1XCDA

Dimeric bovine tissue-extracted decorin, crystal form 1
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
305
structure length
305
Chain Sequence
b'GPVCPFRCQCHLRVVQCSDLGLEKVPKDLPPDTALLDLQNNKITEIKDGDFKNLKNLHTLILINNKISKISPGAFAPLVKLERLYLSKNQLKELPEKMPKTLQELRVHENEITKVRKSVFNGLNQMIVVELGTNPLKSSGIENGAFQGMKKLSYIRIADTNITTIPQGLPPSLTELHLDGNKITKVDAASLKGLNNLAKLGLSFNSISAVDNGSLANTPHLRELHLNNNKLVKVPGGLADHKYIQVVYLHNNNISAIGSNDFCPPGYNTKKASYSGVSLFSNPVQYWEIQPSTFRCVYVRAAVQL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Decorin
publication title Crystal structure of the dimeric protein core of decorin, the archetypal small leucine-rich repeat proteoglycan
pubmed doi rcsb
molecule tags Structural protein
total genus 105
structure length 305
sequence length 305
ec nomenclature
pdb deposition date 2004-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01462 LRRNT Leucine rich repeat N-terminal domain
A PF13855 LRR_8 Leucine rich repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 1xcdA00
2UZYA 1OOKG 5B0TA 2Q4GW 4R58A 2ASTB 5LFNA 3WPCA 1OTNA 3RFEA 2P1QB 4TZHA 4Z64C 1H6TA 2BEXA 3RIZA 3KJ4A 1YRGA 3BZ5A 4Q3IA 2JE1A 4R6FA 4R5DA 4RCAB 4V2EA 4U7LA 4R5CA 4BV4R 1GWBA 3SB4A 3G06A 4KNGA 5CMPA 3TSRE 4OQTA 1M0ZA 4NKGA 4WYKA 4J4LA 1JL5A 4UFRA 2Z82A 4LSXC 5FTTB 4AY9X 1K5GC 4BSSA 5GS0A 4FHOA 4KXFB 1P9AG 2O6RA 4KT1A 5A5CA 2OMZA 4J0MA 4MN8B 3W3GA 1M10B 4Z94G 2WQVA 1DS9A 2Z66A 4FS7A 3CVRA 2Z7XA 5AWDA 4CP6A 1P8TA 1OZNA 2V70A 3WPEA 4GT6A 3WPDA 4I6JB 4CNMA 3RFSA 1P8VA 2ASSB 2A0ZA 3ZYNA 2FT3A 4LXSA 3W3KA 3WPHA 4HQ1A 3O6NA 3CIYA 3DZEA 1H6UA 2Z81A 2BNHA 2UZXA 4GLPA 2Z63A 4WP6A 3FXIA 2Z62A 4FMZA 2Z7XB 2ELLA 3W3MA 5GMFA 2WQUA 2WQXA 4IM6A 4U09A 3E4GA 4ECNA 3ULVA 3RGZA 3RFJA 5HDHA 4Q3GA 4Y61B 1QYYA 3CIGA 2O6QA 3G39A 3OJAA 4PEQB 3UN9A 1SQ0B 3WN4A 2OMVA 1OTMA 3WPGA 4LSXA 5IYXC 4PKIG 4R09A 5AWAA 5GMGA 2Z65A 4CC4C 4FCGA 4P8SA 1OTOA 4CC4A 2RR6A 2JQDA 2RA8A 3OGMB 3O53A 4QC0A 3RJ0A 2R9UA 5CMNA 4CNCA 5GQRK 5B4PA 4MQWX 4XGOA 1O6VA 4H09A 1ZIWA 3OGKB 4ECOA 2IFGA 4C2BB 4R08A 5AWBA 4LSCA 4CILA 3UL9A 3OJAB 4FDWA 1O6SA 3G3AA 1A9NA 3E6JA 4FD0A 2WFHA 1Z7XW 5IJCA 5D3IA 4LI2A 1PGVA 1XWDC 3C6OB 3ZYJA 3UL8A 4U06A 2XWTC 5AWCA 3E3ZA 2OMTA 1KOOA 5IJDA 4AW4A 4R6GA 3ULUA 4XSQA 5B0NA 2V9TB 4ARNA 4PERA 4QBZA 1FQVA 1FT8A 1KOHA 2P1NB 4B8CD 4R6AA 3VQ1A 3W3NA 4NKHA 3PMHG 3A79B 3VQ2A 3W3LA 2WQWA 4R6JA 3WPFA 2XOTA 3ULAA 4LI1A 4QXEA 2JE0A 4Z79A 4LXRA 4Q62A 1FS2A 4ARRA 4PSJA 4BSRA 1IO0A 5IJBA 5GMHA 2CA6A 3ZYOA 3RW6A 4P91A 5AZ5A 4V2CA 3JB9j 2O6SA 2OMUA 1XEUA 2P1MB 3E2JA 1DFJI 4EZGA 1U0ND 4M7EC 4C2AB 4M7EA 1M9LA 1OGQA 3WPIA 2ID5A 2Y5QA 3OGLB 3REZA 1A4YA 1M9SA 1W8AA 4L3FA 4RCWA 2P1PB 4Z8GA 1FO1A 4LSAA 5GS2B 3W3JA 3WPBA 5HZLB 3C6NB 4G8AA 3UL7A 1O6TA 2OMXA 3G04C 2OMYA 4U08A 3ZYIA 3C6PB 4Z61C 1G9UA 1WWLA 4R0AA 3RGXA 1XKUA 4BSUA 1DCEA 4RWTC 3M19A 2Z64A 1XCDA 3RW7A 4R07A 3GOZA 4YEBB 1D0BA 3G3BA 1LTXA 4L3AA 4K17A 3M18A 3P72A 4V2DA 1XECA 2OMWA 1K5DC 2V9SA 2P1OB 4PQ8A 4XOSA
chains in the Genus database with same CATH superfamily
2UZYA 1OOKG 5B0TA 2Q4GW 4R58A 2ASTB 5LFNA 3WPCA 1OTNA 3RFEA 2P1QB 4TZHA 4Z64C 1H6TA 2BEXA 3RIZA 3KJ4A 1YRGA 3BZ5A 4Q3IA 2JE1A 4R6FA 4R5DA 4RCAB 4V2EA 4U7LA 4R5CA 4BV4R 1GWBA 3SB4A 3G06A 4KNGA 5CMPA 3TSRE 4OQTA 1M0ZA 4NKGA 4WYKA 4J4LA 1JL5A 4UFRA 2Z82A 4LSXC 5FTTB 4AY9X 1K5GC 4BSSA 5GS0A 4FHOA 4KXFB 1P9AG 2O6RA 4KT1A 5A5CA 2OMZA 4J0MA 4NZRM 4MN8B 3W3GA 1M10B 4Z94G 2WQVA 1DS9A 2Z66A 4FS7A 3CVRA 2Z7XA 5AWDA 4CP6A 1P8TA 1OZNA 2V70A 3WPEA 4GT6A 3WPDA 4I6JB 4CNMA 3RFSA 1P8VA 2ASSB 2A0ZA 3ZYNA 2FT3A 4LXSA 3W3KA 3WPHA 4HQ1A 3O6NA 3CIYA 3DZEA 1H6UA 2Z81A 2BNHA 2UZXA 4GLPA 2Z63A 4WP6A 3FXIA 2Z62A 4FMZA 2Z7XB 2ELLA 3W3MA 5GMFA 2WQUA 2WQXA 4IM6A 4U09A 3E4GA 4NZTM 4ECNA 3ULVA 3RGZA 3RFJA 5HDHA 4Q3GA 4Y61B 1QYYA 3CIGA 2O6QA 3G39A 3OJAA 4PEQB 3UN9A 1SQ0B 3WN4A 2OMVA 1OTMA 3WPGA 4LSXA 5IYXC 4PKIG 4R09A 5AWAA 5GMGA 2Z65A 4CC4C 4FCGA 4P8SA 1OTOA 4CC4A 2RR6A 2JQDA 2RA8A 3OGMB 3O53A 4QC0A 3RJ0A 2R9UA 5CMNA 4CNCA 5GQRK 5B4PA 4MQWX 4XGOA 1O6VA 4H09A 1ZIWA 3OGKB 4ECOA 2IFGA 4C2BB 4R08A 5AWBA 4LSCA 4CILA 3UL9A 3OJAB 4FDWA 1O6SA 3G3AA 1A9NA 3E6JA 4FD0A 2WFHA 1Z7XW 5IJCA 5D3IA 4LI2A 1PGVA 1XWDC 3C6OB 3ZYJA 3UL8A 4U06A 2XWTC 5AWCA 3E3ZA 2OMTA 1KOOA 5IJDA 4AW4A 4R6GA 3ULUA 4XSQA 5B0NA 2V9TB 4ARNA 4PERA 4QBZA 1FQVA 1FT8A 1KOHA 2P1NB 4B8CD 4R6AA 3VQ1A 3W3NA 4NKHA 3PMHG 3A79B 3VQ2A 3W3LA 2WQWA 4R6JA 3WPFA 2XOTA 3ULAA 4LI1A 4QXEA 2JE0A 4Z79A 4LXRA 4Q62A 1FS2A 4ARRA 4PSJA 4BSRA 1IO0A 5IJBA 5GMHA 2CA6A 3ZYOA 3RW6A 4P91A 5AZ5A 4V2CA 3JB9j 2O6SA 2OMUA 1XEUA 2P1MB 3E2JA 1DFJI 4EZGA 1U0ND 4M7EC 4C2AB 4M7EA 1M9LA 1OGQA 3WPIA 2ID5A 2Y5QA 3OGLB 3REZA 1A4YA 1M9SA 1W8AA 4L3FA 4RCWA 2P1PB 4Z8GA 1FO1A 4LSAA 5GS2B 3W3JA 3WPBA 5HZLB 3C6NB 4G8AA 3UL7A 1O6TA 2OMXA 3G04C 2OMYA 4U08A 3ZYIA 3C6PB 4Z61C 1G9UA 1WWLA 4R0AA 3RGXA 1XKUA 4BSUA 1DCEA 4RWTC 3M19A 2Z64A 1XCDA 3RW7A 4R07A 3GOZA 4YEBB 1D0BA 3G3BA 1LTXA 4L3AA 4K17A 3M18A 3P72A 4V2DA 1XECA 2OMWA 1K5DC 2V9SA 2P1OB 4PQ8A 4XOSA
chains in the Genus database with same CATH topology
2UZYA 1OOKG 5B0TA 2Q4GW 4R58A 2ASTB 5LFNA 3WPCA 1OTNA 3RFEA 2P1QB 4TZHA 4Z64C 1H6TA 2BEXA 3RIZA 3KJ4A 1YRGA 3BZ5A 4Q3IA 2JE1A 4R6FA 4R5DA 4RCAB 4V2EA 4U7LA 4R5CA 4BV4R 1GWBA 3SB4A 3G06A 4KNGA 5CMPA 3TSRE 4OQTA 1M0ZA 4NKGA 4WYKA 4J4LA 1JL5A 4UFRA 2Z82A 4LSXC 5FTTB 4AY9X 1K5GC 4BSSA 5GS0A 4FHOA 4KXFB 1P9AG 2O6RA 4KT1A 5A5CA 2OMZA 4J0MA 4MN8B 3W3GA 1M10B 4Z94G 2WQVA 1DS9A 2Z66A 4FS7A 3CVRA 2Z7XA 5AWDA 4CP6A 1P8TA 1OZNA 2V70A 3WPEA 4GT6A 3WPDA 4I6JB 4CNMA 3RFSA 1P8VA 2ASSB 2A0ZA 3ZYNA 2FT3A 4LXSA 3W3KA 3WPHA 4HQ1A 3O6NA 3CIYA 3DZEA 1H6UA 2Z81A 2BNHA 2UZXA 4GLPA 2Z63A 4WP6A 3FXIA 2Z62A 4FMZA 2Z7XB 2ELLA 3W3MA 5GMFA 2WQUA 2WQXA 4IM6A 4U09A 3E4GA 4ECNA 3ULVA 3RGZA 3RFJA 5HDHA 4Q3GA 4Y61B 1QYYA 3CIGA 2O6QA 3G39A 3OJAA 4PEQB 3UN9A 1SQ0B 3WN4A 2OMVA 1OTMA 3WPGA 4LSXA 5IYXC 4PKIG 4R09A 5AWAA 5GMGA 2Z65A 4CC4C 4FCGA 4P8SA 1OTOA 4CC4A 2RR6A 2JQDA 2RA8A 3OGMB 3O53A 4QC0A 3RJ0A 2R9UA 5CMNA 4CNCA 5GQRK 5B4PA 4MQWX 4XGOA 1O6VA 4H09A 1ZIWA 3OGKB 4ECOA 2IFGA 4C2BB 4R08A 5AWBA 4LSCA 4CILA 3UL9A 3OJAB 4FDWA 1O6SA 3G3AA 1A9NA 3E6JA 4FD0A 2WFHA 1Z7XW 5IJCA 5D3IA 4LI2A 1PGVA 1XWDC 3C6OB 3ZYJA 3UL8A 4U06A 2XWTC 5AWCA 3E3ZA 2OMTA 1KOOA 5IJDA 4AW4A 4R6GA 3ULUA 4XSQA 5B0NA 2V9TB 4ARNA 4PERA 4QBZA 1FQVA 1FT8A 1KOHA 2P1NB 4B8CD 4R6AA 3VQ1A 3W3NA 4NKHA 3PMHG 3A79B 3VQ2A 3W3LA 2WQWA 4R6JA 3WPFA 2XOTA 3ULAA 4LI1A 4QXEA 2JE0A 4Z79A 4LXRA 4Q62A 1FS2A 4ARRA 4PSJA 4BSRA 1IO0A 5IJBA 5GMHA 2CA6A 3ZYOA 3RW6A 4P91A 5AZ5A 4V2CA 3JB9j 2O6SA 2OMUA 1XEUA 2P1MB 3E2JA 1DFJI 4EZGA 1U0ND 4M7EC 4C2AB 4M7EA 1M9LA 1OGQA 3WPIA 2ID5A 2Y5QA 3OGLB 3REZA 1A4YA 1M9SA 1W8AA 4L3FA 4RCWA 2P1PB 4Z8GA 1FO1A 4LSAA 5GS2B 3W3JA 3WPBA 5HZLB 3C6NB 4G8AA 3UL7A 1O6TA 2OMXA 3G04C 2OMYA 4U08A 3ZYIA 3C6PB 4Z61C 1G9UA 1WWLA 4R0AA 3RGXA 1XKUA 4BSUA 1DCEA 4RWTC 3M19A 2Z64A 1XCDA 3RW7A 4R07A 3GOZA 4YEBB 1D0BA 3G3BA 1LTXA 4L3AA 4K17A 3M18A 3P72A 4V2DA 1XECA 2OMWA 1K5DC 2V9SA 2P1OB 4PQ8A 4XOSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UZY A;  1OOK G;  5B0T A;  2Q4G W;  4R58 A;  2AST B;  5LFN A;  3WPC A;  1OTN A;  3RFE A;  2P1Q B;  4TZH A;  4Z64 C;  1H6T A;  2BEX A;  3RIZ A;  3KJ4 A;  1YRG A;  3BZ5 A;  4Q3I A;  2JE1 A;  4R6F A;  4R5D A;  4RCA B;  4V2E A;  4U7L A;  4R5C A;  4BV4 R;  1GWB A;  3SB4 A;  3G06 A;  4KNG A;  5CMP A;  3TSR E;  4OQT A;  1M0Z A;  4NKG A;  4WYK A;  4J4L A;  1JL5 A;  4UFR A;  2Z82 A;  4LSX C;  5FTT B;  4AY9 X;  1K5G C;  4BSS A;  5GS0 A;  4FHO A;  4KXF B;  1P9A G;  2O6R A;  4KT1 A;  5A5C A;  2OMZ A;  4J0M A;  4MN8 B;  3W3G A;  1M10 B;  4Z94 G;  2WQV A;  1DS9 A;  2Z66 A;  4FS7 A;  3CVR A;  2Z7X A;  5AWD A;  4CP6 A;  1P8T A;  1OZN A;  2V70 A;  3WPE A;  4GT6 A;  3WPD A;  4I6J B;  4CNM A;  3RFS A;  1P8V A;  2ASS B;  2A0Z A;  3ZYN A;  2FT3 A;  4LXS A;  3W3K A;  3WPH A;  4HQ1 A;  3O6N A;  3CIY A;  3DZE A;  1H6U A;  2Z81 A;  2BNH A;  2UZX A;  4GLP A;  2Z63 A;  4WP6 A;  3FXI A;  2Z62 A;  4FMZ A;  2Z7X B;  2ELL A;  3W3M A;  5GMF A;  2WQU A;  2WQX A;  4IM6 A;  4U09 A;  3E4G A;  4ECN A;  3ULV A;  3RGZ A;  3RFJ A;  5HDH A;  4Q3G A;  4Y61 B;  1QYY A;  3CIG A;  2O6Q A;  3G39 A;  3OJA A;  4PEQ B;  3UN9 A;  1SQ0 B;  3WN4 A;  2OMV A;  1OTM A;  3WPG A;  4LSX A;  5IYX C;  4PKI G;  4R09 A;  5AWA A;  5GMG A;  2Z65 A;  4CC4 C;  4FCG A;  4P8S A;  1OTO A;  4CC4 A;  2RR6 A;  2JQD A;  2RA8 A;  3OGM B;  3O53 A;  4QC0 A;  3RJ0 A;  2R9U A;  5CMN A;  4CNC A;  5GQR K;  5B4P A;  4MQW X;  4XGO A;  1O6V A;  4H09 A;  1ZIW A;  3OGK B;  4ECO A;  2IFG A;  4C2B B;  4R08 A;  5AWB A;  4LSC A;  4CIL A;  3UL9 A;  3OJA B;  4FDW A;  1O6S A;  3G3A A;  1A9N A;  3E6J A;  4FD0 A;  2WFH A;  1Z7X W;  5IJC A;  5D3I A;  4LI2 A;  1PGV A;  1XWD C;  3C6O B;  3ZYJ A;  3UL8 A;  4U06 A;  2XWT C;  5AWC A;  3E3Z A;  2OMT A;  1KOO A;  5IJD A;  4AW4 A;  4R6G A;  3ULU A;  4XSQ A;  5B0N A;  2V9T B;  4ARN A;  4PER A;  4QBZ A;  1FQV A;  1FT8 A;  1KOH A;  2P1N B;  4B8C D;  4R6A A;  3VQ1 A;  3W3N A;  4NKH A;  3PMH G;  3A79 B;  3VQ2 A;  3W3L A;  2WQW A;  4R6J A;  3WPF A;  2XOT A;  3ULA A;  4LI1 A;  4QXE A;  2JE0 A;  4Z79 A;  4LXR A;  4Q62 A;  1FS2 A;  4ARR A;  4PSJ A;  4BSR A;  1IO0 A;  5IJB A;  5GMH A;  2CA6 A;  3ZYO A;  3RW6 A;  4P91 A;  5AZ5 A;  4V2C A;  3JB9 j;  2O6S A;  2OMU A;  1XEU A;  2P1M B;  3E2J A;  1DFJ I;  4EZG A;  1U0N D;  4M7E C;  4C2A B;  4M7E A;  1M9L A;  1OGQ A;  3WPI A;  2ID5 A;  2Y5Q A;  3OGL B;  3REZ A;  1A4Y A;  1M9S A;  1W8A A;  4L3F A;  4RCW A;  2P1P B;  4Z8G A;  1FO1 A;  4LSA A;  5GS2 B;  3W3J A;  3WPB A;  5HZL B;  3C6N B;  4G8A A;  3UL7 A;  1O6T A;  2OMX A;  3G04 C;  2OMY A;  4U08 A;  3ZYI A;  3C6P B;  4Z61 C;  1G9U A;  1WWL A;  4R0A A;  3RGX A;  1XKU A;  4BSU A;  1DCE A;  4RWT C;  3M19 A;  2Z64 A;  1XCD A;  3RW7 A;  4R07 A;  3GOZ A;  4YEB B;  1D0B A;  3G3B A;  1LTX A;  4L3A A;  4K17 A;  3M18 A;  3P72 A;  4V2D A;  1XEC A;  2OMW A;  1K5D C;  2V9S A;  2P1O B;  4PQ8 A;  4XOS A; 
#chains in the Genus database with same CATH topology
 2UZY A;  1OOK G;  5B0T A;  2Q4G W;  4R58 A;  2AST B;  5LFN A;  3WPC A;  1OTN A;  3RFE A;  2P1Q B;  4TZH A;  4Z64 C;  1H6T A;  2BEX A;  3RIZ A;  3KJ4 A;  1YRG A;  3BZ5 A;  4Q3I A;  2JE1 A;  4R6F A;  4R5D A;  4RCA B;  4V2E A;  4U7L A;  4R5C A;  4BV4 R;  1GWB A;  3SB4 A;  3G06 A;  4KNG A;  5CMP A;  3TSR E;  4OQT A;  1M0Z A;  4NKG A;  4WYK A;  4J4L A;  1JL5 A;  4UFR A;  2Z82 A;  4LSX C;  5FTT B;  4AY9 X;  1K5G C;  4BSS A;  5GS0 A;  4FHO A;  4KXF B;  1P9A G;  2O6R A;  4KT1 A;  5A5C A;  2OMZ A;  4J0M A;  4NZR M;  4MN8 B;  3W3G A;  1M10 B;  4Z94 G;  2WQV A;  1DS9 A;  2Z66 A;  4FS7 A;  3CVR A;  2Z7X A;  5AWD A;  4CP6 A;  1P8T A;  1OZN A;  2V70 A;  3WPE A;  4GT6 A;  3WPD A;  4I6J B;  4CNM A;  3RFS A;  1P8V A;  2ASS B;  2A0Z A;  3ZYN A;  2FT3 A;  4LXS A;  3W3K A;  3WPH A;  4HQ1 A;  3O6N A;  3CIY A;  3DZE A;  1H6U A;  2Z81 A;  2BNH A;  2UZX A;  4GLP A;  2Z63 A;  4WP6 A;  3FXI A;  2Z62 A;  4FMZ A;  2Z7X B;  2ELL A;  3W3M A;  5GMF A;  2WQU A;  2WQX A;  4IM6 A;  4U09 A;  3E4G A;  4NZT M;  4ECN A;  3ULV A;  3RGZ A;  3RFJ A;  5HDH A;  4Q3G A;  4Y61 B;  1QYY A;  3CIG A;  2O6Q A;  3G39 A;  3OJA A;  4PEQ B;  3UN9 A;  1SQ0 B;  3WN4 A;  2OMV A;  1OTM A;  3WPG A;  4LSX A;  5IYX C;  4PKI G;  4R09 A;  5AWA A;  5GMG A;  2Z65 A;  4CC4 C;  4FCG A;  4P8S A;  1OTO A;  4CC4 A;  2RR6 A;  2JQD A;  2RA8 A;  3OGM B;  3O53 A;  4QC0 A;  3RJ0 A;  2R9U A;  5CMN A;  4CNC A;  5GQR K;  5B4P A;  4MQW X;  4XGO A;  1O6V A;  4H09 A;  1ZIW A;  3OGK B;  4ECO A;  2IFG A;  4C2B B;  4R08 A;  5AWB A;  4LSC A;  4CIL A;  3UL9 A;  3OJA B;  4FDW A;  1O6S A;  3G3A A;  1A9N A;  3E6J A;  4FD0 A;  2WFH A;  1Z7X W;  5IJC A;  5D3I A;  4LI2 A;  1PGV A;  1XWD C;  3C6O B;  3ZYJ A;  3UL8 A;  4U06 A;  2XWT C;  5AWC A;  3E3Z A;  2OMT A;  1KOO A;  5IJD A;  4AW4 A;  4R6G A;  3ULU A;  4XSQ A;  5B0N A;  2V9T B;  4ARN A;  4PER A;  4QBZ A;  1FQV A;  1FT8 A;  1KOH A;  2P1N B;  4B8C D;  4R6A A;  3VQ1 A;  3W3N A;  4NKH A;  3PMH G;  3A79 B;  3VQ2 A;  3W3L A;  2WQW A;  4R6J A;  3WPF A;  2XOT A;  3ULA A;  4LI1 A;  4QXE A;  2JE0 A;  4Z79 A;  4LXR A;  4Q62 A;  1FS2 A;  4ARR A;  4PSJ A;  4BSR A;  1IO0 A;  5IJB A;  5GMH A;  2CA6 A;  3ZYO A;  3RW6 A;  4P91 A;  5AZ5 A;  4V2C A;  3JB9 j;  2O6S A;  2OMU A;  1XEU A;  2P1M B;  3E2J A;  1DFJ I;  4EZG A;  1U0N D;  4M7E C;  4C2A B;  4M7E A;  1M9L A;  1OGQ A;  3WPI A;  2ID5 A;  2Y5Q A;  3OGL B;  3REZ A;  1A4Y A;  1M9S A;  1W8A A;  4L3F A;  4RCW A;  2P1P B;  4Z8G A;  1FO1 A;  4LSA A;  5GS2 B;  3W3J A;  3WPB A;  5HZL B;  3C6N B;  4G8A A;  3UL7 A;  1O6T A;  2OMX A;  3G04 C;  2OMY A;  4U08 A;  3ZYI A;  3C6P B;  4Z61 C;  1G9U A;  1WWL A;  4R0A A;  3RGX A;  1XKU A;  4BSU A;  1DCE A;  4RWT C;  3M19 A;  2Z64 A;  1XCD A;  3RW7 A;  4R07 A;  3GOZ A;  4YEB B;  1D0B A;  3G3B A;  1LTX A;  4L3A A;  4K17 A;  3M18 A;  3P72 A;  4V2D A;  1XEC A;  2OMW A;  1K5D C;  2V9S A;  2P1O B;  4PQ8 A;  4XOS A; 
#chains in the Genus database with same CATH homology
 2UZY A;  1OOK G;  5B0T A;  2Q4G W;  4R58 A;  2AST B;  5LFN A;  3WPC A;  1OTN A;  3RFE A;  2P1Q B;  4TZH A;  4Z64 C;  1H6T A;  2BEX A;  3RIZ A;  3KJ4 A;  1YRG A;  3BZ5 A;  4Q3I A;  2JE1 A;  4R6F A;  4R5D A;  4RCA B;  4V2E A;  4U7L A;  4R5C A;  4BV4 R;  1GWB A;  3SB4 A;  3G06 A;  4KNG A;  5CMP A;  3TSR E;  4OQT A;  1M0Z A;  4NKG A;  4WYK A;  4J4L A;  1JL5 A;  4UFR A;  2Z82 A;  4LSX C;  5FTT B;  4AY9 X;  1K5G C;  4BSS A;  5GS0 A;  4FHO A;  4KXF B;  1P9A G;  2O6R A;  4KT1 A;  5A5C A;  2OMZ A;  4J0M A;  4MN8 B;  3W3G A;  1M10 B;  4Z94 G;  2WQV A;  1DS9 A;  2Z66 A;  4FS7 A;  3CVR A;  2Z7X A;  5AWD A;  4CP6 A;  1P8T A;  1OZN A;  2V70 A;  3WPE A;  4GT6 A;  3WPD A;  4I6J B;  4CNM A;  3RFS A;  1P8V A;  2ASS B;  2A0Z A;  3ZYN A;  2FT3 A;  4LXS A;  3W3K A;  3WPH A;  4HQ1 A;  3O6N A;  3CIY A;  3DZE A;  1H6U A;  2Z81 A;  2BNH A;  2UZX A;  4GLP A;  2Z63 A;  4WP6 A;  3FXI A;  2Z62 A;  4FMZ A;  2Z7X B;  2ELL A;  3W3M A;  5GMF A;  2WQU A;  2WQX A;  4IM6 A;  4U09 A;  3E4G A;  4ECN A;  3ULV A;  3RGZ A;  3RFJ A;  5HDH A;  4Q3G A;  4Y61 B;  1QYY A;  3CIG A;  2O6Q A;  3G39 A;  3OJA A;  4PEQ B;  3UN9 A;  1SQ0 B;  3WN4 A;  2OMV A;  1OTM A;  3WPG A;  4LSX A;  5IYX C;  4PKI G;  4R09 A;  5AWA A;  5GMG A;  2Z65 A;  4CC4 C;  4FCG A;  4P8S A;  1OTO A;  4CC4 A;  2RR6 A;  2JQD A;  2RA8 A;  3OGM B;  3O53 A;  4QC0 A;  3RJ0 A;  2R9U A;  5CMN A;  4CNC A;  5GQR K;  5B4P A;  4MQW X;  4XGO A;  1O6V A;  4H09 A;  1ZIW A;  3OGK B;  4ECO A;  2IFG A;  4C2B B;  4R08 A;  5AWB A;  4LSC A;  4CIL A;  3UL9 A;  3OJA B;  4FDW A;  1O6S A;  3G3A A;  1A9N A;  3E6J A;  4FD0 A;  2WFH A;  1Z7X W;  5IJC A;  5D3I A;  4LI2 A;  1PGV A;  1XWD C;  3C6O B;  3ZYJ A;  3UL8 A;  4U06 A;  2XWT C;  5AWC A;  3E3Z A;  2OMT A;  1KOO A;  5IJD A;  4AW4 A;  4R6G A;  3ULU A;  4XSQ A;  5B0N A;  2V9T B;  4ARN A;  4PER A;  4QBZ A;  1FQV A;  1FT8 A;  1KOH A;  2P1N B;  4B8C D;  4R6A A;  3VQ1 A;  3W3N A;  4NKH A;  3PMH G;  3A79 B;  3VQ2 A;  3W3L A;  2WQW A;  4R6J A;  3WPF A;  2XOT A;  3ULA A;  4LI1 A;  4QXE A;  2JE0 A;  4Z79 A;  4LXR A;  4Q62 A;  1FS2 A;  4ARR A;  4PSJ A;  4BSR A;  1IO0 A;  5IJB A;  5GMH A;  2CA6 A;  3ZYO A;  3RW6 A;  4P91 A;  5AZ5 A;  4V2C A;  3JB9 j;  2O6S A;  2OMU A;  1XEU A;  2P1M B;  3E2J A;  1DFJ I;  4EZG A;  1U0N D;  4M7E C;  4C2A B;  4M7E A;  1M9L A;  1OGQ A;  3WPI A;  2ID5 A;  2Y5Q A;  3OGL B;  3REZ A;  1A4Y A;  1M9S A;  1W8A A;  4L3F A;  4RCW A;  2P1P B;  4Z8G A;  1FO1 A;  4LSA A;  5GS2 B;  3W3J A;  3WPB A;  5HZL B;  3C6N B;  4G8A A;  3UL7 A;  1O6T A;  2OMX A;  3G04 C;  2OMY A;  4U08 A;  3ZYI A;  3C6P B;  4Z61 C;  1G9U A;  1WWL A;  4R0A A;  3RGX A;  1XKU A;  4BSU A;  1DCE A;  4RWT C;  3M19 A;  2Z64 A;  1XCD A;  3RW7 A;  4R07 A;  3GOZ A;  4YEB B;  1D0B A;  3G3B A;  1LTX A;  4L3A A;  4K17 A;  3M18 A;  3P72 A;  4V2D A;  1XEC A;  2OMW A;  1K5D C;  2V9S A;  2P1O B;  4PQ8 A;  4XOS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...