB B;  3E3Z A;  5GS2 B;  5IYX C;  2WQX A;  4LXR A;  1O6T A;  4I6J B;  2BEX A;  2WQV A;  3WPE A;  4LSA A;  2P1M B;  4BV4 R;  1M9S A;  4MQW X;  4GT6 A;  4CC4 C;  1WWL A;  2UZX A;  3G39 A;  1FO1 A;  2Z81 A;  4NZT M;  4V2D A;  3RFS A;  4RWT C;  1H6T A;  1LTX A;  2O6S A;  3RJ0 A;  4Z79 A;  3O6N A;  4R09 A;  2O6Q A;  3BZ5 A;  3C6P B;  4QC0 A;  4NKH A;  3TSR E;  1SQ0 B;  3G3A A;  4R6J A;  3VQ2 A;  5B0N A;  4V2C A;  2JQD A;  1JL5 A;  3W3J A;  4R6F A;  1KOH A;  3WPB A;  2AST B;  3RIZ A;  2CA6 A;  4BSR A;  4LSC A;  4CP6 A;  3ZYJ A;  4GLP A;  4KNG A;  2Z7X A;  2OMV A;  3OGK B;  5HDH A;  5B0T A;  4HQ1 A;  1U0N D;  3WPG A;  3PMH G;  2WFH A;  4R0A A;  2RA8 A;  3W3L A;  4Z64 C;  1QYY A;  5GMF A;  4ARR A;  1ZIW A;  2UZY A;  3JB9 j;  2BNH A;  2ASS B;  2ID5 A;  3CVR A;  3E2J A;  4J0M A;  4TZH A;  3REZ A;  2JE0 A;  1M10 B;  1YRG A;  1OTO A;  1M0Z A;  1Z7X W;  1FQV A;  3C6O B;  4L3F A;  5B4P A;  4UFR A;  4R6A A;  4BSS A;  4BSU A;  4QXE A;  4Z8G A;  1D0B A;  5AWD A;  3G06 A;  4FMZ A;  4Q3G A;  1A9N A;  4G8A A;  4CC4 A;  1DS9 A;  4M7E C;  3ZYN A;  1O6V A;  3CIG A;  4NZR M;  4EZG A;  3UL9 A;  4PSJ A;  3UN9 A;  4XGO A;  5CMP A;  4PEQ B;  3OGM B;  2OMW A;  4PER A;  3P72 A;  1XEC A;  1A4Y A;  4FD0 A;  3E6J A;  2V70 A;  5CMN A;  4CNC A;  2P1P B;  3C6N B;  2Z82 A;  3FXI A;  2XOT A;  2P1N B;  2OMT A;  3OJA A;  3W3G A;  1P8T A;  3CIY A;  3OGL B;  1K5D C;  4K17 A;  5FTT B;  4LI2 A;  4QBZ A;  1FT8 A;  4LXS A;  4U09 A;  4RCA B;  3G04 C; 
#chains in the Genus database with same CATH homology
 2JE1 A;  2O6R A;  1KOO A;  1XCD A;  4ECN A;  4Z94 G;  3M18 A;  4XOS A;  3RW7 A;  4FHO A;  3WN4 A;  4ARN A;  5GQR K;  3VQ1 A;  3M19 A;  2Z62 A;  1OTM A;  3WPI A;  3ULA A;  4ECO A;  1IO0 A;  3WPF A;  4J4L A;  1OOK G;  4R58 A;  1P9A G;  4FCG A;  5A5C A;  5GS0 A;  2OMX A;  3A79 B;  3WPD A;  5GMH A;  4IM6 A;  3SB4 A;  4OQT A;  4M7E A;  4H09 A;  4PQ8 A;  3ZYO A;  1OZN A;  3E4G A;  4R07 A;  2OMZ A;  4Q3I A;  1G9U A;  4L3A A;  3W3N A;  1K5G C;  3UL7 A;  3DZE A;  4FDW A;  4C2A B;  1H6U A;  3RFE A;  5AZ5 A;  3RGZ A;  2OMU A;  3RGX A;  2IFG A;  3ULV A;  4B8C D;  5AWB A;  1OTN A;  3RW6 A;  4U08 A;  1XWD C;  4KXF B;  3W3K A;  3ZYI A;  2P1O B;  2Z65 A;  4LSX C;  5AWC A;  4C2B B;  5IJB A;  5D3I A;  1P8V A;  1O6S A;  2Z63 A;  2ELL A;  5LFN A;  4CIL A;  2WQW A;  4U7L A;  4KT1 A;  2A0Z A;  2Q4G W;  2V9T B;  1XKU A;  2Y5Q A;  2FT3 A;  3ULU A;  3WPC A;  4CNM A;  2RR6 A;  4R5D A;  2OMY A;  3OJA B;  5IJC A;  2WQU A;  2V9S A;  1GWB A;  2Z66 A;  4WP6 A;  1OGQ A;  5GMG A;  2R9U A;  5HZL B;  4U06 A;  3GOZ A;  4LI1 A;  4P8S A;  4XSQ A;  4Y61 B;  3UL8 A;  4R6G A;  3W3M A;  4V2E A;  2Z64 A;  3KJ4 A;  4Q62 A;  1M9L A;  3WPH A;  3RFJ A;  2P1Q B;  4AY9 X;  4R5C A;  5IJD A;  2Z7X B;  4R08 A;  3G3B A;  1PGV A;  2XWT C;  4P91 A;  4RCW A;  1XEU A;  4Z61 C;  1DFJ I;  3O53 A;  1DCE A;  4MN8 B;  4NKG A;  5AWA A;  4PKI G;  4FS7 A;  4WYK A;  4LSX A;  4AW4 A;  1FS2 A;  1W8A A;  4YEB B;  3E3Z A;  5GS2 B;  5IYX C;  2WQX A;  4LXR A;  1O6T A;  4I6J B;  2BEX A;  2WQV A;  3WPE A;  4LSA A;  2P1M B;  4BV4 R;  1M9S A;  4MQW X;  4GT6 A;  4CC4 C;  1WWL A;  2UZX A;  3G39 A;  1FO1 A;  2Z81 A;  4V2D A;  3RFS A;  4RWT C;  1H6T A;  1LTX A;  2O6S A;  3RJ0 A;  4Z79 A;  3O6N A;  4R09 A;  2O6Q A;  3BZ5 A;  3C6P B;  4QC0 A;  4NKH A;  3TSR E;  1SQ0 B;  3G3A A;  4R6J A;  3VQ2 A;  5B0N A;  4V2C A;  2JQD A;  1JL5 A;  3W3J A;  4R6F A;  1KOH A;  3WPB A;  2AST B;  3RIZ A;  2CA6 A;  4BSR A;  4LSC A;  4CP6 A;  3ZYJ A;  4GLP A;  4KNG A;  2Z7X A;  2OMV A;  3OGK B;  5HDH A;  5B0T A;  4HQ1 A;  1U0N D;  3WPG A;  3PMH G;  2WFH A;  4R0A A;  2RA8 A;  3W3L A;  4Z64 C;  1QYY A;  5GMF A;  4ARR A;  1ZIW A;  2UZY A;  3JB9 j;  2BNH A;  2ASS B;  2ID5 A;  3CVR A;  3E2J A;  4J0M A;  4TZH A;  3REZ A;  2JE0 A;  1M10 B;  1YRG A;  1OTO A;  1M0Z A;  1Z7X W;  1FQV A;  3C6O B;  4L3F A;  5B4P A;  4UFR A;  4R6A A;  4BSS A;  4BSU A;  4QXE A;  4Z8G A;  1D0B A;  5AWD A;  3G06 A;  4FMZ A;  4Q3G A;  1A9N A;  4G8A A;  4CC4 A;  1DS9 A;  4M7E C;  3ZYN A;  1O6V A;  3CIG A;  4EZG A;  3UL9 A;  4PSJ A;  3UN9 A;  4XGO A;  5CMP A;  4PEQ B;  3OGM B;  2OMW A;  4PER A;  3P72 A;  1XEC A;  1A4Y A;  4FD0 A;  3E6J A;  2V70 A;  5CMN A;  4CNC A;  2P1P B;  3C6N B;  2Z82 A;  3FXI A;  2XOT A;  2P1N B;  2OMT A;  3OJA A;  3W3G A;  1P8T A;  3CIY A;  3OGL B;  1K5D C;  4K17 A;  5FTT B;  4LI2 A;  4QBZ A;  1FT8 A;  4LXS A;  4U09 A;  4RCA B;  3G04 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...