1XCDA

Dimeric bovine tissue-extracted decorin, crystal form 1
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
305
structure length
305
Chain Sequence
GPVCPFRCQCHLRVVQCSDLGLEKVPKDLPPDTALLDLQNNKITEIKDGDFKNLKNLHTLILINNKISKISPGAFAPLVKLERLYLSKNQLKELPEKMPKTLQELRVHENEITKVRKSVFNGLNQMIVVELGTNPLKSSGIENGAFQGMKKLSYIRIADTNITTIPQGLPPSLTELHLDGNKITKVDAASLKGLNNLAKLGLSFNSISAVDNGSLANTPHLRELHLNNNKLVKVPGGLADHKYIQVVYLHNNNISAIGSNDFCPPGYNTKKASYSGVSLFSNPVQYWEIQPSTFRCVYVRAAVQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Decorin
publication title Crystal structure of the dimeric protein core of decorin, the archetypal small leucine-rich repeat proteoglycan
pubmed doi rcsb
molecule tags Structural protein
total genus 105
structure length 305
sequence length 305
ec nomenclature
pdb deposition date 2004-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01462 LRRNT Leucine rich repeat N-terminal domain
A PF13855 LRR_8 Leucine rich repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 1xcdA00
2IFGA 2WQXA 1K5GC 1XEUA 2Z7XA 4KNGA 1DFJI 4U08A 4NKHA 1P8TA 5B4PA 4FD0A 3OJAB 1XCDA 4CILA 2BEXA 4R0AA 4Z94G 4U09A 4BV4R 5IJCA 4R58A 4J0MA 4OQTA 4R07A 4L3FA 2OMTA 4FCGA 2OMXA 4C2BB 4HQ1A 2XOTA 1FO1A 1W8AA 3ULVA 2V9SA 4L3AA 3E3ZA 3RGZA 3OGMB 2Q4GW 1XWDC 2OMWA 4K17A 1O6VA 4Z79A 4Y61B 2WFHA 3RGXA 2Z64A 3RFSA 5AWCA 4ECOA 3RW6A 1M9LA 5CMPA 2Z62A 1M0ZA 2V9TB 1SQ0B 4G8AA 1FT8A 3G3AA 1PGVA 4MN8B 5LFNA 4Z64C 2UZYA 4CC4A 2WQVA 2Y5QA 5AWBA 1M9SA 4LI1A 4QBZA 3WN4A 2ASTB 4AW4A 4XOSA 4XGOA 4U06A 4FHOA 4Z8GA 3RFEA 2O6QA 2Z66A 4GLPA 5GMHA 4QXEA 1QYYA 1GWBA 3ZYOA 4QC0A 3E6JA 4Q3GA 1D0BA 1OTOA 1OTNA 4KXFB 4M7EA 3TSRE 4NKGA 4UFRA 4PSJA 5HDHA 4PKIG 3WPHA 3G3BA 4FMZA 3REZA 3DZEA 3ZYJA 3ULUA 5CMNA 3RIZA 5IJDA 4R6AA 3G06A 4GT6A 1DS9A 4R6GA 1OOKG 2P1OB 1JL5A 1YRGA 3W3LA 3ZYNA 4Q3IA 1O6TA 1P8VA 5AZ5A 2RA8A 3A79B 1G9UA 2ASSB 2O6RA 4CNMA 3WPDA 4MQWX 1XECA 2Z81A 3RJ0A 1Z7XW 2P1PB 1OZNA 4CC4C 2BNHA 2CA6A 3OGLB 1KOOA 1ZIWA 3ZYIA 3WPEA 1A9NA 3CIYA 4P91A 2V70A 2UZXA 4RCAB 2FT3A 2OMVA 1XKUA 2Z65A 3OGKB 3JB9j 2JQDA 3WPIA 4FDWA 2Z63A 4B8CD 3FXIA 4LI2A 3C6OB 1M10B 4LSXA 2R9UA 5B0NA 2A0ZA 4R09A 4IM6A 1LTXA 4WYKA 2XWTC 3E4GA 4CNCA 2ID5A 1FQVA 4PERA 1OGQA 3W3MA 1OTMA 4PQ8A 3UN9A 3UL7A 1P9AG 3WPBA 1H6TA 1KOHA 3O53A 4BSSA 4V2EA 3G39A 5B0TA 1IO0A 4R6FA 3RW7A 4CP6A 5HZLB 1A4YA 4I6JB 3W3GA 4V2DA 5GS0A 2O6SA 3C6PB 3BZ5A 3M19A 1U0ND 1DCEA 4C2AB 5AWDA 4Z61C 4R5CA 2WQUA 1O6SA 2JE1A 4R5DA 3G04C 2RR6A 3SB4A 5GS2B 3O6NA 2OMUA 4TZHA 3W3JA 4RWTC 4BSRA 4P8SA 5IJBA 4YEBB 1WWLA 2OMYA 3VQ2A 3E2JA 4EZGA 4AY9X 4RCWA 4LSXC 4Q62A 3UL9A 4LSCA 4J4LA 3CIGA 3VQ1A 3RFJA 5FTTB 2Z7XB 4FS7A 4M7EC 3GOZA 1FS2A 2P1QB 3C6NB 4PEQB 4U7LA 4R6JA 3OJAA 4ARRA 3WPCA 4V2CA 4LSAA 4LXSA 1K5DC 1H6UA 4LXRA 5GQRK 3M18A 2OMZA 2Z82A 3WPGA 3W3KA 4XSQA 4WP6A 2WQWA 5A5CA 2JE0A 3P72A 3PMHG 4KT1A 3ULAA 3UL8A 4BSUA 3KJ4A 3CVRA 4H09A 2P1NB 4ARNA 4R08A 5GMGA 2ELLA 5D3IA 3W3NA 4ECNA 5IYXC 5AWAA 3WPFA 2P1MB 5GMFA
chains in the Genus database with same CATH superfamily
2IFGA 2WQXA 1K5GC 1XEUA 2Z7XA 4KNGA 1DFJI 4U08A 4NKHA 1P8TA 5B4PA 4FD0A 3OJAB 1XCDA 4CILA 2BEXA 4R0AA 4Z94G 4U09A 4BV4R 5IJCA 4R58A 4J0MA 4OQTA 4R07A 4L3FA 2OMTA 4FCGA 2OMXA 4C2BB 4HQ1A 2XOTA 1FO1A 1W8AA 3ULVA 2V9SA 4L3AA 3E3ZA 3RGZA 3OGMB 2Q4GW 1XWDC 2OMWA 4K17A 1O6VA 4Z79A 4Y61B 2WFHA 3RGXA 2Z64A 3RFSA 5AWCA 4ECOA 3RW6A 1M9LA 5CMPA 2Z62A 1M0ZA 2V9TB 1SQ0B 4G8AA 1FT8A 3G3AA 1PGVA 4MN8B 5LFNA 4Z64C 2UZYA 4CC4A 2WQVA 2Y5QA 5AWBA 1M9SA 4LI1A 4QBZA 3WN4A 2ASTB 4AW4A 4XOSA 4XGOA 4U06A 4FHOA 4Z8GA 3RFEA 2O6QA 2Z66A 4GLPA 5GMHA 4QXEA 1QYYA 1GWBA 3ZYOA 4QC0A 3E6JA 4Q3GA 1D0BA 1OTOA 1OTNA 4KXFB 4M7EA 3TSRE 4NKGA 4UFRA 4PSJA 5HDHA 4PKIG 3WPHA 3G3BA 4FMZA 3REZA 3DZEA 3ZYJA 3ULUA 5CMNA 3RIZA 5IJDA 4R6AA 3G06A 4GT6A 1DS9A 4R6GA 1OOKG 2P1OB 1JL5A 1YRGA 3W3LA 3ZYNA 4Q3IA 1O6TA 1P8VA 5AZ5A 2RA8A 3A79B 1G9UA 2ASSB 2O6RA 4CNMA 3WPDA 4MQWX 1XECA 2Z81A 3RJ0A 1Z7XW 2P1PB 1OZNA 4CC4C 2BNHA 2CA6A 3OGLB 1KOOA 1ZIWA 3ZYIA 3WPEA 1A9NA 3CIYA 4P91A 2V70A 2UZXA 4RCAB 2FT3A 2OMVA 1XKUA 2Z65A 3OGKB 3JB9j 2JQDA 3WPIA 4FDWA 2Z63A 4B8CD 3FXIA 4LI2A 3C6OB 1M10B 4LSXA 2R9UA 5B0NA 2A0ZA 4R09A 4IM6A 1LTXA 4WYKA 2XWTC 3E4GA 4CNCA 2ID5A 1FQVA 4PERA 1OGQA 3W3MA 1OTMA 4PQ8A 3UN9A 3UL7A 1P9AG 3WPBA 1H6TA 1KOHA 3O53A 4BSSA 4V2EA 3G39A 5B0TA 1IO0A 4R6FA 3RW7A 4CP6A 5HZLB 1A4YA 4I6JB 3W3GA 4V2DA 5GS0A 2O6SA 3C6PB 3BZ5A 3M19A 1U0ND 1DCEA 4C2AB 5AWDA 4Z61C 4R5CA 2WQUA 1O6SA 2JE1A 4R5DA 3G04C 2RR6A 3SB4A 5GS2B 3O6NA 2OMUA 4TZHA 3W3JA 4NZRM 4RWTC 4BSRA 4P8SA 5IJBA 4YEBB 1WWLA 2OMYA 3VQ2A 3E2JA 4EZGA 4AY9X 4RCWA 4LSXC 4Q62A 3UL9A 4LSCA 4J4LA 3CIGA 3VQ1A 3RFJA 5FTTB 2Z7XB 4FS7A 4M7EC 3GOZA 1FS2A 2P1QB 3C6NB 4PEQB 4U7LA 4R6JA 3OJAA 4ARRA 3WPCA 4V2CA 4LSAA 4LXSA 1K5DC 1H6UA 4LXRA 5GQRK 3M18A 2OMZA 2Z82A 3WPGA 3W3KA 4XSQA 4WP6A 2WQWA 4NZTM 5A5CA 2JE0A 3P72A 3PMHG 4KT1A 3ULAA 3UL8A 4BSUA 3KJ4A 3CVRA 4H09A 2P1NB 4ARNA 4R08A 5GMGA 2ELLA 5D3IA 3W3NA 4ECNA 5IYXC 5AWAA 3WPFA 2P1MB 5GMFA
chains in the Genus database with same CATH topology
2IFGA 2WQXA 1K5GC 1XEUA 2Z7XA 4KNGA 1DFJI 4U08A 4NKHA 1P8TA 5B4PA 4FD0A 3OJAB 1XCDA 4CILA 2BEXA 4R0AA 4Z94G 4U09A 4BV4R 5IJCA 4R58A 4J0MA 4OQTA 4R07A 4L3FA 2OMTA 4FCGA 2OMXA 4C2BB 4HQ1A 2XOTA 1FO1A 1W8AA 3ULVA 2V9SA 4L3AA 3E3ZA 3RGZA 3OGMB 2Q4GW 1XWDC 2OMWA 4K17A 1O6VA 4Z79A 4Y61B 2WFHA 3RGXA 2Z64A 3RFSA 5AWCA 4ECOA 3RW6A 1M9LA 5CMPA 2Z62A 1M0ZA 2V9TB 1SQ0B 4G8AA 1FT8A 3G3AA 1PGVA 4MN8B 5LFNA 4Z64C 2UZYA 4CC4A 2WQVA 2Y5QA 5AWBA 1M9SA 4LI1A 4QBZA 3WN4A 2ASTB 4AW4A 4XOSA 4XGOA 4U06A 4FHOA 4Z8GA 3RFEA 2O6QA 2Z66A 4GLPA 5GMHA 4QXEA 1QYYA 1GWBA 3ZYOA 4QC0A 3E6JA 4Q3GA 1D0BA 1OTOA 1OTNA 4KXFB 4M7EA 3TSRE 4NKGA 4UFRA 4PSJA 5HDHA 4PKIG 3WPHA 3G3BA 4FMZA 3REZA 3DZEA 3ZYJA 3ULUA 5CMNA 3RIZA 5IJDA 4R6AA 3G06A 4GT6A 1DS9A 4R6GA 1OOKG 2P1OB 1JL5A 1YRGA 3W3LA 3ZYNA 4Q3IA 1O6TA 1P8VA 5AZ5A 2RA8A 3A79B 1G9UA 2ASSB 2O6RA 4CNMA 3WPDA 4MQWX 1XECA 2Z81A 3RJ0A 1Z7XW 2P1PB 1OZNA 4CC4C 2BNHA 2CA6A 3OGLB 1KOOA 1ZIWA 3ZYIA 3WPEA 1A9NA 3CIYA 4P91A 2V70A 2UZXA 4RCAB 2FT3A 2OMVA 1XKUA 2Z65A 3OGKB 3JB9j 2JQDA 3WPIA 4FDWA 2Z63A 4B8CD 3FXIA 4LI2A 3C6OB 1M10B 4LSXA 2R9UA 5B0NA 2A0ZA 4R09A 4IM6A 1LTXA 4WYKA 2XWTC 3E4GA 4CNCA 2ID5A 1FQVA 4PERA 1OGQA 3W3MA 1OTMA 4PQ8A 3UN9A 3UL7A 1P9AG 3WPBA 1H6TA 1KOHA 3O53A 4BSSA 4V2EA 3G39A 5B0TA 1IO0A 4R6FA 3RW7A 4CP6A 5HZLB 1A4YA 4I6JB 3W3GA 4V2DA 5GS0A 2O6SA 3C6PB 3BZ5A 3M19A 1U0ND 1DCEA 4C2AB 5AWDA 4Z61C 4R5CA 2WQUA 1O6SA 2JE1A 4R5DA 3G04C 2RR6A 3SB4A 5GS2B 3O6NA 2OMUA 4TZHA 3W3JA 4RWTC 4BSRA 4P8SA 5IJBA 4YEBB 1WWLA 2OMYA 3VQ2A 3E2JA 4EZGA 4AY9X 4RCWA 4LSXC 4Q62A 3UL9A 4LSCA 4J4LA 3CIGA 3VQ1A 3RFJA 5FTTB 2Z7XB 4FS7A 4M7EC 3GOZA 1FS2A 2P1QB 3C6NB 4PEQB 4U7LA 4R6JA 3OJAA 4ARRA 3WPCA 4V2CA 4LSAA 4LXSA 1K5DC 1H6UA 4LXRA 5GQRK 3M18A 2OMZA 2Z82A 3WPGA 3W3KA 4XSQA 4WP6A 2WQWA 5A5CA 2JE0A 3P72A 3PMHG 4KT1A 3ULAA 3UL8A 4BSUA 3KJ4A 3CVRA 4H09A 2P1NB 4ARNA 4R08A 5GMGA 2ELLA 5D3IA 3W3NA 4ECNA 5IYXC 5AWAA 3WPFA 2P1MB 5GMFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IFG A;  2WQX A;  1K5G C;  1XEU A;  2Z7X A;  4KNG A;  1DFJ I;  4U08 A;  4NKH A;  1P8T A;  5B4P A;  4FD0 A;  3OJA B;  1XCD A;  4CIL A;  2BEX A;  4R0A A;  4Z94 G;  4U09 A;  4BV4 R;  5IJC A;  4R58 A;  4J0M A;  4OQT A;  4R07 A;  4L3F A;  2OMT A;  4FCG A;  2OMX A;  4C2B B;  4HQ1 A;  2XOT A;  1FO1 A;  1W8A A;  3ULV A;  2V9S A;  4L3A A;  3E3Z A;  3RGZ A;  3OGM B;  2Q4G W;  1XWD C;  2OMW A;  4K17 A;  1O6V A;  4Z79 A;  4Y61 B;  2WFH A;  3RGX A;  2Z64 A;  3RFS A;  5AWC A;  4ECO A;  3RW6 A;  1M9L A;  5CMP A;  2Z62 A;  1M0Z A;  2V9T B;  1SQ0 B;  4G8A A;  1FT8 A;  3G3A A;  1PGV A;  4MN8 B;  5LFN A;  4Z64 C;  2UZY A;  4CC4 A;  2WQV A;  2Y5Q A;  5AWB A;  1M9S A;  4LI1 A;  4QBZ A;  3WN4 A;  2AST B;  4AW4 A;  4XOS A;  4XGO A;  4U06 A;  4FHO A;  4Z8G A;  3RFE A;  2O6Q A;  2Z66 A;  4GLP A;  5GMH A;  4QXE A;  1QYY A;  1GWB A;  3ZYO A;  4QC0 A;  3E6J A;  4Q3G A;  1D0B A;  1OTO A;  1OTN A;  4KXF B;  4M7E A;  3TSR E;  4NKG A;  4UFR A;  4PSJ A;  5HDH A;  4PKI G;  3WPH A;  3G3B A;  4FMZ A;  3REZ A;  3DZE A;  3ZYJ A;  3ULU A;  5CMN A;  3RIZ A;  5IJD A;  4R6A A;  3G06 A;  4GT6 A;  1DS9 A;  4R6G A;  1OOK G;  2P1O B;  1JL5 A;  1YRG A;  3W3L A;  3ZYN A;  4Q3I A;  1O6T A;  1P8V A;  5AZ5 A;  2RA8 A;  3A79 B;  1G9U A;  2ASS B;  2O6R A;  4CNM A;  3WPD A;  4MQW X;  1XEC A;  2Z81 A;  3RJ0 A;  1Z7X W;  2P1P B;  1OZN A;  4CC4 C;  2BNH A;  2CA6 A;  3OGL B;  1KOO A;  1ZIW A;  3ZYI A;  3WPE A;  1A9N A;  3CIY A;  4P91 A;  2V70 A;  2UZX A;  4RCA B;  2FT3 A;  2OMV A;  1XKU A;  2Z65 A;  3OGK B;  3JB9 j;  2JQD A;  3WPI A;  4FDW A;  2Z63 A;  4B8C D;  3FXI A;  4LI2 A;  3C6O B;  1M10 B;  4LSX A;  2R9U A;  5B0N A;  2A0Z A;  4R09 A;  4IM6 A;  1LTX A;  4WYK A;  2XWT C;  3E4G A;  4CNC A;  2ID5 A;  1FQV A;  4PER A;  1OGQ A;  3W3M A;  1OTM A;  4PQ8 A;  3UN9 A;  3UL7 A;  1P9A G;  3WPB A;  1H6T A;  1KOH A;  3O53 A;  4BSS A;  4V2E A;  3G39 A;  5B0T A;  1IO0 A;  4R6F A;  3RW7 A;  4CP6 A;  5HZL B;  1A4Y A;  4I6J B;  3W3G A;  4V2D A;  5GS0 A;  2O6S A;  3C6P B;  3BZ5 A;  3M19 A;  1U0N D;  1DCE A;  4C2A B;  5AWD A;  4Z61 C;  4R5C A;  2WQU A;  1O6S A;  2JE1 A;  4R5D A;  3G04 C;  2RR6 A;  3SB4 A;  5GS2 B;  3O6N A;  2OMU A;  4TZH A;  3W3J A;  4RWT C;  4BSR A;  4P8S A;  5IJB A;  4YEB B;  1WWL A;  2OMY A;  3VQ2 A;  3E2J A;  4EZG A;  4AY9 X;  4RCW A;  4LSX C;  4Q62 A;  3UL9 A;  4LSC A;  4J4L A;  3CIG A;  3VQ1 A;  3RFJ A;  5FTT B;  2Z7X B;  4FS7 A;  4M7E C;  3GOZ A;  1FS2 A;  2P1Q B;  3C6N B;  4PEQ B;  4U7L A;  4R6J A;  3OJA A;  4ARR A;  3WPC A;  4V2C A;  4LSA A;  4LXS A;  1K5D C;  1H6U A;  4LXR A;  5GQR K;  3M18 A;  2OMZ A;  2Z82 A;  3WPG A;  3W3K A;  4XSQ A;  4WP6 A;  2WQW A;  5A5C A;  2JE0 A;  3P72 A;  3PMH G;  4KT1 A;  3ULA A;  3UL8 A;  4BSU A;  3KJ4 A;  3CVR A;  4H09 A;  2P1N B;  4ARN A;  4R08 A;  5GMG A;  2ELL A;  5D3I A;  3W3N A;  4ECN A;  5IYX C;  5AWA A;  3WPF A;  2P1M B;  5GMF A; 
#chains in the Genus database with same CATH topology
 2IFG A;  2WQX A;  1K5G C;  1XEU A;  2Z7X A;  4KNG A;  1DFJ I;  4U08 A;  4NKH A;  1P8T A;  5B4P A;  4FD0 A;  3OJA B;  1XCD A;  4CIL A;  2BEX A;  4R0A A;  4Z94 G;  4U09 A;  4BV4 R;  5IJC A;  4R58 A;  4J0M A;  4OQT A;  4R07 A;  4L3F A;  2OMT A;  4FCG A;  2OMX A;  4C2B B;  4HQ1 A;  2XOT A;  1FO1 A;  1W8A A;  3ULV A;  2V9S A;  4L3A A;  3E3Z A;  3RGZ A;  3OGM B;  2Q4G W;  1XWD C;  2OMW A;  4K17 A;  1O6V A;  4Z79 A;  4Y61 B;  2WFH A;  3RGX A;  2Z64 A;  3RFS A;  5AWC A;  4ECO A;  3RW6 A;  1M9L A;  5CMP A;  2Z62 A;  1M0Z A;  2V9T B;  1SQ0 B;  4G8A A;  1FT8 A;  3G3A A;  1PGV A;  4MN8 B;  5LFN A;  4Z64 C;  2UZY A;  4CC4 A;  2WQV A;  2Y5Q A;  5AWB A;  1M9S A;  4LI1 A;  4QBZ A;  3WN4 A;  2AST B;  4AW4 A;  4XOS A;  4XGO A;  4U06 A;  4FHO A;  4Z8G A;  3RFE A;  2O6Q A;  2Z66 A;  4GLP A;  5GMH A;  4QXE A;  1QYY A;  1GWB A;  3ZYO A;  4QC0 A;  3E6J A;  4Q3G A;  1D0B A;  1OTO A;  1OTN A;  4KXF B;  4M7E A;  3TSR E;  4NKG A;  4UFR A;  4PSJ A;  5HDH A;  4PKI G;  3WPH A;  3G3B A;  4FMZ A;  3REZ A;  3DZE A;  3ZYJ A;  3ULU A;  5CMN A;  3RIZ A;  5IJD A;  4R6A A;  3G06 A;  4GT6 A;  1DS9 A;  4R6G A;  1OOK G;  2P1O B;  1JL5 A;  1YRG A;  3W3L A;  3ZYN A;  4Q3I A;  1O6T A;  1P8V A;  5AZ5 A;  2RA8 A;  3A79 B;  1G9U A;  2ASS B;  2O6R A;  4CNM A;  3WPD A;  4MQW X;  1XEC A;  2Z81 A;  3RJ0 A;  1Z7X W;  2P1P B;  1OZN A;  4CC4 C;  2BNH A;  2CA6 A;  3OGL B;  1KOO A;  1ZIW A;  3ZYI A;  3WPE A;  1A9N A;  3CIY A;  4P91 A;  2V70 A;  2UZX A;  4RCA B;  2FT3 A;  2OMV A;  1XKU A;  2Z65 A;  3OGK B;  3JB9 j;  2JQD A;  3WPI A;  4FDW A;  2Z63 A;  4B8C D;  3FXI A;  4LI2 A;  3C6O B;  1M10 B;  4LSX A;  2R9U A;  5B0N A;  2A0Z A;  4R09 A;  4IM6 A;  1LTX A;  4WYK A;  2XWT C;  3E4G A;  4CNC A;  2ID5 A;  1FQV A;  4PER A;  1OGQ A;  3W3M A;  1OTM A;  4PQ8 A;  3UN9 A;  3UL7 A;  1P9A G;  3WPB A;  1H6T A;  1KOH A;  3O53 A;  4BSS A;  4V2E A;  3G39 A;  5B0T A;  1IO0 A;  4R6F A;  3RW7 A;  4CP6 A;  5HZL B;  1A4Y A;  4I6J B;  3W3G A;  4V2D A;  5GS0 A;  2O6S A;  3C6P B;  3BZ5 A;  3M19 A;  1U0N D;  1DCE A;  4C2A B;  5AWD A;  4Z61 C;  4R5C A;  2WQU A;  1O6S A;  2JE1 A;  4R5D A;  3G04 C;  2RR6 A;  3SB4 A;  5GS2 B;  3O6N A;  2OMU A;  4TZH A;  3W3J A;  4NZR M;  4RWT C;  4BSR A;  4P8S A;  5IJB A;  4YEB B;  1WWL A;  2OMY A;  3VQ2 A;  3E2J A;  4EZG A;  4AY9 X;  4RCW A;  4LSX C;  4Q62 A;  3UL9 A;  4LSC A;  4J4L A;  3CIG A;  3VQ1 A;  3RFJ A;  5FTT B;  2Z7X B;  4FS7 A;  4M7E C;  3GOZ A;  1FS2 A;  2P1Q B;  3C6N B;  4PEQ B;  4U7L A;  4R6J A;  3OJA A;  4ARR A;  3WPC A;  4V2C A;  4LSA A;  4LXS A;  1K5D C;  1H6U A;  4LXR A;  5GQR K;  3M18 A;  2OMZ A;  2Z82 A;  3WPG A;  3W3K A;  4XSQ A;  4WP6 A;  2WQW A;  4NZT M;  5A5C A;  2JE0 A;  3P72 A;  3PMH G;  4KT1 A;  3ULA A;  3UL8 A;  4BSU A;  3KJ4 A;  3CVR A;  4H09 A;  2P1N B;  4ARN A;  4R08 A;  5GMG A;  2ELL A;  5D3I A;  3W3N A;  4ECN A;  5IYX C;  5AWA A;  3WPF A;  2P1M B;  5GMF A; 
#chains in the Genus database with same CATH homology
 2IFG A;  2WQX A;  1K5G C;  1XEU A;  2Z7X A;  4KNG A;  1DFJ I;  4U08 A;  4NKH A;  1P8T A;  5B4P A;  4FD0 A;  3OJA B;  1XCD A;  4CIL A;  2BEX A;  4R0A A;  4Z94 G;  4U09 A;  4BV4 R;  5IJC A;  4R58 A;  4J0M A;  4OQT A;  4R07 A;  4L3F A;  2OMT A;  4FCG A;  2OMX A;  4C2B B;  4HQ1 A;  2XOT A;  1FO1 A;  1W8A A;  3ULV A;  2V9S A;  4L3A A;  3E3Z A;  3RGZ A;  3OGM B;  2Q4G W;  1XWD C;  2OMW A;  4K17 A;  1O6V A;  4Z79 A;  4Y61 B;  2WFH A;  3RGX A;  2Z64 A;  3RFS A;  5AWC A;  4ECO A;  3RW6 A;  1M9L A;  5CMP A;  2Z62 A;  1M0Z A;  2V9T B;  1SQ0 B;  4G8A A;  1FT8 A;  3G3A A;  1PGV A;  4MN8 B;  5LFN A;  4Z64 C;  2UZY A;  4CC4 A;  2WQV A;  2Y5Q A;  5AWB A;  1M9S A;  4LI1 A;  4QBZ A;  3WN4 A;  2AST B;  4AW4 A;  4XOS A;  4XGO A;  4U06 A;  4FHO A;  4Z8G A;  3RFE A;  2O6Q A;  2Z66 A;  4GLP A;  5GMH A;  4QXE A;  1QYY A;  1GWB A;  3ZYO A;  4QC0 A;  3E6J A;  4Q3G A;  1D0B A;  1OTO A;  1OTN A;  4KXF B;  4M7E A;  3TSR E;  4NKG A;  4UFR A;  4PSJ A;  5HDH A;  4PKI G;  3WPH A;  3G3B A;  4FMZ A;  3REZ A;  3DZE A;  3ZYJ A;  3ULU A;  5CMN A;  3RIZ A;  5IJD A;  4R6A A;  3G06 A;  4GT6 A;  1DS9 A;  4R6G A;  1OOK G;  2P1O B;  1JL5 A;  1YRG A;  3W3L A;  3ZYN A;  4Q3I A;  1O6T A;  1P8V A;  5AZ5 A;  2RA8 A;  3A79 B;  1G9U A;  2ASS B;  2O6R A;  4CNM A;  3WPD A;  4MQW X;  1XEC A;  2Z81 A;  3RJ0 A;  1Z7X W;  2P1P B;  1OZN A;  4CC4 C;  2BNH A;  2CA6 A;  3OGL B;  1KOO A;  1ZIW A;  3ZYI A;  3WPE A;  1A9N A;  3CIY A;  4P91 A;  2V70 A;  2UZX A;  4RCA B;  2FT3 A;  2OMV A;  1XKU A;  2Z65 A;  3OGK B;  3JB9 j;  2JQD A;  3WPI A;  4FDW A;  2Z63 A;  4B8C D;  3FXI A;  4LI2 A;  3C6O B;  1M10 B;  4LSX A;  2R9U A;  5B0N A;  2A0Z A;  4R09 A;  4IM6 A;  1LTX A;  4WYK A;  2XWT C;  3E4G A;  4CNC A;  2ID5 A;  1FQV A;  4PER A;  1OGQ A;  3W3M A;  1OTM A;  4PQ8 A;  3UN9 A;  3UL7 A;  1P9A G;  3WPB A;  1H6T A;  1KOH A;  3O53 A;  4BSS A;  4V2E A;  3G39 A;  5B0T A;  1IO0 A;  4R6F A;  3RW7 A;  4CP6 A;  5HZL B;  1A4Y A;  4I6J B;  3W3G A;  4V2D A;  5GS0 A;  2O6S A;  3C6P B;  3BZ5 A;  3M19 A;  1U0N D;  1DCE A;  4C2A B;  5AWD A;  4Z61 C;  4R5C A;  2WQU A;  1O6S A;  2JE1 A;  4R5D A;  3G04 C;  2RR6 A;  3SB4 A;  5GS2 B;  3O6N A;  2OMU A;  4TZH A;  3W3J A;  4RWT C;  4BSR A;  4P8S A;  5IJB A;  4YEB B;  1WWL A;  2OMY A;  3VQ2 A;  3E2J A;  4EZG A;  4AY9 X;  4RCW A;  4LSX C;  4Q62 A;  3UL9 A;  4LSC A;  4J4L A;  3CIG A;  3VQ1 A;  3RFJ A;  5FTT B;  2Z7X B;  4FS7 A;  4M7E C;  3GOZ A;  1FS2 A;  2P1Q B;  3C6N B;  4PEQ B;  4U7L A;  4R6J A;  3OJA A;  4ARR A;  3WPC A;  4V2C A;  4LSA A;  4LXS A;  1K5D C;  1H6U A;  4LXR A;  5GQR K;  3M18 A;  2OMZ A;  2Z82 A;  3WPG A;  3W3K A;  4XSQ A;  4WP6 A;  2WQW A;  5A5C A;  2JE0 A;  3P72 A;  3PMH G;  4KT1 A;  3ULA A;  3UL8 A;  4BSU A;  3KJ4 A;  3CVR A;  4H09 A;  2P1N B;  4ARN A;  4R08 A;  5GMG A;  2ELL A;  5D3I A;  3W3N A;  4ECN A;  5IYX C;  5AWA A;  3WPF A;  2P1M B;  5GMF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...