1FO1A

Crystal structure of the rna-binding domain of the mrna export factor tap
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
240
structure length
215
Chain Sequence
TIPYGRKYDKAWLLSMIQSKCFTPIEFHYENTRAALKAVNYKILDRENRRISIIIELKPEQVEQLKLIMSKRYDGSQQVLDLKGLRSDPDLVAQNIDVVLNRRSCMAATLRIIEENIPELLSLNLSNNRLYRLDDMSSIVQKAPNLKILNLSGNELKSERELDKIKGLKLEELWLDGNSLCDTFRDQSTYISAIRERFPKLLRLDGHELPPPIAF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NUCLEAR RNA EXPORT FACTOR 1
publication title The structure of the mRNA export factor TAP reveals a cis arrangement of a non-canonical RNP domain and an LRR domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein
total genus 67
structure length 215
sequence length 240
chains with identical sequence B
ec nomenclature
pdb deposition date 2000-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09162 Tap-RNA_bind Tap, RNA-binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1fo1A01
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 1fo1A02
3PIOQ 3BZ5A 3MDFA 1H2VZ 3RW7A 3MUTP 4R6FA 3UD3P 2ASSB 3CTRA 3IRWP 4U08A 1U1KA 1VBZA 1KD1T 2LXUA 4ZKAA 4NKHA 1X4BA 2M70A 3G8TA 2J0SD 4GT6A 1PGVA 3G6ES 4RWTC 3P49B 1X5SA 2RVJA 1P8TA 2MZRA 1VBYA 4F26A 4KNGA 2ID5A 4L3FA 4WKRA 4CNCA 4M7EC 3W3LA 4R08A 1RKJA 3G96A 3OGMB 2DNGA 5CMNA 4CP6A 1H6UA 3O53A 3GOZA 2RQCA 2UZYA 1HD0A 1U2FA 1M5VC 2WQWA 2K8GA 2DNLA 1JJHA 5FJ4A 1UW4A 1X0FA 3RW6A 4Y61B 4Z79A 3TP2A 1WHVA 3I55S 4C2BB 4WCEQ 3RFJA 1BY9A 2DNKA 3G9CA 3MXHP 3CMES 4PSJA 4Q3IA 2P1NB 2LECA 4CH1A 1HD1A 3UN9A 4Z61C 3CF5Q 2RS8A 1SXLA 4FMZA 3WPDA 4CQ1A 1D9AA 3MOJB 2XS5A 1WWLA 3Q2TC 3MURP 2XS7A 3CCLS 2KN4A 2DH7A 2LA6A 4RCWA 1WF1A 4J0MA 2KM8C 2G1DA 2OMTA 1WHWA 2JVRA 2WFHA 2FHOB 3VAFA 1KC8T 2DISA 2HVZA 2V9SA 3Q2SC 5GMGA 4BSUA 3UE2A 4M5DB 3R1LA 1U1LA 3ULAA 4CH0S 1SJ3P 2OJ3A 2MZSA 2KG1A 2BZ2A 2M52A 2DNHA 3U1LA 4XGOA 4LIRA 2F3JA 3G71S 5ITHA 3I56S 2OIHA 2ADCA 2KU7A 5GS2B 2KRBA 1OGQA 4V2DA 3CULA 1Q86T 2XSFA 4A8XA 1H2UX 3G4SS 1WHYA 2Z82A 2YH0A 1YHQS 1WF0A 2X1AA 2N3LA 3SDEB 3VF0B 1ZZFA 4UY8T 1F9FA 1VQMS 2AYEA 2HYIB 2UZXA 4XSQA 4ERDA 5IM0B 2CPJA 4WP6A 3RFEA 4C4WA 4CNMA 1VBXA 2WBRA 3W3KA 1GWBA 2MQLA 3OGLB 3THTA 4EZGA 3MD1A 5GADU 2MGZA 1K73T 1NO8A 1O6TA 5D77A 5GQRK 2BOPA 2CPZA 3S8SA 3G3AA 3VQ1A 1RK8A 2MKSA 1X4CA 1XCDA 2GO9A 4WYKA 2KXHA 1WEYA 1X5PA 3WPHA 2OMUA 5IYXC 2OMVA 3ULHA 5AZ5A 1U1PA 2D9OA 2DB1A 2L9WA 4IO9Q 2LQ5A 2DNMA 2D3OR 3CXCR 2RQ4A 3CIGA 1VQ9S 5DM7Q 4OQTA 3CCES 2M8HA 2MZQA 2VOPA 2VODA 4FHOA 4KXFB 4PEQB 3ZZYA 5DDRC 2CA6A 4QC0A 2CQGA 2Z7XB 3S01A 3WPGA 2MQQA 3CCSS 4J4LA 1YRGA 4M7EA 2F9DA 2ZJRQ 1X5OA 1VQLS 2WQUA 2CPHA 2LCWA 3VAGA 1UAWA 4TLQA 1U6FA 1NJIT 2DHXA 4R09A 1WEXA 4MN8B 1A4YA 1X4DA 5DDOC 5LXYA 1VQ5S 3BS9A 1WWHA 2OTJS 5B0NA 3ZYJA 4QU7A 1M0ZA 4OZ1A 2CPDA 5B4PA 4Q3GA 2HGNA 1DS9A 3SXLA 2CQ0A 3MD3A 1VQ6S 2BEXA 1HL6A 3PIPQ 2LEBA 3REZA 4WFAQ 3C6PB 1JJ4A 2O6QA 5DDQC 1KOHA 2X1GA 2DGXA 2JX2A 5JVHQ 2DIUA 2RR6A 3BO2A 2M4MA 4IM6A 3W3GA 4TU9A 2N7CA 4H09A 2I38A 2AYMA 2DGTA 4LXSA 2MQPA 2RNEA 3OJAA 2O6RA 3N9UC 3MUVP 2PE8A 2JE0A 3C6OB 3NMRA 1K8AT 4LSCA 2MZTA 2Z62A 1DZ5A 2CQ3A 4OZ0A 2DGWA 1FJCA 4J5OA 2DIVA 1U1RA 1VQNS 2EVZA 5LSLA 1WG5A 2Z66A 5LJ5Y 4XOSA 1XEUA 5IJBA 3H2UB 2CQPA 3PMHG 5B0TA 3US5A 3P6YC 2K3KA 1U1MA 5GAGU 1DFJI 1JL5A 3V4MA 1WI8A 3EX7B 3NNCA 4PQ8A 2GHPA 3CMAS 2XB2D 2OMZA 3ULVA 3NS5A 3EGNA 4PRFA 2E44A 2LA4A 2ADBA 4GLPA 4ECNA 2A0ZA 1P9AG 4QU6A 3S6EA 5AWCA 1Q81T 2KFYA 4F02A 1AUDA 4I6JB 2KI2A 2DHSA 5CXTA 2MB0B 2JWNA 2I2YA 2DNZA 1SJQA 1QVGR 2LMIA 1WELA 2XWTC 2OMXA 2XNRA 3R1HA 4TU8A 2OMWA 2X1BA 1A9NA 2KRRA 2Z81A 3J7ZT 2RU3A 3J7YU 3CC2S 3UCZP 1X4HA 5DM6Q 2IFGA 4WF9Q 4AY9X 5D3IA 4CC4C 5HL7Q 2E5IA 2VOOA 2G0CA 3H2VE 1SJFA 2DO4A 4QQBA 4K17A 4UFRA 1VQKS 3MUMP 3EGZA 5H1SV 3A79B 4C2AB 2KXFA 1WG1A 2PEHA 4R5DA 1WEZA 4RU2A 3TO8A 2L41A 1FS2A 1R8PA 4BS2A 1X4EA 2MQMA 3CCUS 1S72S 4R58A 5A5CA 3WPCA 2RRAA 3ULUA 2XNQA 1DBDA 4CILA 1OTMA 4Z64C 2VONA 2MY8A 1VQ4S 3ZYIA 4RCAB 2DNPA 3UWTA 1YI2S 3VAIA 1ZIWA 3B4MA 2LKZA 3ZYOA 1KQSR 3FEYB 2ZJPQ 2HGLA 1K9MT 1U1NA 1OTOA 3CCJS 2FC8A 1QYYA 5DDPC 3CC7S 3K0JA 3UL9A 1M5OC 2MMYA 1YITS 1WHXA 2MKCA 4QPTA 2MY7A 2JVOA 4LI2A 2HZCA 1X4FA 2CQIA 1A7GE 1HA1A 4Y0FA 3BO3A 1ZH5A 1G2EA 4V2CA 3RIZA 1UFWA 2MGZB 2EK6A 2DNYA 2MJNA 4R5CA 3KJ4A 2MKJA 2JQDA 4FD0A 3W3MA 1JJ2R 2ELLA 3LQVA 2MSSA 2KH9A 2OTLS 1FHTA 2O3DA 4U06A 4QXEA 2CQBA 2UP1A 2DGUA 2QFJA 4F25A 4R6GA 1OZNA 2KHCA 3MI7X 3P5TL 3WPIA 4EGLA 3O6NA 2MHNA 3UCUP 1M9SA 4LSXC 5IQQA 3G3BA 3RFSA 1D0BA 3CUNA 4IOCQ 3NS6A 2M8DB 3ZYNA 4IUFA 2OSRA 2MPUA 4TU7A 1OO0B 2CPEA 2R9UA 1U0ND 4TZHA 1XKUA 3E6JA 5HDHA 4YUDA 5HZLB 2Q79A 2CQ2A 1KOOA 2DHGA 2KVIA 1N52B 3UL8A 2P1MB 4LI1A 3HI9A 1K5GC 1R8HA 1VC5A 1IO0A 1FNXH 4YOEA 2DNOA 3NNAA 1LTXA 5CA5A 3OGKB 1YJWS 4R6JA 4AW4A 1FJ7A 3TYTA 2KT5A 4Z94G 5LJ3Y 1OWXA 2J0QD 3VAHA 1VQPS 2ERRA 2CPXA 4Z2XA 2YH1A 1O6VA 1UP1A 5GMHA 1W2BR 4FCGA 1YTYA 1B7FA 3RGZA 4WIIA 2HGMA 3ZZZA 5GAEU 2OSQA 4C0OC 3VAKA 3E3ZA 4BSSA 1FXLA 3WN4A 3DXBA 4ECOA 4NKGA 3CCQS 1X4AA 5AWDA 2N82B 3JB9k 4ARRA 1M5PC 3P72A 1N54B 2A3JA 2RS2A 3RJ0A 3CCVS 1X4GA 5EN1A 2RA8A 2M7SA 4C7QA 3VAMA 2CPYA 1L3KA 3VALA 2CPFA 2DGVA 4YB1P 1URNA 1DCEA 4V19X 3M18A 3CC4S 4LSAA 2DK2A 3LPYA 4LMZA 4FDWA 5HO4A 2AYGA 2E5JA 3OJAB 1O0PA 1YJNS 5LXRA 1Q82T 1G9UA 3THPA 1Z7XW 1NU4A 2MZ1A 5DETA 2X1FA 3E4GA 4CC4A 4LXRA 5GMKa 1P8VA 2AYBA 2Z63A 4QBZA 2LYVA 2KM8B 3DLLQ 1H6TA 2RRBA 2U2FA 2MKKA 1JMTA 1YIJS 5IFMA 1FT8A 3VAJA 3G39A 4WFNQ 1FO1A 2P1QB 2E5GA 5CYJA 3UCGA 2FY1A 1YWXA 1VQ7S 2KYXA 4FXVA 3D2WA 4P6QA 1FQVA 2FT3A 3OW2R 4L3AA 2O6SA 2P1OB 2V70A 2LXIA 2Y5QA 2CJKA 1FJEB 1SQ0B 2M9KA 1W8AA 2G4BA 2DO0A 3E2JA 3JB9j 5LSOA 2MKIA 4FXWA 1XWDC 5GMFA 2MZJA 2KG0A 4ED5A 2DNRA 2RUGA 2J8AA 2DNNA 3R27A 2JRSA 3U1MA 1SJ4P 4PKDB 5JVGQ 3DZEA 3WPBA 2U1AA 3UL7A 4ARNA 2CQDA 2F9JA 3NNHA 4W92B 1VC6A 2N3OA 5CMPA 3CIYA 2ASTB 1D8ZA 2DH8A 2M0GB 3SDEA 4U67Q 2NZ4A 1A9NB 2WQXA 3SB4A 1H6KX 1VC0A 1O6SA 2MQOA 4W90B 3CPWR 2EK1A 5IM0A 2BNHA 4R07A 2QEXS 1WG4A 4P8SA 4P91A 1X5TA 1M9LA 3S7RA 1U1QA 1P27B 2Q4GW 4Q62A 2FPHX 3SMZA 2AD9A 3P3DA 1M1KT 1U6BA 1N8RT 3G8SA 4U7LA 2CQCA 2SXLA 2Z64A 1S79A 5GVQA 4KT1A 2MSTA 4LSXA 1DRZA 2RT3A 4PR6A 2DH9A 2V94A 1M90T 1IQTA 2Z65A 4PERA 5LFNA 1DHMA 3FEXB 5IJCA 1WF2A 4IOAQ 4V2EA 2DGOA 1SJRA 2LEAA 3W3JA 4U09A 2DGQA 2B0GA 3CCRS 2CPIA 3CCMS 1PGZA 1CVJA 2NLWA 1XN9A 4BV4R 1M5KC 1QM9A 4CIOA 3VQ2A 2CQ1A 2MJUA 1M10B 2E5HA 2MXYA 1YJ9S 1OOKG 3TSRE 4BSRA 1P1TA 2MKHA 2QA4S 2JE1A 2YKAA 2CQ4A 2MYFA 3B4DA 1Q7YT 2XS2A 2Z7XA 3CD6S 3W3NA 5AWAA 1ZZNA 1XECA 1OTNA 3BO4A 2XOTA 4G8AA 4WFBQ 5GAHU 3HHNB 4FS7A 4Y00A 3CVRA 2KXNB 5AWBA 3WPFA 4B8CD 3G04C 2YTCA 2MQNA 5MLCV 3FXIA 5BJRA 2DNQA 2M2BA 1U1OA 1QVFR 4R6AA 2M88A 1N88A 2P1PB 5GS0A 3UD4P 2WQVA 1WI6A 1K5DC 2DITA 3M19A 2D9PA 3BEGB 3L3CA 3C6NB 4Z8GA 5IJDA 1OPIA 2FC9A 2YWKA 5D78A 4MQWX 2CQHA 2L08A 1VQ8S 2V9TB 4PKIG 4R0AA 2J76E 3RGXA 2DHAA 4LJMA 1VQOS 1H2TZ 2DGSA 2ZJQQ 4YEBB 2OMYA 3WPEA 4UQTA 1OIAA 4HQ1A 1PO6A 3IWNC 5FTTB 3G06A 1WTBA
chains in the Genus database with same CATH superfamily
1ICEB 3PIOQ 1MN7A 1H2VZ 4JI2F 4FS2A 3M7VA 4U08A 1X31C 2ZWOA 5FD1A 1UL3A 2AZ1A 2RF2B 4PWUA 4YHHF 2BRKA 4LF1A 2GHVC 3G96A 3CO0P 2V0NA 1N5YA 2AJ4A 1RJJA 2RRNA 4IO1A 1X0FA 2E5LJ 4Y61B 2WVCA 2HEKA 3OUYB 4L3KA 2DY1A 3RFJA 2ZOMA 4LF9F 2GW8A 3QJLA 3A8IA 3CCLS 2LA6A 3PY8A 8RUCA 1FEEA 4OI0A 3PO4A 2JVRA 2DISA 2C3OA 2M52A 1VQYA 3CJRA 5M2PA 4LIRA 2R3VA 3FBCA 4O4GA 2Y0BB 1NJYA 1R6YA 3I0SA 3ADAC 2N4DA 3IMQJ 3UDCA 2JL9A 2ZNZA 2I0XA 4PPDA 4IR1A 5CYMB 3WC2A 1R0AB 1JLQA 5IT0A 2VC1A 3PNIA 1O6TA 2BOPA 4PWWA 2MKSA 2H4WB 5HLFB 2BE2B 4TN2A 2D9OA 1JK9B 1U49A 1RT7B 3CXCR 2JLGA 4ECQA 2MEWA 4FHOA 4PEQB 3MPVA 3ZZYA 4LREA 4F67A 1XR5A 5B0FA 1NJIT 1RISA 1A4YA 1T3NA 1VQ5S 3KUEA 4I4BA 1WWHA 1XIQA 4M5JA 2P9CA 3A3PB 1TL7B 3C6PB 1KOHA 2VA2A 4KO0B 3BO2A 2HLUA 2E7XA 2I38A 1NJZA 2VC0A 1HQUB 1NAQA 3C6OB 5E3CA 3TJAA 1S6OA 4NL5A 3JYTA 3W64A 5E41A 1WG5A 3FK4A 4PQ8A 4DUYJ 4Y2KA 3ULVA 3FC9A 4ZVEA 3MWBA 4P52A 4C11A 4RZRA 2JH3A 1ZM9A 3PW4A 2X1BA 2IM3A 3J7ZT 1HBNB 1X4HA 2CNLB 5KFUA 4OHYA 1F9EB 3OTOF 3QIPB 4LF4J 4IH6A 2YNIB 3ILLA 4M94A 3A79B 1J5EJ 6FDRA 2XG8A 1C0TB 1DTQA 1EARA 4USWA 3KWMA 1FS2A 2WONA 1QUVA 2IFXA 1X8DA 2ZC3A 2V9KA 3ZYOA 2ZJPQ 5I3UA 1Y5IB 4JI8F 1U1NA 3W65A 2JEJA 3I32A 5GADI 3CJ0A 3F73A 3MMBB 2F5GA 1KVKA 4UF4A 3MECB 5E33A 3H4BA 3R5BA 2XHCA 3F0NA 4MKYA 3KJ4A 2V8GA 2HFVA 2UP1A 1OZNA 3P5TL 4LF6F 2XLJA 4LBPA 1OMSA 1HQEB 1JLAA 2B51A 2YKNA 2EFGA 4DPOA 4JI3J 4H4OA 1WNEA 2NXJA 2ABYA 3CJ8A 3IO1A 2DNOA 1PSDA 4C8NA 3C15A 1NNDA 1N34F 4WYLA 2ERRA 3CIMA 1IJFB 4JYAJ 1CJUB 1T9VA 2HG4A 4M63A 1FFWB 2PMZD 4GKKJ 4ARRA 3AXMA 3VQTA 3CCVS 4X4QA 3JQJA 3UPFA 1FI4A 3E01B 4MFBA 1G9UA 1YJNS 4HVZA 5GMKa 3EVMA 3KKFA 1HBOB 5IFMA 2FB0A 2HVIA 2IPOB 1UVKA 3KHHA 3SQOP 2FUG9 3GV8B 1XWDC 1NPKA 2IRXA 3W5YA 1UJ6A 2JRSA 2HHTA 2YNHB 3HM9A 5C2GA 3R6LB 1RAFB 1EP4B 1O6SA 3AODA 3RTVA 2BNHA 4C3KA 3OHBA 1S6UA 3BSCA 3SMZA 1HHSA 2IJRA 3KK2B 4GVBA 4QR1A 5DS7A 1N36F 1DRZA 1TR0A 2G2OA 2V94A 3TVYA 2FVRA 2W2PP 3KLGA 3DM2B 3M6VA 1OOKG 5K8PA 5K20B 1T7PA 1VR6A 4I2PB 3CD6S 3CT9A 1KR4A 3OL9A 1MROB 2PMHA 3FXIA 2YNFB 4R6AA 4ZJLA 4CLUA 1JIHA 4Z8GA 1GMWA 1O8BA 5DLGA 1S9FA 1VQOS 3J81Y 1PO6A 3DOLB 3MDFA 4RL1A 1ZM3A 3MR5A 2KVQE 2DRAA 5EWGA 2V34A 2LXUA 4YP3A 5IT4A 4DR4J 1C0UA 5DRKA 4OJHA 3K8VA 1U47A 1KP6A 1SV5A 3GJQB 2HHPA 1TU0B 3HSDA 2UZYA 3DYAB 2WQWA 3DMJA 1Y0HA 3BYRA 1UW4A 3MEEA 3SI8A 4I7FA 2QO3A 1CC8A 1KEKA 2VPXB 3PX4A 4FXDA 2WB4A 1FX2A 5L1JA 2EKYA 4J0MA 1CJTA 2RE1A 1GX5A 2R8GA 1U1LA 1U2RA 5EWEA 1GTHA 3TNVA 1LK7A 3PKMA 4RW6A 5L1IA 1CC7A 3FJ2A 2XSFA 1R89A 4P73A 5HQLA 4RBTA 3KLFA 1ZZFA 1MNEA 2HFOA 4DL7A 3LWLA 4XSQA 1WC5A 3RFEA 1UZHA 2MGZA 4ZLJA 2JEFA 3IAS9 8ATCB 1X4CA 3GR1A 5ETQA 1VHIA 2OMUA 4YB5A 5A2QU 1IKWA 2D3OR 5IT9U 1R3NA 1S9EA 4OQTA 1U2CA 3M8YA 2Z7XB 4NCGB 3OT9A 1JXVA 2F9DA 1JX4A 1H98A 2CPHA 4LIWA 4CO4A 2AGQA 2XSJA 3NP5A 4NASA 3GPAA 1S0OA 5CCLA 2YWEA 4DR1J 4CT9A 1M0ZA 4EFAC 4AE5A 1CJVA 2B4PA 5CCMA 4DV7J 4RR5A 1NPRA 3AD8C 2F8MA 2PE8A 3NMRA 3MMAB 3TW0A 2CQ3A 4JI7F 3K5OA 1RYRA 5LSLA 3PW7A 1N6QA 2BXJA 5KFHA 3PMHG 5D6GA 5B0TA 1F3FA 2GVZB 1T94A 1R0CB 4NI2A 2BOAA 2H5IB 2W01A 5T7LB 3QQCD 5AWCA 4RW8B 4I6JB 2ZH5A 4FBUA 3M2UB 2KO1A 1U25A 2XO6A 3FCVA 4DFPA 1S9GB 4CDIA 1HLWA 4UUWA 4DV2J 3TQ1A 2HIQA 3OFGA 2J9DA 3NOCA 3KLIB 2X3GA 4DSKA 2R7UA 5DQIA 1S76D 1YKWA 2A0FB 2L41A 1LNQA 3GFHA 2RRAA 4Z64C 4QIVA 2FLPA 3FZ2A 1KQSR 1KKHA 3VGUA 3IGNA 3GU0A 2D3ZA 4AL7A 4CZCA 1X4FA 1A7GE 2WOMA 2DNYA 3IWXA 5EDWA 2PA3A 4K59A 3ZZ0A 1IBKF 4KQZA 1FK9B 2MHNA 3PJXA 3HZGA 4B3MF 3K58A 3MM6B 3HLUA 3LGNA 2E7WA 4F36A 1B0TA 2JEIA 1YTYA 2WTFA 3CCZA 4E2FB 2HNZB 3WN4A 3H5UA 1VHFA 2XWXA 2HQCA 4PWDB 5EN1A 2XMTA 4Q2LA 4NXNF 3OUYA 1NHKL 4PXCA 3SCKE 2P6TA 3Q24A 1EB0A 4QYRA 3UDLA 3MPWA 5KFLA 3U02A 3LANA 3WQPA 5A8KB 4UOHA 3G39A 4NCAA 2GHWA 3BKUA 2LXIA 4LFCF 5D4NA 2DO0A 3CMQA 1U24A 2HVEA 3OLAA 4HYKA 4P75A 2YKMB 3PVXA 2VQFJ 2ASTB 3QJJA 2D1CA 1TV6B 2JSXA 4ZP8A 3N5FA 4P8SA 3M9OB 1GMUA 3MM8B 1U6BA 5CYMA 3Q8YA 1G4CA 3EVWA 1R0AA 1OSCA 2C22A 5E3RA 5JUMA 4LSXA 1IQTA 4U9RA 4IG0B 2F7VA 1H38A 4U09A 1BHNA 4X84A 1F5CA 4WK1A 1RT7A 3QZ7A 4N8OA 1M1GA 2UUCF 4NOHA 2MKHA 2Y1IA 1YZ7A 1N48A 1UEKA 4Y00A 2W25A 2YTCA 5I42B 4F4XA 5AXNA 4IQXA 5GS0A 1Y10A 1V3ZA 2C2KB 4RUCA 1TL7A 5T41A 2ZUAA 4L74A 4R0AA 4KO0A 4ZCIA 4HQ1A 3OTEA 4DFJA 1HQUA 3AJDA 3H4DA 1RTHA 4B9TA 5G0RB 1JLGB 3R97A 1X4BA 4L72B 3ELHA 1KVIA 3D4JA 4G65A 3ENAA 3I5AA 3GOZA 2YX1A 4WE1B 1RWUA 3DRPB 3ENWA 3WX8A 2B7BB 3HHEA 3PRDA 2B5JB 1S57A 4F4ZA 4WU2A 4B3SJ 1ZYQA 3THVA 1R0BG 2OFHX 2LECA 2Y3YA 1D9AA 2XLIA 1HBNA 1PBUA 2XULA 4OI1A 3QIPA 1XJWB 4R8UB 2O67A 3QGHA 3CJKB 4R25A 3SZ2A 1AA1B 3BBCA 4ZPWR 1C0TA 1FFGB 3EUNA 2HFSA 1N32F 3JTPA 5D0HA 2RIJA 1Q8LA 3HP6A 1Q86T 3K5NA 2J8SA 4WXWA 4RW7B 3A4TA 2N3LA 2AGOA 4WU3A 3MMBA 3MECA 3VZIA 2WBRA 4KGMA 1T02A 5GADU 4DV1J 3FEZA 3S8SA 1AB8A 1B64A 2DHHA 1LEOA 2CJYB 1U45A 2W9CB 2ZDOA 3HT0A 1HQEA 2R7TA 1HWIA 1S5ZA 4P10A 4IG3B 2HS3A 4KXFB 2VODA 1NLKL 3BH7B 3TJ9A 2E1RA 3Q8PB 1YJRA 2Z8QA 2C3YA 1CJUA 4R09A 3P96A 2IJNA 5F8GA 5DDQC 3TOQA 2RJZA 3E01A 2O6RA 2R9LA 4YB7A 1U7LA 4YY3F 2DIVA 4PXEA 4NLGA 1HBOA 4PG8A 4DL5A 3BN7A 4XOSA 4ES1A 1JLCB 5BYQA 3NWRA 3V4MA 1WI8A 3SV3A 4N41A 2UVVA 2ZUGA 2R8JA 1FTCA 5C2CA 1SC1B 1Q81T 4PG4A 2UUWA 2KI2A 2YNHA 1SJQA 4OYBA 4ID8A 1FKOB 2NSBA 3GJRB 3IR7B 4NLOA 5DM6Q 3HVTB 4AY9X 3KK2A 1EKSA 2DO4A 4K8RA 4ZHRB 4BLGA 3A13A 5KFQA 5MAOA 1JJCB 3DC2A 2ZD1B 1RHJB 3BB5A 1YDLA 1U8SA 2Z2YB 3I31A 3K17A 1I5OB 1R8CA 3AA9A 2KTQA 1S1VB 1RWMB 5LMNF 3BDEA 2ILZA 3GFXA 3IG1A 4Y34A 4I2PA 5DDPC 2COLA 1MROA 2EPIA 1V6HA 3SYZA 2YNFA 3LP0B 2CXEA 3GQCA 2R2RA 3R2CJ 4DV3J 3NCPA 1FRJA 1RWNB 2L3MA 4Q44A 1MMDA 3M2VB 3HPOA 3NGUA 2EWHA 4IUFA 3DOLA 4XK8C 3HULA 1AT1B 1N52B 1D0EA 2JFKA 3W9JA 2QLXA 2Y8WA 1RTIB 4KAIA 3BKTA 4URGA 3VAHA 2YWHA 2L48A 3Q22A 3E2EA 2BW2A 3RGZA 4DR2F 3TRGA 3CCQS 3JB9k 4X62F 3L9ZA 2FDNA 3GYGA 3DYAA 3PYGA 2XTJP 1UVIA 4DQSA 3EZ5A 3DNCA 1V3SA 4F3QA 3U1NA 1Z7XW 3AJ1A 4G1QB 1ULRA 3DGVA 3QZ8A 4RW9B 4FF1A 3MEDB 4R5PB 5CZVA 1TKZA 1RSCA 4RNHA 3D2WA 4C98A 3OW2R 2V70A 2AV5A 1FJEB 4N56A 4HH0A 2MKIA 1TAUA 1R31A 2FJAB 3R27A 5M2RA 2LU1A 2NCKL 4F50A 2XY5A 2LQ9A 2QEXS 1N0VC 1NDPA 3V6JA 1HI1A 4UTGA 3IC1A 1BWEA 4PQAA 3QWUA 5KFKA 3FEXB 1AZSB 2G1HA 4I69A 1M5KC 3VQ2A 2MXYA 1VCTA 2QL5B 2NXNA 3IBCB 2Z7XA 2CNOB 1CJKA 4NCGA 4Y2CA 1NJWA 4G8AA 2UU9F 3VZHA 4OFZA 4ZS6A 3D6FB 2Y0SD 2B3TB 1N88A 3C6UB 3JSRA 2IIHA 4HKQA 3BEGB 4MK8A 1NK7A 3GSIA 3RGIA 3C2PA 1WJ9A 4DLGA 3J81U 3PW5A 2PEBA 3GE9A 4RWTC 1PC4A 4DV5F 1K1QA 2GVZA 4CP6A 1MN9A 3D3CJ 4LVNP 4CLSA 1IBLJ 5T7LA 4H54A 5DLFA 1F2GA 4RW8A 1MSWD 1PAEX 4TY9A 2LDIA 3M2UA 3V5RA 1BY9A 1IJEB 4Z61C 1S9GA 4A47A 4OYPA 3DN9A 1WWLA 1FERA 5FDLB 4NZTM 2FZKB 2KM8C 4ILLA 2OMTA 2AX1A 4JI1F 1UETA 3KK3B 3UE2A 3I82A 1FRKA 1VDHA 2XZTB 2H48B 4CYUB 5KG7A 1WHYA 1RU1A 1C4AA 4FKXA 3O2IA 2HHWA 4A8KA 5D8HB 2QTWA 5F9NA 2RDIA 2UZXA 1VLYA 3CDEA 2C28A 1NO8A 5D77A 3MHYA 3WIVA 4C9DA 3VV2B 1DARA 3BSNA 1C1CB 1FK9A 3IXQA 4KKOB 3CCES 3V2UC 4KRWA 2ZKTA 3MM6A 2AQ4A 3Q8RB 2MQQA 3WBZA 4GC6A 4ECRA 3HDSA 1RWVB 3OV7A 1S1TB 4MN8B 1RTDB 2HNZA 3FBFA 3KHRA 5BYSA 4JV1A 4ZPDA 4QR0A 4PWDA 5HBMB 1MG7A 4WFAQ 3N28A 2NSCA 2M4MA 3M8PB 2B9XA 2H4YB 2P2CB 3V81B 1UPPA 5CAAA 4DWIA 1K8AT 5T14A 4OHVA 4OZ0A 4L73A 5A8KA 4ECXA 2DD8S 4ZLNA 3IS9B 1WKKA 1KSPA 1LXNA 1U1MA 1DFJI 3EX7B 3CNQP 4ER8A 3EGWB 4ZVTB 4KT0C 2ZHAA 4DR5J 1FVQA 2IC3B 2YKMA 2LMIA 2AHOB 5LMUJ 1TV6A 2KRRA 2BJ7A 3PR5B 2OGUA 4MMOA 2E5IA 2G0CA 2XMKA 4OJGA 3IP0A 2R8IA 4CNYA 4IG0A 1Z2ZA 2EFNA 5F41A 4PUOB 4IRCA 4I67A 2ZZNA 3HSJA 4RBVA 3HCXA 2VIHA 1R8PA 3NLCA 2V8HA 4O3SA 1R8AA 3GIMA 4OMFG 3KG4A 3BGOP 4EYIB 3NAIA 1ZIWA 4QWAA 5CYQB 1OTOA 1FVSA 4TYAA 1NEEA 2JC1A 3OL8A 2XWYA 1TELA 5I42A 4NLYA 1F1BB 3MMCA 1T03B 4QWEA 3LQVA 4XAKA 2KT3A 3AH6A 3G3BA 2ACYA 2C2RA 4FPIA 4HI2A 1TKDA 3WDOA 1EKRA 3BR8A 1R8HA 5G0RA 1IBCB 1JLGA 3AA8A 3D6MB 5RUBA 4C0OC 2W24A 4DF8A 2OP5A 2VPYB 2YX4A 5F9LA 4WE1A 3DRPA 3N01A 5I3QA 4HACB 4V19X 2Y1RI 4NZRM 2DK2A 4DFKA 2B5JA 2I5JB 4XPEA 4B9VA 4HI1A 2QMXA 3HK2A 2OI2A 1RYSA 1TZ0A 5E3PA 4JI2J 3A3OB 2E5GA 5CYJA 4R8UA 4ES3A 3CJKA 1VLOA 2NR0A 4YHHJ 2MZJA 3NXZA 1S1XA 1SJ1A 5B0AA 2YY3A 3WPBA 3B8HA 2F9JA 5FIIA 2E1AA 4KTQA 3CIYA 1D8ZA 2NZCA 4NA3A 3OTDA 4IOBA 4FNHA 2LQJA 1DLOB 4LF9J 3P3DA 3ZTRA 2HWIA 2ASJA 4PG6A 2D3O1 3GG0A 3BREA 2DPIA 4PR6A 2IHR1 1WF2A 1O51A 2W8KA 1TL1A 2W9CA 1XMQF 3X1LB 4IG3A 2BMBA 1NSAA 2MHEA 2YKAA 4QWBA 4M5LA 5CH7B 4LR8A 3WPFA 4YDDB 2WVEA 2QA1A 5L1LA 1RI7A 1PCAA 2HHQA 2DRBA 1OPIA 3RGXA 3NCQA 2H3EB 3MM5B 3D68A 3OSNA 4J9MA 3MPDA 3UVJB 3W61A 4HEA9 5EHHA 2J0SD 4F8RA 1Q8BA 3G6ES 4F26A 1F9HA 2GAGC 1RKJA 4K2XA 5DZ6A 2ZBPA 1V5VA 5ETKA 3T3FA 1DAXA 3VGVA 3CEDA 1CSJA 4CWBA 2Y8YA 2EC2A 3SV4A 3GIIA 3R8YA 1FKOA 4P72A 2RS8A 2G9OA 3V4IB 3J7AN 4WP8A 2DH7A 2IA0A 3BBFA 2WSCC 3OQ2A 3TEHB 1RQ0A 3MZIA 4BSUA 3ULAA 1RDRA 2ZD1A 2LQBA 2FVQA 5ITHA 4YR0A 3FBEA 5GS2B 1LWXA 4B17A 1S1VA 4F4YA 4PQUB 3VF0B 2ZFHA 4A48A 3QRQA 1VIXA 1HR0F 4RJVA 3OGLB 3THTA 3OTOJ 1RB0A 3LP0A 3F41A 3I4PA 3FVYA 2XI2A 2BJDA 4R0EA 1RK8A 4OHXA 4Y3CA 3M2VA 3ZTOA 3DOKB 5KFNA 1SUQA 1RTIA 4DPUA 4K4ZA 3TX0A 1X5OA 2BANB 1UAWA 4TLQA 4JI8J 4DXLA 2XCAA 5EUHA 2EFVA 2BA9A 4Q3GA 1VQSA 3SXLA 2FVPA 2DKOB 4TXSA 2E7VA 1S77D 2N7CA 1X0PA 2WZ1A 4LF6J 4G1QA 1JXEA 4F2RA 4RW9A 3MCNA 3MEDA 4R5PA 1BGXT 2H65B 1XEUA 2ILYA 3K59A 2ZEJA 1WORA 1WSRA 1N34J 1SL1A 3AFGA 4LBIA 2J6UA 4DSLA 4OHWA 3T1HF 2RHQB 2GGPB 2JWNA 3QYYA 3D1HA 1EQ0A 3TZYA 4TU8A 4DV0J 3EXYA 4U7CA 3CC2S 2F65A 2LEPA 4CO0A 4CO3A 1C1BB 5A0YB 2WAQD 1ZTWA 2GMJA 1N4LA 3N79A 1S97A 4ZIVA 4K17A 1VQKS 3MUMP 3K5LA 5H1SV 1AZSA 4CI0B 1WG1A 1PYSB 1WEZA 3IR6B 5KFIA 1RAGB 2KJVA 2ACMA 2CZ9A 2BJ9A 4UT4A 1ZPWX 1Q8KA 4C8MA 2QLBB 4ZVSB 2B6AB 3WHIA 1UVMA 3OXFA 4NLTA 1YITS 4ICLB 3IGVA 3AD9C 3ISND 2CQIA 4Y0FA 4EBCA 3C6UA 2XZWA 5KTQA 4K7QA 1N36J 4B9UA 2ZH6A 3O6NA 1SC4B 4L3NA 3HD2A 2Q79A 3BBBA 3UL8A 5JMNA 1VC5A 1FNXH 2V8DA 3EM1A 1M1HA 1ACMB 1OWXA 2AEFA 1R7IA 4GRSA 2HRUA 4I2QB 2A6MA 2FZGB 4W4MA 5F8JA 1RGVA 2C1EB 3PX6A 2M7SA 3LA0A 1LXJA 4M5NA 3IFEA 3R5JB 3PW2A 5LXRA 3JQMA 2AW0A 4LXRA 2C2OB 4HT7A 3H20A 3DLLQ 5GAGI 1H6TA 1FDBA 2RRBA 1N5SA 3GSDA 5CHCB 1RU2A 5FDLA 1YRUA 2O01C 2ATCB 3TX8A 2EBGA 2O6SA 1W8AA 3KK3A 3GV5B 3CSKA 1U26A 3FNNA 2NQPA 2RUGA 3VWSA 3W7BA 3UL7A 4CYUA 2HQGA 2BV3A 5CMPA 4O4RA 2FQQB 1NB2A 2M0GB 2AGPA 4X64F 1VC0A 3Q83A 1WG4A 3LPEA 5HMZA 2AJFE 2XY7A 4K50A 1DHMA 2YBVA 3EDRB 4IR9A 2VBXA 2ZZMA 3KOAA 1T9XA 2B0GA 1C1CA 4ZA1A 3GIKA 2W2NP 5HVFA 4U8VA 1NB7A 1YJ9S 2XI3A 1NJXA 4X66F 4KPYA 3OVBA 1OY9A 3DGPA 5KFOA 1S1TA 5DJBA 1RTDA 4F4AA 3F56A 1J5OB 3W2WB 2P1PB 4DFMA 4C3LA 1EETB 5KFRA 4HHHA 5HBMA 3T5KA 2V9TB 3M8PA 3V81A 4BDPA 2IA6A 2IYIA 2KFNA 3R5GA 1X9MA 4O0IA 1KQFB 2CZ4A 4F7VA 3M1VB 2N4CA 4OHZA 1U1KA 1KD1T 1NUEA 4NKHA 2R4FA 1PYOB 3IS9A 3BQ1A 1PILA 1M5VC 2K8GA 4TYBA 5K5MA 2WVDA 4Z79A 4IDKB 2B56A 2IC3A 1NK0A 2A10A 1RHUB 2DNKA 3Q8VA 4KBIA 4LFAF 3A8JA 1R6VA 2Q43A 1LOUA 3HFZB 3M8QA 1Q5YA 4XDCA 3UFCX 3TZWA 5JXSA 2XMMA 3PEJA 4M5HA 4PUOA 4CH0S 2HWHA 1XNRF 1HBUB 4XGOA 3I56S 3HHLB 1P1LA 4P71A 3M30B 5HP1B 4ZVUB 2ZBQA 2DT9A 2QE5A 5CYQA 4EWTA 3DDIA 3OR2B 4CT8A 5K14A 4L76A 2RD5C 2HVHA 1T03A 1RT5A 2KXHA 1WEYA 4OYAA 5ETVA 2E29A 1XQIA 2F40A 4NLUA 2DNMA 5KT5A 2UV8G 4QC0A 2J9CA 1SL2A 1RBAA 4NYZA 3U7JA 4M7EA 1OYEA 1FDDA 3MEKA 2WSFC 4F4WA 2UUAF 1RP5A 4ID5A 4HACA 3ILOA 1KVJA 1IBKJ 2NREA 2CG4A 5EX3A 4B3TF 2OPQA 5KT6A 1SH0A 1VISA 4B3MJ 3PHEA 3N5BA 3GIRA 3TA2A 5ADZA 8AT1B 4M5KA 9RUBA 3SBMA 1JL5A 4LQ3A 2IRYA 2DXEA 2ASYA 2GA7A 3H98A 3EGNA 5IXUA 2E44A 2LA4A 4S0MA 1BC6A 2A0ZA 4QU6A 3LP2B 2VDHA 2QLFB 2I2YA 2EFQA 5KFYA 2XWTC 2LXFA 3VGTA 4NXNJ 1RT3B 3TUPA 4UQGA 5F8HA 4NLPA 2FGCA 2XGPA 1DLOA 2HHSA 2MLYA 2XHWA 2CJQA 2ZBRA 1SJFA 3NCRA 4LFCJ 4DLEA 1DBDA 2VONA 2JJ4D 3ZYIA 1LFWA 3GJTB 2KB2A 3IAM9 1QYYA 3HKWA 5J2MB 2HZCA 3RIZA 1RHRB 4C8ZA 4K4TA 1LKZA 2CIMA 1JJ2R 4OIXA 4LSXC 3MM5A 5HJXA 3TEGA 1FEHA 2HQ3A 4ILRA 5FLXY 4TY8A 2KVIA 2P1MB 1RBOB 3CE8A 2G13A 4WP3A 2LU2A 1LTXA 5HROA 2UUCJ 2JLEA 4WIIA 5CD4H 1BQMB 2HS4A 2F63A 3OLBA 1Y3KA 2HBRB 1KLMA 1N54B 3VGSA 1SBRA 3RJ0A 3C6TB 3U27A 4J9LA 2AEJA 4PABA 5ETTA 4ZLLA 1GH8A 1RCXB 4DPWA 2F8HA 3QGGA 1HQ2A 1KQKA 3V4IA 1UJ4A 2P1QB 4Y28C 2BACA 4YFUA 1FQVA 1TL3B 3H2LA 4ED3A 3D0IE 1N56A 4KH0B 1A0OB 3T5JA 1VC6A 2N3OA 3TAPA 3HSZA 2ZM6F 3QBCA 3SB4A 3JAMY 3BH6B 1CS4B 1O5JA 2JHEA 1X5TA 3A8KA 2RMLA 1GEHA 5GVQA 3KG1A 2W7PA 2JOQA 2XMVA 1M0SA 1NZAA 4FPRA 3DRRA 3CCMS 3PYEA 4QW9A 2YQ1A 4OV1A 3DOKA 2GVDB 2PFFB 1RT4B 2CQ4A 1RTZA 2HK2A 2CAJA 2E1MC 3OL7A 3CVRA 3W62A 2BANA 5E3AA 1OQ3A 5MLCV 2ZVSA 1OY6A 1B4SA 1U48A 3BGFA 3FKBA 1WD6A 5SZTA 2R7QA 1U02A 3OFFA 1PBAA 4DUYF 2DGSA 4J9UE 4RWWA 4UQTA 2BKPA 1O6VA 1REGX 4HHUA 4ECYA 1EZZB 4U7UD 1ELOA 5E7OB 4B9SA 3P49B 3R5CA 1X5SA 1ZOTA 3OBIA 2MZRA 1NH8A 3EICA 1VIOA 1YRTA 4UZBA 5CMNA 1CQNA 1Y7PA 3QFHA 3QMQA 3DLGA 1SIWB 2EXUA 4PAAA 1P9YA 2R8HA 2QLJB 2RKIA 1HI8A 2AZ3A 2M3DA 3CF5Q 1VK3A 3MOJB 4B9NA 1C1BA 4AL6A 5A0YA 1IR2A 1WOOA 4ANEA 3IN5A 3PTWA 4NPOA 1EX8A 1WHWA 1KC8T 3M8RA 3NOGA 3TAQA 4P7TA 6FD1A 3OVAA 2KRBA 5DO2A 1RADB 4EYHB 2X1AA 3AOAA 4UY8T 2IMWP 2Z56B 4P2SA 4ICLA 4NCBA 1VBXA 5L8RC 3M8ZA 3W2VA 5C24B 5IYXC 2V6AA 2LQ5A 3BGLA 2I8EA 1DQAA 3GFZA 3CIGA 3T5HA 3BGRA 4BWJA 2P6SA 2ROGA 3AOBA 5LMNJ 5D0RA 2YKQA 3F44A 2HS0A 1U6FA 4I2QA 2DHXA 1SKWA 4P7VA 1SC6A 5DDOC 5LXYA 2P9EA 3FCWA 2PI5A 4EK2A 2HGNA 1HL6A 2XLKA 2RR6A 2WRMA 2ZBCA 2MQPA 4NZ6A 2RNEA 3N9UC 4X4RA 2Z62A 3FQLA 2DGWA 1D3WA 5D0EA 1VQNS 2HZAA 3T1AA 4X4PA 2OMLA 5GAGU 3ZZPA 3RBDA 4K0KF 3G87A 4F3OA 4RLEA 2WSEC 3L7UA 4OYIA 1Y11A 1L3TA 3CDUA 3O3LA 4DR2J 3MR2A 4F02A 4X62J 4ANDA 4DU8A 3QNWB 1TVRB 2IM2A 2XY6A 3JQKA 4OV6A 1X9SA 4DHVA 3QRRA 4HT5A 5HL7Q 5H9FJ 1URRA 2K1RB 4NMLA 4N77A 4A8FA 3S1TA 4LFBJ 5HI7A 2DR8A 4DV6F 1IQZA 1P8GA 2MY8A 2HPUA 2DNPA 4CLPA 1YI2S 3VAIA 3RAMA 4KHPF 1OQ6A 2HHUA 2ZHBA 2FC8A 3EZOA 4U95A 4OI2A 3K0JA 1HMVB 3TAMB 2MY7A 2J9DE 4EO8A 4XTTA 1FA0A 1J5OA 3W2WA 4ZPCA 2VDIA 3BM7A 4DR4F 2ZE2B 3RU0A 1EETA 3DLEB 2J6TA 5ETLA 4AYBD 5IQQA 1H7WA 2HSEB 1UMJA 1Q0NA 4TU7A 2K7JA 1OO0B 2R9UA 4IYQA 3KHGA 5L39A 2HNYB 4ATNA 3M1VA 1T95A 3CB4A 1JLEB 5LJ3Y 1RKIA 3B78A 4EEYA 2J0QD 2VKZG 4F0MA 3J81j 2CPXA 3TVZA 2EEYA 1B7FA 2FD2A 2OSQA 3FSYA 2W7AA 2UU9J 1S0NA 3QRPA 2CPYA 1XR7A 2ALYB 3UN5A 3KNGA 2G0JA 1RE1B 3CC4S 3PYDA 4FDWA 4IDKA 1CBKA 1P8VA 2IBKA 2U2FA 4RNFA 2WW4A 1YBTA 3IRXB 1I94F 1YWXA 1VQ7S 4WPAA 2BM0A 2G4BA 1I1GA 4DV5J 4NA2A 1HNVB 3SCIE 3SCLE 2YNGB 2CADA 3HHLA 2Z2ZA 3M30A 5E5NA 5HP1A 4K4UA 3JSBA 1A9NB 2WB1D 1RXOB 3HHKA 4ED2A 1N8RT 3OR2A 1I6JA 5F3ZA 2P8IA 3DRYA 2MSTA 3RJMB 1CULA 5LFNA 4IOAQ 2CYYA 2DGOA 1KBRA 4ED7A 2BABA 4DR1F 4JI1J 7FD1A 5IOLA 3FSXA 1S48A 4DV7F 3TSRE 4U7UK 4MYTA 3SFGA 1WC1A 2OD4A 3GLJA 4FS7A 1NKCA 1HIYA 4MT1A 4O3OA 2H1YA 3G04C 2DNQA 1U1OA 4IKAA 2FJEB 3H7HB 5SUHA 3RUBL 2NXEA 3RG6A 4C0BA 4MQWX 4J9QA 2DHAA 4QIWD 2ZJQQ 2XO7A 2FJXA 1WTBA 1K47A 1WC4A 3RW7A 4M8LA 3UD3P 3GFYA 2M70A 2I9SA 2UXBF 5ETOA 1SB6A 4JI0F 1E6VB 4YB6A 4DV2F 3ZZTA 2QN6B 1RTJB 2HURA 4YS2A 1NHUA 5D4OA 3W5XA 4CLTA 3LP2A 3TP2A 1ZS6A 2GCFA 4C2BB 1TK8A 3K5MA 2P1NB 2BBEA 3T19A 3M2RB 3QT5A 1U0SA 2HAFA 4A4JA 2VD3A 1RAEB 4CTAB 2IM1A 2BZ2A 1WC0A 4X4OA 2B4UA 2CJ9A 3C8YA 1OGQA 3D6TB 2CRLA 3G4SS 1YLXA 4TNOA 3FFIB 3MM7A 2Z57B 5THWA 5J2MA 4GO7X 3W3KA 3HZEA 4HDGA 3NGDA 1S49A 1WOSA 2AKWB 1XK8A 4WTOB 2Y1LB 2OMVA 1U1PA 4CLYA 3IWLA 1AXQA 2RQ4A 4WP9A 2MZQA 2FJBB 5KFPA 2CA6A 1T9TA 3LAMA 4G3IA 3CCSS 1YRGA 4IFVA 4YR3A 3TA0A 1WC3A 4CH7A 4D3GA 4Y2MA 4OZLA 1BQMA 5AXKA 2ZHOA 4X2BA 2GC8A 3QO9B 3ITHB 1JJ4A 2DGXA 1RABB 4IM6A 3W3GA 1HNWF 3MAQA 3J7Z5 3CJ5A 3H8YA 2I1RA 4FYXB 4J5OA 3OR1B 1Y3JA 2VHGA 4EO6A 2FHKA 2Z66A 1Q7LB 3FZBA 2K3KA 3DU5A 4LRAA 1GX6A 2CJXB 1BD6A 2V2ZA 4PRFA 2IMOA 4RU9A 3S6EA 2IVMA 2AJ1A 2D69A 2OMXA 2PIIA 4M5MA 4DDFA 2NS1B 2XMAA 1CS4A 2IFGA 1YSJA 3JS9A 4DQRA 2FGOA 3H2VE 4QQBA 2CFXA 2O66A 3K8WA 4DQPA 4UFRA 2BDPA 3MTKA 2ZH9A 3HVWA 2EI5A 4LRCA 1UTAA 3RR8A 2GVDA 1HKAA 1AYEA 1HWLA 1RT1B 1K9MT 5GMDA 4U6PA 1M5OC 3GTYX 4QPTA 4K4WA 2CUYA 2ZH1A 2JQDA 1Z2LA 2KH9A 2MQ8A 3NGSA 1B0PA 3MI7X 4EGLA 2BRLA 1NPPA 4P2MA 4DS5A 1D0BA 3CUNA 1HNXF 2NUUG 1ZBTA 2MPUA 2CPEA 4TZHA 5HZLB 2CQ2A 1FX4A 3HI9A 1K5GC 1YJWS 4G1PA 4R6JA 5L38A 1FJ7A 1S1UB 2LLZA 2GIQA 4FCGA 5H9EK 4UW2A 3P72A 1SQEA 3DRSB 4LSAA 2BEFA 4LMZA 1FJGF 2AYGA 3NL0A 3OJAB 2IRUA 4A8MP 2AYBA 3PKYA 3QAUA 3VAJA 4WFNQ 3EZUA 2B9EA 1YBUA 4RWXA 3SIPB 2HQFA 1IKYA 3OFEA 2CJKA 5EX0A 1M5HA 3QWPA 2KG0A 1VRTB 4ZJOA 4DR3F 4PKDB 3SFUA 1WKJA 1WDDA 3BQ2A 2JZ5A 2QV6A 2BQ3A 1VJQA 4EZ6A 1YK9A 4OL8A 2ZZTA 2FPHX 3I4HX 1IBMF 4ED1A 5KFVA 3JAMU 1JKHB 2Z65A 3WPDA 4FYWB 2I6WA 4DPYA 1VS3A 3PRBA 5IC4B 2QX0A 1Z1ZA 5C24A 3W3JA 4F0HA 1NM2A 1T8EA 4ZPVR 3B82A 4BV4R 4U8YA 1D9FA 2R7OA 4CM0A 4AQYF 2MYFA 2YQ0A 5AWAA 1XECA 3BO4A 1IKVA 3BYPA 2XM3A 5A8WA 2HHHF 2AWZA 2QYCA 2NYIA 2PGCA 2FYXA 4C8KA 2DITA 4QWDA 2EG1A 5ETPA 4ZVRB 3DLHA 2NUHA 3G06A 4DJBA 2GIFA 1VRUB 4A8QA 1IXKA 4F2SA 2N7YA 1QJHA 2XC9A 4MK7A 4ZPBA 1E6YA 4N7TA 5FJ4A 5HN0A 3JSYA 1SVDA 1RCOB 3MM9B 3CMES 1TVRA 1D09B 1QDUB 4CQ1A 2IY5B 2PDAA 1G6BA 3ZFVA 4ED0A 4N76A 1SKUB 2GJFA 4OZ2A 3GV7B 2K1RA 4C97A 4TQSA 5IC6B 1KQGB 5KFFA 3JTNA 3T1HJ 1DTQB 5HSPA 5AXMA 4ECVA 4C4WA 1HMVA 3KDOA 3NGRA 3TAMA 3TUZC 3EPIA 4E98A 1TL5A 2W7OA 2ZE2A 3G3AA 3DLEA 3PXGa 2W9BB 2L9WA 2LQ8A 2OD6A 4KB7A 1W25A 4JV0A 4C2MA 3G6VA 1JLEA 1Y9OA 2ZH7A 1VQLS 1S7IA 1S10A 1UWBB 4EBEA 1WEXA 4QU7A 5B4PA 1DS9A 5KT4A 4DV4F 1NDKA 4USJC 4OI3A 2A6OA 5JVHQ 1KWMA 1JNZB 4H09A 2DGTA 2DXFA 2RF2A 4KV8B 1DZ5A 1NZ8A 1UWAA 1S59A 3IRXA 5IJBA 2CQPA 3R7SB 1FCAA 4LF2A 2L9DA 4DX5A 2CKWA 3V6KA 2DVIA 2EFPA 2E1CA 3UN3A 5B08A 2YNGA 3ILIA 4GKJF 3MCOA 2DHSA 2DNZA 2A2CA 2CDQA 2XNRA 3R1HA 4ELUA 4ZVHA 5J2QB 5F8LA 1A9NA 1KLNA 4DOZA 4TVAB 2OMOA 2RU3A 3KDNA 2E66A 2UXDF 5D4LA 3B54A 2DRDA 2PEHA 4RU2A 3HO1A 1TMJA 5KG5A 2APOA 2MQMA 4AXJA 3I9V9 1OTMA 2H9ZA 1F5AA 5A2QY 5IT9Y 3FEYB 2KT2A 2ZOGA 2UVWA 3CCJS 2IJFA 5HLFA 2BE2A 3KLGB 4X64J 4NLDA 1NK6A 3TZXA 4W98A 2PSZA 4QXEA 4U06A 4LRDA 4ZK7M 1FRLA 4IOCQ 3NS6A 4F4KA 2F4VF 1NDCA 2BKNA 4Q0BB 3TZZA 3P45B 5DQGA 3CD5A 3DOMB 4ITSA 3OFHA 1PIEA 1S1WB 3PX0A 4X66J 4J9SA 2YH1A 4C8YA 1SQFA 4DCPB 1G3OA 1RWXB 2YKOA 4BSSA 1T9YA 1E6VA 4FVCA 3AJ2A 1X4AA 2C3UA 1RTJA 2VBYA 4QR2A 2BJ1A 5CABA 4WTYA 2CPFA 1YVFA 4X65F 3MAAB 5HO4A 2E5JA 1U6ZA 1Q82T 4K5RA 2H54B 3M2RA 2HQIA 5M2UA 3J80Y 2FHJD 1U8WA 4LF8F 2WBMA 3MEEB 2WK4A 4P6QA 5DG9A 4X4UA 2GJ2A 3T41A 4CTAA 4RUAA 2W1BA 3ZNJ1 4ED5A 2DNNA 7FDRA 5JVGQ 2U1AA 2YNIA 1R27B 1QAXA 3FFIA 2DEIA 2EK1A 4LFAJ 3MGJA 2W2OP 4V2EA 1FNOA 2DR5A 2VFUA 4OYOA 3LUYA 4URSA 1PGZA 2RDDA 3SEOA 2Z4PA 3QSYB 1RAIB 2E5HA 1XNRJ 3NBPB 4O44B 1YQHA 3JTOA 4ZDNA 3W1YC 3DLBA 4H4KA 1U4BA 3IM9A 1S9EB 4DMZA 3N6NA 3TWZA 3QO9A 3ITHA 2WQVA 3TI0A 4RNOA 5IJDA 2FC9A 4PKIG 4LJMA 1IVZA 4CLFA 4Z7YA 2FLNA 2OHDA 4RNMA 3NY0A 4JBCA 3OR1A 3G8TA 2Y1JA 1T05B 1PGVA 2GMLA 2RVJA 3PZPA 5BYRA 2J6SA 1VBYA 5EGYA 2GQCA 4M7EC 3GONA 4B9MA 1QTNB 4ZLPA 2DNGA 5KFEA 2QC3A 1W26A 1HWKA 1N0UA 2UXCF 1LW0B 1DTTB 2UUAJ 2RQKA 5HQ8A 4O0NA 4Q3IA 4CH1A 4C3MA 1ZAXA 1GT8A 4B3TJ 3ILJA 4OJ1A 3H0PA 2H5EA 5U47A 3GWCA 2Q6CA 2FHOB 2LVWA 2PT0A 2HVZA 3ET6B 1EP4A 1Y5NB 4ZP9A 2F3JA 2ROPA 4JP8A 3RB0A 3CCTA 2DCLA 1P9QC 3CULA 1H2UX 1VFJA 1OS5A 2XMUA 4ELVA 2Z82A 3SDEB 1IUJA 4K4XA 4A46A 3AQPA 2QGFB 2RQMA 3DM2A 5DQHA 4EZGA 2CPZA 3QGPA 1HARA 3TUIC 2BE9B 4J90A 2VB6A 1WUUA 3T6JA 2G2ZA 1IM4A 2RILA 5BR8F 2VG5B 4KSEB 3KLHB 2M8HA 1Q8IA 4MYUA 1HBMB 3WPGA 1S1UA 1SPBP 4CM2A 3MCMA 2LCWA 1FRXA 5E3QA 3BDPA 3QAEA 2OTJS 5GMEA 4USTA 1C2PA 5B0GA 3VQSA 3DRSA 3Q8UA 3BN4A 1QAYA 4CLZA 2AYMA 3UO0A 3OJAA 1U0HB 3G86A 2XZDB 4I1TA 3MUVP 3W9HA 4C8LA 4KYZA 1FD8A 1UKUA 2YPYA 4DS4A 2EVZA 2W9AA 1JLBB 2YWWA 4F04B 2PC6A 1DFDA 3US5A 3LH2S 3P6YC 1SKSA 1TKXB 3HHDA 2CJAA 1UJ5A 3ISZA 4PG7A 3AXKA 1S0MA 1CPZA 3CJ2A 5KG2A 1VRTA 3ENVA 4C8OA 4DCJB 3AB2B 2HBYB 4IRDA 1LWFB 2VFSA 1XERA 2DR6A 5F8IA 3KJNB 2A1BA 2R42A 1SH3A 1JKHA 4DUZF 1NRKA 3H5YA 1N33F 3OXLA 4FN5A 3BSOA 3TA1A 3CJSA 3VR1A 1L3VA 2EFOA 4QCLA 1VQ4S 3IR5B 1UVLA 1RWOB 2AJQA 1F3VA 3FUYA 2XQCA 2ZM6J 4LI2A 3OTCA 2KFZA 1KRPA 4ES2A 5ETSA 1BLUA 4V2CA 4IQMA 4JUZA 2MJNA 4FD0A 4KGKA 2MSSA 1HHTP 4R6GA 2KHCA 5HAOA 5IV3A 4QPXA 1FE4A 3RFSA 4ZOSA 3C66A 2FLLA 4ELTA 3E6JA 1RAJA 1NDLA 4X4NA 4OX7A 6AT1B 2GNKA 1VRUA 2V8VA 3TYTA 5J1EB 4OZ5A 5GMHA 4LBHA 1RTHB 2N82B 1ZAVA 3MMAA 4CLKA 1L3KA 3NKYA 1DCEA 2HQDA 1HYSB 4JV5J 4KGVB 3DCAA 3MM9A 5DETA 1XMOF 4WWSA 2W8LA 2BW7A 1YIJS 2ZVIA 4A8OA 3W8GA 3EDQB 1MMNA 4DSIA 2C3MA 1YRXA 1MMLA 2MLZA 5A6PA 4QW8A 2NPFA 2M9KA 4AXIA 3JB9j 1RACB 3AY0A 4MKAA 3E51A 3QJPA 3ENQA 2J8AA 4WFZA 2BE7D 4J9KA 4K2JA 4DEZA 2GAHC 3KLIA 3N6LA 4U67Q 2L9NA 4B3RF 2B8QA 5KFJA 1KTVA 3PFEA 5J1NA 4NMXA 1P27B 1IWGA 1HNZF 4XIUA 1AFIA 2QMWA 3RYLA 1SJRA 1VYAA 1BQNB 4NLVA 3P4UB 2W9BA 2BQUA 4H4MB 3G6YA 4CIOA 2QSWA 2HMIB 1P1TA 5C7PA 1S6QB 3E8OA 2Q1LA 4WFBQ 5GAHU 3HHNB 2OFGX 1UWBA 5BJRA 5KAKA 2M2BA 3UI3A 2UZAA 2V2QA 1WI6A 3VVTA 4WFXA 1JWWA 1TP7A 3L3CA 1FNMA 1EAYC 2OPPB 5A6WA 3MF5A 4KV8A 4Y2AA 4OI4A 2AIRB 4HTIA 3HX9A 5A76A 4DV0F 4DPTA 3H5XA 4QJVA 1H73A 3O53A 1W2IA 2BQRA 2RQCA 4RUHA 4PYAA 1H74A 3CDAA 1LFPA 3D1OA 3FRYA 1FXDA 3TUJC 1QAIA 3KK1B 4WCEQ 4BHQA 1Q4RA 3FQKA 3D7SB 2NXCA 5J2QA 1HWJA 2B43A 1UCNA 3BPSP 4FZVA 3HJVA 4ZPAA 3C14B 1FWKA 1RA6A 2KN4A 1MLAA 4RCWA 2V2VA 2WFHA 3QT8A 3ZZRA 4G6VB 3CWJA 3VAFA 3NS7B 4LF5F 1RT6B 2EBEA 4K0KJ 1RBLA 2DNHA 4FYDA 1CQMA 3KJQB 5CQGA 4GC7A 3K5PA 2KU7A 3MM8A 2B4OA 2LFVA 2YH0A 3ZNUA 5B0BA 3HFVA 3ETMA 4USHA 1GFWB 3SQGB 2AYEA 2HYIB 4ERDA 5IM0B 2CPJA 3C3LA 2QFIA 2ASLA 3DHXA 3IG1B 3QLHB 2QL9B 2ZC4A 4DL3A 4DUTA 3WPHA 3R7BB 3TVKA 1PYTA 3IBWA 3MFIA 1SL0A 3GB0A 4DBQA 4Q45A 4Q0BA 4DV6J 3DOMA 1S1WA 4KHPJ 2Z0GA 2VV5A 4PYDA 4D3HA 1GK8A 3RB3A 2E1PA 3M05A 1MU2B 4WFYA 2CQ0A 1KS2A 3LALA 2V50A 3MAAA 3AQOA 4M95A 1QUPA 3CD7A 1ZETA 2MZTA 1WSVA 2V69A 1U1RA 1FKPB 1QD1A 3PDNA 3QT6A 4KHMA 2OPRB 4ED6A 1IWAA 3H2UB 2R7RA 4JI4F 1GTEA 1T11A 1IN0A 5KFCA 4IFYB 4ED4A 2DR9A 1TKZB 2QA2A 1AUDA 2VU5A 4RUBA 4LF7F 2R7WA 3LW5C 2C42A 1GQEA 5KFSA 4URQU 2AF6A 2QYGA 2CZVC 2Z81A 1GXUA 3GG1A 2OAUA 3SSQA 4FNIA 2OEJA 1UZDA 1I94J 4RW7A 3EGZA 1IR0A 3TO8A 1REVB 1QLNA 4R58A 4LRFA 4JOUA 4EMDA 4U96A 4NA1A 1G7CB 5HQMA 2LKZA 1XEZA 1KHVA 3NBPA 4O44A 4TQRA 3UNYA 3HHLC 4NXMF 3OTBA 1JLFB 3PJWA 4WBFA 2MKCA 2DXDA 4Y65A 1X7VA 4RO0A 1NHVA 5AE2A 3DDKA 3BO3A 1G2EA 3E3XA 1UFLA 4DR6F 3W3MA 1CJKB 2DTJA 2DGUA 3D28A 4F25A 4ZN1A 3FCHA 2A2DA 2OSRA 1LWEB 1DQ9A 1U0ND 1JNRB 2DHGA 4YOEA 4NEYA 1FDAA 3UR0A 2CNKB 5G4DA 3MR3A 1T05A 1NSKL 1BXNA 2BJ8A 3V6HA 5DZ7A 4DZ6A 1M5PC 4Q2MA 2RS2A 1X4GA 3KJFB 3VAMA 2AT1B 1LW0A 1DTTA 4LR9A 4JI5F 3TQEA 1JLCA 1AW0A 1NU4A 1CLFA 3VTIA 1CG2A 1RZMA 3K89A 1D8YA 1LW2B 2JC0A 4QIEA 1FO1A 3R5DA 2UXBJ 4B9LA 1SCJB 2HBQB 2Y5QA 2UUBF 3J80U 4JI0J 3ET6A 2ZBIA 1V9OA 2V9WA 3D0HE 3HVTA 2AEMA 4PG5A 4GO5X 5KT3A 1I3OB 2FVSA 4ECWA 2G2YA 4ZHRA 3HVRA 3BR9A 3SDEA 1PJ5A 3LF0A 3ZZUA 2ZOFA 3CPWR 4G1IA 4IH5A 5ETRA 4B3OB 3G82B 2SXLA 2Z64A 3W66A 3L95X 5AE1A 2QL7B 1M90T 2DH9A 5H9EJ 2BUNA 1RLDA 2LEAA 3O44A 4DN0A 1HWUA 1ZPVA 3HXMA 1LV5A 1KDNA 1XN9A 1APSA 1VGYA 2VG5A 2OKQA 3KLHA 5LL6d 1HBMA 4J9VA 2FLOA 1N5VA 2C2MB 3A12A 2R8KA 3CJ3A 3KMSA 4MIBA 2BYCA 3TANA 3GR0A 3AHPA 4M5IA 5E0OA 3GZ7A 5AJ3F 2IVFB 2XYGB 4UZCA 1FRHA 4J9PA 3ETOA 4DR7F 3RBZA 2OMYA 4DL4A 1U0HA 3BZ5A 2VJVA 1VBZA 2RAQA 2P5VA 1XNQF 1JLBA 1RUSA 2D3UA 3GIJA 2V4QA 1TKXA 1CEZA 2FJWA 1HD0A 3D5MA 1VI7A 1VOMA 4LQ9A 4FP9A 1V5IB 2HVDA 3LP1B 3I55S 4ENOA 4PSJA 1LWFA 4OZJA 1HNWJ 4DPXA 2W4PA 2XS5A 3Q2TC 2JNJA 3SCJE 3NRBA 2KZZA 1WF1A 4J37A 2G1DA 3KFWX 4OX8A 5K8MA 4K4SA 5C5JA 2V9SA 4QYZK 3Q2SC 4F0KA 1RAAB 3PCOB 3ONQA 3M9NB 2V67A 3W8PA 2IDEA 1K1SA 3RR7A 1JB0C 4OJ3A 3L09A 3NWGA 4LT6A 1GWBA 3R3TA 2YWGA 1K73T 3VCDA 2IBOA 4K4VA 4WYKA 5HATA 2BVZA 4P9SA 3T1YF 2DB1A 4PXBA 4XO0A 1NK5A 3MMCB 4PCQA 2V5HG 2XEXA 4NLXA 3IBFB 4YQWA 3X3UA 2GO8A 2WQUA 5J1EA 4K4YA 1H0HB 1XTZA 5B0NA 4CO1A 5ETNA 3LGMA 3GCWP 4C0HA 2CPDA 5HVHA 3PIPQ 4OX9F 1HYSA 3FGVA 4LSCA 4KGXB 5CZXA 1NSPA 3AB4B 5KFXA 3TJ8A 1HNXJ 2VPWB 2VL1A 4AD6A 1O6XA 2PFDA 2O5DA 3TR5A 2ZDPA 5D15A 3RAQA 4WJBA 4ECNA 2AU0A 3BKFA 2E9RX 4I6AA 3ISNC 4C48A 1J2VA 3MR6A 1RWPB 2OMWA 1FJGJ 3G2XA 2DEJA 1S1XB 3AOCA 3RBEA 3BZQA 1FXRA 4BC9A 4R5DA 3DRXA 1BQNA 1YJTA 5HK4A 3DKDA 3HJFA 2QRRA 2VQEF 2C3PA 4O3QA 2XNQA 4H4MA 2G0IA 1MWQA 2HMIA 1TFYA 3B4MA 4DR3J 2HGLA 2AX0A 1S6QA 1TL1B 4J7CA 4ZVOB 2Q6BA 4MIWA 3SSSA 2JVOA 2C2EA 1HA1A 4KKOA 4I6WA 4J9OA 1PAUB 5A8RB 2OLWA 1FHTA 1SKRA 1IKXB 1XBWA 1IBMJ 4K5SA 1KFSA 3UCUP 2FIUA 2J5AA 2OPPA 3ZYNA 1NCLA 4DQQA 4DG1B 5HDHA 1WDTA 1IO0A 3OGKB 4DZDA 1HFEL 4L75A 4AQYJ 1W2BR 2VUGA 4ECOA 1QSLA 5KT7A 2HHHJ 1QTMA 4AFFA 4C7QA 3VALA 5KFAA 2V68A 3R6GB 4LR7A 3KK1A 3LWMA 3G6XA 5KOXA 4CC4A 2IVYA 1Y4ZB 2VG6B 4RKUC 2LYVA 4KFBB 1FE0A 3UDEA 1FT8A 3C14A 4ETZA 2BX6A 4A8SA 4NLQA 2KYXA 5K8OA 3AAWB 4ETXA 4ECSA 4Q43A 1RT6A 4ZMMA 4OYZA 3DZEA 4JI7J 3LOUA 4O23A 4ARNA 4BBYA 4CP5A 4W92B 2WCXA 2EKNA 3G8QA 3CO9A 3CGIA 4EU0A 4KR0B 3SQGA 4W90B 1T9UA 2HAIA 1ZM4A 1K0TA 5IM0A 1NH7A 4UOFA 1B3TA 4U7LA 2V2KA 2CQCA 3R2DJ 3RRHA 1NSQA 2FHJA 2H5JB 3QLHA 1HPZB 1FESA 4DSEA 4DL0C 3UR3C 1K44A 2R2UA 2MJUA 3RB6A 3M32B 2QA4S 1T0TV 1Q7YT 2XOTA 5KOWA 5AWBA 4WZMA 4B8CD 3QSIA 2C2DA 3UD4P 1LQ9A 4X4VA 3KUHA 2PA8D 1MU2A 1SUQB 4ZIWA 3C6NB 2HKEA 2E9ZA 2KYZA 1H2TZ 1TKTB 4JI6F 4N8NA 1OIAA 1AROP 1GNKA 2HHVA 3I5CA 4QBUA 2HFZA 2KL8A 3R7NB 1RT2B 2W4CA 2A18A 1FKPA 4HR2A 2FY8A 3KLEB 2OPRA 2BR0A 2QLWA 2K7KA 2UVRA 2I5JA 4CNCA 3W3LA 3A3NB 1H6UA 3ZXWA 2MTLA 2MKYA 3O5TB 1U2FA 4IFYA 1T9WA 2WW8A 4DV4J 2DCUB 1FFSB 5AT1B 3MXHP 4LFBF 1HD1A 5IWAF 2PO4A 3AT1B 3MMJA 3C46A 4WYWA 2XS7A 2W2QP 2V63A 2HW3A 1HW9A 5BXIA 5GMGA 3I87A 3KNAA 4M5DB 2KG1A 4NX9A 1REVA 3EGVA 3RRKA 4LSNB 2WVFA 2ADCA 4Q8FA 4LUBA 4Z7CA 4M5GA 4P2XA 1ZTTA 4GKJJ 3CDWA 4I68A 3DU6A 1S12A 1F9FA 4DSFA 1JLFA 4PZVA 3GYXB 1Y00A 3PJ9A 1EIYB 3IM8A 2EC0A 2UXDJ 3PW0A 4NZ7A 4XPCA 4USKA 2GV1A 1LWEA 3BGUA 3QFWA 2W4DA 1FKAF 2VFTA 3ZZOA 2MLXA 3NG8A 3UVJA 4MH8A 3ZYJA 2DBBA 3OPKA 2E5LF 2Q66A 2O6QA 2VJUA 4FF3A 1QSYA 2OPSB 1HNIB 2GIRA 2ALZA 1YZ6A 2F4VJ 1FJCA 2OELA 2R7XA 1LW2A 5LJ5Y 4NLSA 2UVUA 2RHSB 3UD5A 1MWYA 2ZWPA 1Q95G 1ZA1B 3NNCA 3AD7C 2PMWA 4GLPA 2KKHA 1P9AG 2ZH2A 1FWPA 2OEKA 3D3BJ 3OHAA 5ETMA 5LT5A 1NK9A 5KG4A 3RZAA 1WELA 4X65J 4Q5VA 3UCZP 4WF9Q 1ITPA 3W60A 4B3OA 3G82A 4WK3A 2CJBA 4OLPA 3P5BP 3PEHA 4QOTA 4LF8J 4C2AB 4PQUA 3ZC4A 4BS2A 2POKA 3D66A 2CWXA 1S72S 5A5CA 3WPCA 1Q1KA 4CILA 1C4CA 4RX6A 4FF4A 1N5QA 1ROFA 3FSIA 2Z2MA 1WHXA 3Q0AA 4X4SA 1VK8A 1QE1B 1N32J 4F3MA 2VFRA 4ZVPB 2RUSA 2OTLS 3NEKA 3MEGB 4MTPA 3DGPB 5H9FK 2M8DB 2XGQA 1XKUA 1H3DA 3M6UA 4DU7A 4QIGA 3GCXP 2J0XA 3EE3A 1Z4UA 1H72C 9ATCB 2GMHA 1FXLA 1L3SA 3QT7A 2ZH8A 1FDNA 2VKRA 2A3JA 2IDLA 4H4KC 2KHDA 2DGVA 4YB1P 1URNA 1JQGA 3LPYA 5KFBA 1F60B 2VPZB 3LP1A 3THPA 5J2PB 2X1FA 3GILA 3I5BA 3MAHA 3OSPA 4LF4F 1S0VA 1XR6A 3UCGA 1J5EF 1VBKA 1F2HA 2GGPA 3QPIA 4UOCA 2WVBA 1S4FA 5AXLA 2HFNA 5KG0A 5J1PA 3M8QB 3J7YI 4YY3J 2VG7B 1R8BA 2UXCJ 4NEZA 2WQXA 4R07A 4KPCA 4DX7A 4EZ9A 2Q4GW 3T6BA 1M1KT 4ZITA 2B8PA 3KYLA 4KT1A 5D3GB 2RT3A 1TAQA 5IJCA 1H7XA 2B6AA 1HI0P 2DGQA 2R7VA 2CPIA 4JI3F 1XC9A 5DGAA 4AUKA 5K14B 3EVOA 3JSMB 4B02A 2GFFA 2JE1A 2OH2A 3B4DA 2D74B 1RT5B 2XS2A 1Q78A 4JYAF 4NWBA 1OTNA 1PKUA 1W7WA 1YGYA 4CO5A 4GKKF 3KUGA 2M88A 2QT7A 2FHMA 4ZJQA 4L6V3 3PV8A 1VQ8S 4DL2A 4GVLA 3WPEA 4EUVA 1WACA 4DX8H 4HLBA 1WOPA 5GAEI 3IRWP 2FJDB 3M8WA 3HHLD 5BR8J 1UVNA 4ID5B 2P9GA 4DI6A 4KC5A 4KNGA 2ID5A 1F5BA 2OPQB 5F0UA 3L7PA 1KTQA 1JJHA 4ALZA 5L9NA 3HD1A 1ZA2B 2DPJA 1KHWA 2IAJB 1S4EA 1VJWA 4UY85 1TUWA 2HHXA 4I0WA 2KJWA 4FMZA 2CWKA 1N5TA 4ZCMA 4YN3B 2GQ2A 3CJQA 5HMWA 2HBZB 4YEAA 3R1LA 1B99A 1MWZA 2VASA 4J9NA 1TUGB 3G71S 3POTB 2R2TA 4B08A 3BSAA 3D67A 2CNNB 2MQLA 5A8RA 3CD0A 4LVOP 4O3RA 1IKXA 2XBPA 1X5PA 4DUZJ 1DJ0A 2W2MP 2IM0A 1N33J 4DG1A 3I0RB 1VQ9S 4BC7A 2VOPA 1RAHB 2CQGA 1OPZA 4WKYA 3S01A 2ZJRQ 2J7KA 1X4DA 4TY8B 3RAXA 3BS9A 1RHQB 3BF4A 2V4RA 3JXOA 5HROB 1VQ6S 3H59A 3REZA 3HF5A 2YXLA 3W3SA 2GZOA 2DIUA 4QWCA 3OJSA 3PO5A 2JE0A 1TFWA 1SIZA 2VG6A 1KLMB 1KN6A 3MFHA 4KFBA 4NZ0A 3H5SA 1P6TA 3NGTA 2GHPA 1V3RA 2OEMA 3PYFA 4J91A 2XB2D 2PN6A 3HT3A 2M5YA 3LTOA 3C16B 2KFYA 4HH1A 2QSFA 2MB0B 2UV8A 2B4VA 3EWGA 3GMGA 1QY7A 2J7UA 5I3PA 1XMOJ 2VF3A 1HBUA 5D3IA 2Y9HA 3D9BA 2LDYA 4ZPTR 1QSSA 4O3PA 1X9WA 2KXFA 1HPZA 3CDBA 1BQXA 2O1PA 3CCUS 3KHLA 3O1LA 2HZVA 2BKOA 3UWTA 3M32A 2R2SA 2XCPA 1XWLA 3DRRB 2MMYA 4PXDA 1F6TA 3N4WA 4A8YA 1PJ7A 2XYHB 4B3RJ 5C25B 4FS1A 5B09A 1RAOA 1SI9A 5KFWA 1VMBA 2MKJA 2QIFA 1HNZJ 4NLWA 2ELLA 2XMWA 2B9WA 2O3DA 1BMQB 1VRQC 4EBDA 2QFJA 3WPIA 2X7IA 2QMUB 1FRMA 1TKTA 5L9XA 2OUGA 1RT2A 5CA5A 3KLEA 2KT5A 1VQPS 4E0DA 2YWFA 3EPGA 2X3DA 4KE5A 3KTQA 4V1Ak 3ZZZA 4RPFA 5J2NB 3OL6A 1HW8A 4NKGA 3H42A 3L7OA 1UEUA 4USMA 2HNDB 3O8WA 2AJ0A 1S6PB 3M18A 3EJMA 3KXDA 5LOQA 3DLGB 3FBBA 2KM8B 3HFKA 4C6AA 2MKKA 1JMTA 1NBEB 4LSZB 4OYWA 2FY1A 3TARA 4PEOA 2RKIB 4I56A 2IYGA 2ZNYA 3DI6B 2JLFA 4MJKA 3V6DB 4ZCKA 1RT3A 4M5DA 1YJ7A 3CJTA 5LSOA 4LSNA 1UA1A 4OX6A 5F0WA 1SJ4P 4USVA 1G1XA 4GMKA 2VA3A 4O3NA 2DH8A 4CLLA 5HMYA 1H6KX 2MQOA 2FVCA 3PM9A 3L4BC 1EJ7L 2AD9A 4DSJA 5C42B 2BJEA 2Z2LA 2RSQA 1GMWD 4EI2A 3LO3A 3NGKA 4FF2A 1JXLA 1MW7A 1RHKB 4LF5J 4N5SA 3ZTSA 1KFDA 4HTJA 1NKEA 3CCWA 2CQ1A 4LSLB 4BSRA 3W2VB 1LWCB 1IR1A 2KXNB 3MCSA 2MQNA 3N6MA 3BGRB 4JB8B 1YJUA 5L1KA 5HJYA 3OJUA 1KNZA 3I9ZA 5D78A 4CNZA 2OPSA 1HNIA 1FD2A 2YX7A 4UOGA 3IWNC 5FTTB 2E9TA 3RBXA 1PJ6A 3MUTP 4R6FA 2ASSB 1Q79A 1S99A 3A1YG 2F1FA 4ZKAA 4P2FA 3N0VA 3C6TA 4GT6A 1S7HA 4MKBA 4KJIA 3OGMB 3Q89A 4KGZB 2VQFF 3KMQA 3RW6A 4FYYB 1YBAA 1TQLA 1YG0A 3G9CA 1TL3A 3WC0A 3I96A 3UN9A 3BV8A 2YKPA 5DGBA 5KT2A 1D1UA 5F8MA 3FRZA 4I6YA 5I4MA 3KJVB 4ECZA 5F8NA 2CVEA 2HK3A 3RB4A 4JI4J 1OY8A 1SJ3P 2MZSA 3CIZA 3U1LA 2OIHA 1ZM2A 4BCAA 4FVMA 4DCOB 1L3UA 4OZNA 2AMCB 3K2YA 3O6QA 1WF0A 3KLVA 4Q7AA 5DG8A 1VQMS 5IS2A 4LF7J 4NRTA 3FMBA 4WP6A 2LP4A 1RHMB 2FZCB 5F3TA 1QE1A 3SSRA 3CJ4A 3MD1A 3DLKB 3QATA 1J27A 3VQ1A 1RT4A 4MAKA 2GO9A 2V4JB 1R43A 4XDDA 3ULHA 4OI6A 1IM6A 4Y6IA 3MEGA 3UQSA 4IO9Q 4DQIA 3EMTA 4OQJA 4KY3A 5HANA 3KG0A 4ZN3A 3VAGA 2QZ8A 1OYDA 2JFDA 2JEGA 4NXMJ 4FKYA 4E8UA 1Q16B 2CDRB 1FTRA 1XMQJ 4OZ1A 4RW4B 1UA0A 4DR6J 2X1GA 4QYZJ 2RB7A 4B3SF 5FLXU 4TU9A 1WKLA 4LXSA 5J2PA 1UVJA 3LGHA 1U09A 4ED8A 3MTJA 4NLRA 3W9IA 1SC3B 3GJSB 3CMAS 2OMZA 3M4XA 1N5YB 2YPZA 2ADBA 1BWVA 2WHOA 2C2ZB 1TL4A 2VG7A 3DHWC 3WZ0A 3T5LA 5IQ6A 2PD1A 4RNNA 2ZITA 2K06A 2H51B 5CD4A 4JI5J 1EHWA 2QA4G 4X4TA 3J7YU 3UN2A 2DYAA 4DV1F 1PG5B 2VOOA 2VBWA 2DJWA 2XMJA 2D41A 5D3GA 5KFMA 4DX6A 5B7WA 4NYPA 2YQ3A 4O4GB 2UUBJ 3CW2C 3JSMA 1UEVA 1B70B 1K0VA 4RCAB 4FBTA 1CULB 3PR4A 3I0SB 5HVGA 3CC7S 1Q53A 5KFTA 1JLQB 2YVSA 3T9ZA 2F8EX 1AUSL 4YDXA 2DR7A 1RA7A 3PACA 2Q3PA 5LM7E 3VHQA 1UW9A 5IZHA 1NK4A 1KOOA 3PRVA 1HR0J 3BJYA 1DQ8A 4AW4A 2ROEA 4NE9C 4IH7A 2HIYA 5GAEU 3DXBA 2VBZA 4CRJA 2RA8A 2FJVA 1FRIA 5AJ3J 3Q8QB 2CA9A 2J9EA 4MIAA 2IAJA 1O0PA 2MZ1A 4DR7J 3E4GA 2Z63A 3JYTB 3ICLA 1WC6A 1TMMA 4FXVA 1XNQJ 2FT3A 3DXSX 4AT1B 1T3OA 4CCHA 1SQ0B 4FXWA 4FYVB 4C11B 4OLOA 3M8SA 2DNRA 4IRKA 3U1MA 3HVAA 3POTA 3GYNA 2CQDA 3NNHA 2GJIA 1TTHB 2NZ4A 4KHRA 2XYPB 1M9LA 3S7RA 4Q62A 3B6BA 4DV3F 4TKTA 3MM7B 2OO4A 2WONB 3M6WA 2ZKUA 2V8PA 1CVJA 2NLWA 5B0EA 2RU9A 2AJ2A 1QM9A 4ZVGA 3I0RA 3Q8SB 1UFKA 4NYOA 5I3UB 4A8WA 3W3NA 1ZZNA 5D0GA 1FF2A 2QJ3A 3WX4A 3HMJG 5AE3A 5GAHI 1SH2A 3W5ZA 2HNYA 1K5DC 2K2PA 4ILMA 2D9PA 4IFVB 2L08A 2F4FA 2BM1A 2MDAA 3FDSA 3OXGA 1XMBA 1JLAB 4OZ3A 2YKNB 3QIDA 1D9DA 1KONA 3T1YJ 4H4OB 3CTRA 4OYMA 2DY9A 3C15B 2NYHA 1YJVA 3DLJA 1P8TA 4L3FA 4WKRA 1TK5A 1ZAWA 4R08A 5KG3A 4ZVQB 5KFZA 1Q5VA 3DFEA 2DNLA 3C16A 4ZP7A 3P8BB 3BQ0A 1OSDA 3M9MB 1WHVA 3MPYA 4MFBB 3BPDA 3EYZA 4OYXA 4OX9J 5KG6A 1NXIA 3FMWA 1SXLA 4UUXA 1HNVA 3MURP 5LSRA 3W63A 5B0CA 3NAHA 2CVIA 2RDJA 3ZTPA 2OJ3A 1RLCL 3C19A 1NK8A 3D6HB 4V2DA 4CLWA 4A8XA 1YHQS 2QG9B 1BE4A 1X60A 1GAOA 4CNMA 1B7YB 3NMAA 1HHQA 5IV4A 5C25A 2VICA 4GVBB 4YR2A 3UW1A 4P74A 5GQRK 2X51A 3DDNA 1XCDA 2HWTA 1A6LA 5AZ5A 4NRUA 1LK5A 5D4PA 4MK9A 1YX2A 5DM7Q 2VQEJ 5DDRC 3D54A 4JV5F 2HRTA 1EQMA 3MPUB 4J4LA 3EXCX 1OJ4A 3R9LA 3H90A 2HFUA 3D1QA 4LRBA 7AT1B 5J2NA 1IBLF 3T9NA 1I51B 2GS8A 3J7A1 3D0GE 3ZO7A 3MD3A 2BEXA 2LEBA 5DG7A 2HNDA 1S6PA 2JX2A 4ANCA 3M6XA 2D7SA 3HKZD 4YMEA 2B9YA 1TK0A 4DN9A 4I64A 1C0UB 1TUVA 1SV5B 1FWLA 3DI6A 3V6DA 4Q8EA 3NS5A 3DMJB 1DURA 3GP9A 1WTFA 4ECUA 3PFOA 5CXTA 4I7FB 3LAKA 1IKYB 1QVGR 2RH3A 3Q86A 5KG1A 4Y2IA 4CC4C 3K57A 3H25A 5C42A 2GX8A 4JV2A 2ZH3A 1CJTB 2VFVA 3MR7A 1B0VA 4M1KA 2K3IA 2ZH4A 2R7SA 1X4EA 4RW6B 3ULUA 5HMXA 5E2QA 1QAJA 4QIFA 2EW9A 4LSLA 4DL6A 2NPIA 4QZVB 3KLFB 1LWCA 4CO2A 3UL9A 2Z30B 2HLTA 4FDFA 5B0DA 2GQQA 2KDOA 1BUXA 1F0XA 1ZH5A 1AFJA 1UFWA 2MGZB 2EK6A 4TLRA 4R5CA 4KIAA 2UUTA 4HDHA 4BWMA 2CQBA 2HRYA 1IKVB 1M9SA 1IKWB 5A8WB 3IA0A 3VVUA 4YUDA 4LI1A 3I6PA 3RRGA 3NNAA 3ZTQA 4Z94G 4ZP6A 2ATLA 2VZ9A 2J7WA 4Z2XA 1UP1A 2JDJA 2XSJB 4KH1B 3VAKA 2HGMA 3E3ZA 5KFGA 1L5UA 4AL5A 4USIA 3CVKA 5AWDA 1CJVB 4DR5F 4HHJA 3R5AA 1DY3A 4N47A 5LMUF 3Q23A 4JI6J 4QBZA 1E6YB 1NMEB 2B7CB 4USUA 5KFDA 1N6QB 3MOZA 4WZQA 3KJVA 4L3AA 2P1OB 4NI2B 2J0WA 3E2JA 3PG9A 5GMFA 1GXLA 2ASDA 1Y5LB 2Z58B 1PC5A 2FTRA 1RWWB 4ZVFA 2VH7A 3QGIA 4P91A 1U1QA 3OD2A 4ECTA 5IWAJ 3UNGC 3G8SA 1S79A 4DF4A 3H40A 3DLKA 3HSGA 4Z37A 4PERA 1RT1A 2BJ3A 3WIUA 2V4JA 2NXUA 1NKBA 3CCRS 3OVSA 3PHTA 2C2NA 4PPZA 2AP6A 4WIQA 4WXOA 2PI4A 1M10B 1UPMB 2EG2A 2CG8A 5K9FA 5JJBA 4HL9A 4ZCLA 2KZMA 3A8EA 1M5SA 2WOMB 5K8NA 5L46A 1QVFR 5EWFA 1GXTA 4RBUA 4V19J 1SQGA 4RW4A 3M19A 4R0JA 4MKVA 2YWKA 3UDVA 2CQHA 4J9RA 2J76E 1RWKB 4YEBB 3K7RA 1GMVA
chains in the Genus database with same CATH topology
4QBUA 3PIOQ 2HFZA 4DJBA 1H2VZ 4JI2F 4FS2A 4U08A 1RT2B 2W4CA 4HEA9 2A18A 1FKPA 1VRUB 3KLEB 2OPRA 5FD1A 5EHHA 4A8QA 4F8RA 2J0SD 1Q8BA 1UL3A 3G6ES 1IXKA 2RF2B 4PWUA 2BR0A 4YHHF 2QLWA 2K7KA 4F26A 2UVRA 4F2SA 2BRKA 2N7YA 1QJHA 2I5JA 4CNCA 3W3LA 1RKJA 2XC9A 2GHVC 3G96A 4MK7A 4K2XA 4ZPBA 1H6UA 2V0NA 1N5YA 2AJ4A 1E6YA 3O5TB 1U2FA 1RJJA 2RRNA 4IFYA 5FJ4A 3T3FA 1DAXA 4IO1A 3CEDA 5HN0A 3JSYA 1CSJA 1X0FA 4Y61B 3OUYB 2WW8A 2DCUB 3SV4A 3RFJA 3GIIA 3MXHP 3MM9B 3CMES 2ZOMA 1FKOA 1TVRA 4LFBF 1HD1A 4LF9F 2RS8A 5IWAF 2GW8A 2PO4A 3MMJA 2G9OA 3QJLA 4CQ1A 3V4IB 3C46A 4WYWA 2XS7A 2PDAA 3CCLS 1G6BA 3ZFVA 2HW3A 2DH7A 2LA6A 3PY8A 1FEEA 1HW9A 4OI0A 3PO4A 4ED0A 4N76A 2JVRA 2IA0A 2WSCC 3OQ2A 3GV7B 1RQ0A 2DISA 2K1RA 2C3OA 3MZIA 5GMGA 4BSUA 3I87A 3KNAA 4M5DB 3ULAA 1RDRA 4C97A 2ZD1A 2KG1A 2LQBA