1FO1A

Crystal structure of the rna-binding domain of the mrna export factor tap
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
240
structure length
215
Chain Sequence
TIPYGRKYDKAWLLSMIQSKCFTPIEFHYENTRAALKAVNYKILDRENRRISIIIELKPEQVEQLKLIMSKRYDGSQQVLDLKGLRSDPDLVAQNIDVVLNRRSCMAATLRIIEENIPELLSLNLSNNRLYRLDDMSSIVQKAPNLKILNLSGNELKSERELDKIKGLKLEELWLDGNSLCDTFRDQSTYISAIRERFPKLLRLDGHELPPPIAF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of the mRNA export factor TAP reveals a cis arrangement of a non-canonical RNP domain and an LRR domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein
molecule keywords NUCLEAR RNA EXPORT FACTOR 1
total genus 67
structure length 215
sequence length 240
chains with identical sequence B
ec nomenclature
pdb deposition date 2000-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09162 Tap-RNA_bind Tap, RNA-binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1fo1A01
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 1fo1A02
4C2AB 2GO9A 4BV4R 1VBZA 3WPEA 1VQNS 1WF1A 2JRSA 1YJ9S 5GMHA 2F3JA 2CQPA 4CIOA 1OGQA 2Z7XA 4I6JB 3CIGA 3FEYB 2YH0A 3MD1A 5LXRA 1O0PA 2MQOA 2DNZA 1U1NA 2XOTA 2DK2A 5HZLB 4LSCA 4R6GA 2MQNA 2BZ2A 2DB1A 2MZJA 2MXYA 2MSSA 2OMZA 5GS0A 2BOPA 3ULHA 4NKGA 1X4EA 2KRRA 2AYBA 1K5DC 2J0QD 4PSJA 2P1NB 4U06A 2R9UA 1DCEA 3RFJA 2L9WA 5A5CA 3G3BA 1WEXA 4CQ1A 2CQ0A 1HD1A 2OTLS 3RGXA 1JMTA 1WG1A 2YTCA 5BJRA 1X5SA 3ULAA 2HGLA 3P6YC 3RW7A 1N8RT 1X4FA 3J7YU 1YRGA 4U09A 4C7QA 1CVJA 1W8AA 2JVOA 2KT5A 2WQUA 2MGZB 2Y5QA 5HDHA 2M88A 3UCGA 1URNA 3G04C 1WWLA 1M0ZA 1QYYA 3MOJB 3VAMA 1K9MT 1UP1A 3OGKB 4RCAB 3K0JA 2MZTA 3R1LA 1NO8A 3CCJS 4PEQB 4F26A 2MYFA 2MZQA 1YTYA 2JQDA 1L3KA 4R0AA 3N9UC 1M5KC 1OO0B 2QA4S 3E4GA 5AWBA 3CMES 2Q4GW 4ECNA 3EGZA 1GWBA 4GLPA 2JX2A 1H6KX 2XNQA 3G4SS 1XCDA 4WFAQ 3RIZA 1WG5A 3NNCA 1X4AA 2RRBA 2DGSA 1IO0A 3H2VE 1FJ7A 4ECOA 3EGNA 1VQLS 3KJ4A 1K8AT 5JVGQ 1N52B 4Z94G 4MN8B 4J4LA 3C6NB 1WHWA 2MKIA 2AYMA 3OJAB 3CCMS 1ZH5A 1P8VA 2DNPA 1SJFA 1U2FA 5EN1A 3CTRA 4WKRA 3ZYJA 4BSUA 2V94A 2MY8A 3NNAA 4B8CD 1UAWA 2CQGA 2WFHA 4CNCA 4LIRA 1XEUA 2RNEA 3W3MA 3FEXB 3CXCR 1WTBA 1M9LA 1KQSR 1JJ4A 2E44A 2MHNA 2VODA 2Z82A 2KM8C 2V70A 2I2YA 2KXFA 5CYJA 1YI2S 2D3OR 1RKJA 1WF2A 2KI2A 2JVRA 3VAFA 4IUFA 2N3OA 3WPBA 2Z62A 5IYXC 2OMTA 2XS5A 3NMRA 1R8PA 2P1PB 2N3LA 2OMVA 3CIYA 2M0GB 5IJCA 3C6OB 1FJCA 2CA6A 3BO3A 3BO4A 1O6VA 2FC8A 2A0ZA 4Y0FA 2CQHA 3VAGA 1FJEB 1H2VZ 2CQBA 2CQ1A 1WF0A 2Z64A 2U1AA 5D77A 2ZJPQ 1XKUA 4UY8T 5DM6Q 4R07A 2CPEA 2OIHA 1VQMS 2M52A 3P49B 4Y00A 4TZHA 2MKCA 2Z81A 4TLQA 2ERRA 5MLCV 4R6JA 2MKHA 3CCLS 1WWHA 1SJ3P 3WPFA 1JJHA 3V4MA 3MD3A 2HGNA 2HGMA 4LI1A 5GS2B 2V9SA 1VQKS 4FXVA 1PO6A 1M1KT 5CA5A 4M5DB 4WP6A 1SJ4P 3CCSS 1VQ8S 3VAJA 4W90B 4QXEA 4BS2A 2MQQA 2L08A 2M7SA 2QEXS 1H6UA 4QBZA 2LECA 2DH7A 2MZRA 4UFRA 3JB9j 2DGVA 4TU7A 3O53A 2J0SD 3US5A 4FMZA 4W92B 3P72A 2O6RA 2FY1A 3MXHP 2MMYA 5HL7Q 3MUMP 5DDPC 1YJNS 3UL7A 2RQ4A 4PKDB 2KXNB 2RS2A 4PQ8A 3RGZA 4R5CA 3JB9k 3WPGA 1OWXA 2KU7A 4CILA 1S72S 2LEBA 2MSTA 2UZXA 5FTTB 2LEAA 2D9OA 2DNHA 3VAHA 1FS2A 1AUDA 2V9TB 1Q86T 2MJUA 3RJ0A 4Z64C 1VQ9S 2M8HA 1A4YA 5GQRK 3CC2S 5B0TA 4P6QA 3EX7B 2DH9A 3BEGB 1K73T 5CMNA 4WFNQ 2E5IA 3U1MA 3Q2TC 5LFNA 3W3LA 1DZ5A 1R8HA 1M5PC 1H2TZ 3THPA 5LSLA 5IQQA 1DRZA 3DLLQ 3GOZA 2CPHA 3S01A 4Q3IA 4M7EA 4QPTA 2MKJA 1YHQS 3REZA 3NS6A 4FS7A 1JL5A 1M90T 4WF9Q 1OIAA 3TSRE 1DBDA 1FHTA 2FT3A 3WPDA 4QC0A 3E2JA 3ZYNA 5HO4A 3MURP 1Z7XW 1QM9A 1QVGR 1XECA 4BSRA 2CPDA 1YWXA 2MJNA 1P27B 3C6PB 2E5JA 5GMFA 1HL6A 2KVIA 3ULVA 3G9CA 4AW4A 4CH1A 4IM6A 4CP6A 2DNQA 2DITA 2G0CA 1M10B 4FD0A 4A8XA 3RFEA 4ARRA 1OOKG 4KT1A 4H09A 1H2UX 2ZJRQ 3G8SA 2MQPA 2DH8A 5GADU 1P9AG 2ID5A 2MZ1A 4Z2XA 2LYVA 3HI9A 5D78A 4Z8GA 1N88A 3CCQS 4OZ1A 2CQIA 3W3JA 1PGZA 1M5OC 2NZ4A 2O6SA 2DNGA 3SDEA 1Q7YT 1VC0A 3H2UB 4R09A 4V2CA 2YKAA 1OTMA 1YITS 3OGMB 3Q2SC 3L3CA 2DO0A 2Z7XB 5LXYA 2N82B 2LXIA 4C2BB 2MB0B 3THTA 5GVQA 2K8GA 4Y61B 1VQPS 1HA1A 3WN4A 3MDFA 2E5GA 4LI2A 1U1KA 3VQ2A 3S6EA 1YIJS 2P1QB 5IFMA 1VC6A 2DGXA 3UE2A 3CCRS 4CNMA 3TYTA 2Q79A 1XWDC 2M4MA 3G3AA 4FDWA 3IWNC 1SXLA 2ELLA 2RUGA 3G06A 1P1TA 1M9SA 4U08A 1W2BR 4RWTC 4J0MA 1ZZFA 5AWDA 2OSRA 3BZ5A 2PEHA 4Z61C 1U1PA 2LA6A 1X5PA 5IM0A 2CJKA 2M9KA 2ASSB 4CC4A 2MGZA 3OW2R 4GT6A 1VQ7S 4KNGA 2DGQA 3SDEB 3VAIA 4L3AA 4ERDA 3S8SA 1UFWA 2DGUA 4WIIA 1OTNA 3U1LA 1ZIWA 1NJIT 2Z65A 2J8AA 5GMGA 5H1SV 2N7CA 3DXBA 4XGOA 2RU3A 3MUTP 1X0FA 2AD9A 2OMUA 2X1FA 4FCGA 3CCVS 3ZZZA 3W3GA 2DNLA 2BEXA 2DIVA 2DNRA 2LCWA 4AY9X 2CPIA 4WCEQ 4C0OC 4IOCQ 1LTXA 5LJ3Y 2DGOA 1U6FA 3J7ZT 4LSXC 4YB1P 3LPYA 2J76E 2KFYA 3VAKA 2MPUA 5GMKa 2KXHA 3UD4P 5GAGU 1KOHA 2G4BA 3ZYOA 1SJRA 2DNOA 2IFGA 1FXLA 4U67Q 2DISA 2RQCA 3R1HA 4LJMA 4R5DA 2DGTA 3UL8A 5IM0B 3P3DA 1A9NB 3UCZP 2FC9A 2MQLA 2KM8B 1OTOA 4P91A 2DGWA 2YWKA 2OTJS 2XWTC 2P1MB 4V19X 2LQ5A 2OMYA 1Q82T 2K3KA 5GAEU 4RCWA 2M8DB 4U7LA 2ASTB 3WPIA 2L41A 4YOEA 5JVHQ 2VONA 2BNHA 4YEBB 1Q81T 2CQCA 3G8TA 2JWNA 3M18A 4K17A 2CPYA 1WI6A 2PE8A 2XS2A 5D3IA 2WBRA 2NLWA 2CPZA 2KH9A 1NU4A 1D9AA 3SMZA 1UW4A 3I56S 3UCUP 4WYKA 2DNYA 2HVZA 4XSQA 4TU8A 3OJAA 3CPWR 3CULA 2X1BA 1WI8A 2KG0A 1M5VC 1WHYA 5AWCA 5DM7Q 5CXTA 3RW6A 3DZEA 3E6JA 4QQBA 1O6SA 3E3ZA 2XSFA 3CUNA 2JE0A 1DS9A 1X4CA 5DDOC 2ADBA 3B4MA 2DHGA 3BS9A 1A9NA 1G9UA 2ADCA 1JJ2R 4RU2A 2RS8A 1FNXH 3CCUS 3ULUA 1X5OA 3P5TL 3MI7X 2KN4A 4L3FA 1S79A 2EK6A 2LKZA 3G71S 1D8ZA 2EK1A 1B7FA 3ZYIA 2LA4A 4EZGA 3FXIA 1WEZA 1P8TA 3VF0B 4Q3GA 1OPIA 1X4DA 2DHAA 1FO1A 2DHSA 3W3KA 2O3DA 4OZ0A 4XOSA 1X4BA 3D2WA 2MZSA 3PMHG 1U6BA 3WPCA 2EVZA 3B4DA 2CQ2A 2AYEA 1VBXA 4WFBQ 3UD3P 4HQ1A 1SQ0B 5B0NA 3SB4A 2HZCA 2RA8A 2WQWA 2YH1A 2AYGA 3IRWP 4PR6A 3G39A 3OGLB 5B4PA 2G1DA 3CMAS 1FT8A 1U1QA 4ZKAA 2QFJA 2OSQA 4FXWA 2RVJA 2MY7A 3ZZYA 1VBYA 5FJ4A 4YUDA 1QVFR 1XN9A 1YJWS 3NNHA 3VALA 3MUVP 3TP2A 2MKSA 2DNMA 1F9FA 1WHXA 5GAHU 1G2EA 2CPXA 4V2DA 3LQVA 2XNRA 3S7RA 2MKKA 2M2BA 4Z79A 4G8AA 5LSOA 3R27A 2A3JA 3PIOQ 1VQ6S 1K5GC 5DETA 4F02A 4TU9A 1ZZNA 2O6QA 4R58A 4FHOA 3CD6S 1VC5A 4CH0S 2U2FA 3CC4S 4ED5A 4BSSA 3G6ES 4PKIG 2KG1A 4PRFA 4LSXA 2DNKA 2CQ3A 3RFSA 1U1LA 4MQWX 5AZ5A 3UN9A 3VQ1A 3G96A 1U1OA 1WHVA 2KRBA 1U1MA 1WELA 1H6TA 2F9DA 2Z66A 2DHXA 5ITHA 2WQXA 4CC4C 2DNNA 3BO2A 2P1OB 5LJ5Y 1VQOS 4V2EA 4UQTA 2UP1A 2Z63A 4LSAA 1IQTA 5DDRC 2WQVA 5IJBA 2RR6A 3M19A 1DHMA 3CVRA 1VQ4S 2XB2D 2ZJQQ 4P8SA 3UWTA 3W3NA 2D9PA 4QU7A 2FPHX 2OMXA 4J5OA 3CC7S 1OZNA 4OQTA 1U1RA 2KHCA 4C4WA 1X4HA 2CQDA 2X1GA 4M7EC 4F25A 5DDQC 2OJ3A 3HHNB 1DFJI 4IOAQ 1U0ND 1X4GA 4PERA 1WG4A 3SXLA 1PGVA 2GHPA 2CPFA 4Q62A 2B0GA 5AWAA 4KXFB 1A7GE 1X5TA 4LXSA 1BY9A 2M70A 1WEYA 1D0BA 2FHOB 2I38A 2UZYA 2F9JA 1N54B 3TO8A 2DO4A 2RRAA 1KD1T 2E5HA 5CMPA 3WPHA 2JE1A 1KC8T 4R6AA 2KYXA 4R6FA 1RK8A 4IO9Q 2SXLA 2DIUA 3CCES 3CF5Q 2X1AA 3NS5A 4LMZA 1FQVA 4NKHA 2CPJA 1VQ5S 3O6NA 1O6TA 2XS7A 2VOPA 2OMWA 1KOOA 4QU6A 1SJQA 2MQMA 3PIPQ 2HYIB 4EGLA 5IJDA 2LXUA 1HD0A 3UL9A 2VOOA 4ARNA 4LXRA 4R08A 2RT3A 2LMIA 2CQ4A 3A79B 3I55S
chains in the Genus database with same CATH superfamily
3LO3A 3T6BA 1BD6A 2GO9A 2HFNA 2Y3YA 3C16A 3H59A 3DOKA 1PBAA 3WPEA 1WF1A 1YX2A 3C6UA 2QN6B 4C8NA 4FF2A 3A3PB 4DR4J 2RIJA 2EKYA 2RILA 3P45B 4F4WA 1AFIA 5CYMB 1RLCL 1TKTB 1HNXF 2Z7XA 4P2MA 2RF2A 2YH0A 2ZFHA 1HHTP 4HACA 3HULA 2PGCA 2ZOGA 5C5JA 1CPZA 3GG1A 2XOTA 3G87A 2RHSB 4U8VA 4BLGA 4QWDA 2GZOA 1FDBA 2HRUA 1TL3B 4LVNP 4R6GA 1ZTWA 1GMWA 3M2UB 3C6TB 1SV5B 1PKUA 3DRSB 2PO4A 5BYRA 2MSSA 5GS0A 4U96A 3Q8VA 5KFUA 3AJDA 2ILZA 4B9VA 1X4EA 5EHHA 4PSJA 2J0QD 2ACMA 4RPFA 5KTQA 4RNFA 1RT7B 3KLGA 4MT1A 2CQ0A 2FLOA 3W65A 4P75A 1EAYC 1GK8A 4KRWA 5LM7E 1Q0NA 3CGIA 4OIXA 5KG1A 4CT8A 3K59A 4Y6IA 3DDKA 1JMTA 4DUYJ 4OHXA 3FBBA 3TZXA 3HHDA 3KNGA 7AT1B 3P6YC 5C2GA 4DUYF 2J7WA 4KO0A 5CH7B 4ANEA 4ES1A 4K4UA 1KHWA 4U09A 3GR0A 3ZXWA 2J9DA 4GRSA 5HATA 4TQRA 4JI5F 3GIRA 4LF5J 4G3IA 3BZQA 2Y5QA 3DDNA 1S9GA 3EGVA 3I96A 5IOLA 2IRUA 2XMUA 4KYZA 3C19A 3BSNA 2APOA 1HQEA 1HR0J 1K9MT 2NREA 2IM3A 1FRHA 1DTTB 1UP1A 5EDWA 3R1LA 1TZ0A 3CCJS 1FRLA 3RAQA 2NYIA 4P52A 1YTYA 1KWMA 4HHHA 1S99A 1SVDA 4HHUA 4ZPAA 5KFXA 5IWAF 1HARA 3CMES 1M5KC 4PQUB 4GKKJ 1BQMA 3JSRA 1GWBA 2V50A 3AD8C 1RBLA 1H6KX 4P7VA 2YX7A 1JLBA 3G4SS 4DUZF 4GLPA 3RJMB 4WFAQ 5F0UA 4NLQA 4MAKA 2RRBA 1I51B 2HQGA 4ECOA 5C7PA 1O8BA 3EGNA 1M5HA 2UUBJ 2Y1IA 3KJ4A 1OQ6A 1LWEB 1N52B 4DDFA 1D3WA 1O5JA 4GVLA 4IDKA 1U09A 1FRIA 3WC2A 4Z94G 3RGIA 2MKIA 1MLAA 2AYMA 3W62A 2FJEB 3M6XA 3CCMS 1HBOB 3TJAA 1UPMB 1RYSA 4O4GA 5EWFA 2FB0A 4DV7J 4QCLA 1P1LA 3ILIA 1CLFA 2QJ3A 3EUNA 3CTRA 4Y2KA 2MY8A 2NPFA 2I9SA 3TA2A 4M8LA 2WFHA 2HWHA 4CNCA 1VMBA 4H4OA 4MK7A 5K14A 4QIVA 3HSJA 1Q95G 3DMJA 3EPGA 3LGNA 5A0YB 2ZDOA 1UWAA 3I5AA 5I3UA 1JJ4A 4TYAA 4NX9A 2VODA 4C8YA 2UVVA 3D3BJ 3NCRA 1WORA 3N5BA 4K2XA 1WKJA 4DU7A 4DL3A 1GAOA 2NXEA 4E2FB 2VHGA 4LF7J 1UVJA 1VRUB 2B56A 4M5DA 1S7HA 5KG0A 2N3OA 1HBNA 5CYQB 2DR6A 1SJ1A 3OUYA 2WVEA 4DMZA 2QRRA 3QT6A 3R8YA 1R0AA 4NA2A 1CJKB 2ZBRA 4OV6A 4WK3A 1Q8KA 2P1PB 1RBOB 1FEEA 2QSFA 1JLEB 4ZVGA 2FUG9 9ATCB 2M0GB 1U47A 4NI2B 1QLNA 3C6OB 3H8YA 3CIYA 9RUBA 3VGVA 2XM3A 2WSFC 5DGAA 2YPYA 4RUHA 1YBUA 3GJTB 2J8SA 2HMIA 2GIQA 1HI8A 1JLCB 4FKYA 4S0MA 1CULA 5D4LA 1FXRA 3VAGA 1FJEB 2WVFA 3LGHA 4DX5A 2J7KA 1T05A 1MN9A 2I5JB 3HZGA 3N0VA 2JEJA 3F73A 1JLQB 2B4UA 2BRLA 3MZIA 4XPCA 2Z64A 4X4RA 1VQSA 5KFVA 4BCAA 2U1AA 4CTAB 2ZJPQ 5T7LB 2VD3A 5KAKA 3EZOA 3J80U 4ECZA 2EKNA 3ILJA 5A6PA 5DQGA 4TZHA 3QYYA 4TLQA 2LDIA 2AWZA 4CO4A 2Z2YB 4PWUA 4C8OA 1UZHA 2JLFA 3DFEA 1NHKL 3CCLS 2XQCA 1LW0A 4Q0BB 3H5XA 4WP3A 5A8RA 1N5YA 3E3ZA 5GS2B 4OYBA 4FXVA 1PO6A 5KFPA 5CA5A 1S1WA 1XC9A 2RUSA 1F0XA 1XNRJ 2V6AA 2MQQA 5ETLA 1I3OB 2OD6A 4LF1A 1I94F 2Q66A 4UFRA 2VG6B 1RSCA 2HHPA 3PKMA 4FMZA 2NPIA 2CJAA 3T41A 2BJ8A 4KH0B 5G4DA 5HSPA 5F9LA 3MUMP 3DM2B 5DDPC 3A8EA 2DPIA 4JI5J 2KXNB 3HK2A 4LQ3A 3RGZA 4R5CA 3DNCA 1OWXA 1RWMB 2ZE2A 3TVZA 3T1YJ 2MSTA 5BXIA 5KT5A 2UZXA 4ID8A 2BE9B 3T1YF 2LEAA 4X64F 1HR0F 2DNHA 3RU0A 3IBWA 4KHPJ 1KTQA 2XWXA 1AUDA 3GG0A 2V9KA 4KV8B 4CWBA 1TV6A 1VFJA 1YJVA 4U8YA 2GC8A 1LNQA 2YNHB 3VCDA 3RJ0A 1KVJA 3D0GE 3MM6A 4FF3A 2YVSA 4IKAA 5GQRK 4BC9A 2H65B 3EX7B 5AXLA 2DH9A 3KLEA 4C8KA 2UXBF 3HFVA 4WFNQ 1ZM2A 2JSXA 2HQFA 4W4MA 2P2CB 1R8HA 2RKIA 3GYGA 1OPZA 2MHEA 4J90A 4YY3F 4X65F 1DRZA 5IQQA 4OZLA 2YNGB 3S01A 1SQFA 2AX1A 4DZDA 4M7EA 1U26A 2MKJA 4R5PB 4DR4F 2I8EA 3QAEA 4NASA 1FRJA 1FDNA 2VV5A 4RW8A 4IFYB 3AXMA 2PMWA 4ZCIA 2BBEA 1NJXA 5HO4A 5B0NA 2ACYA 1MNEA 2JLEA 1YG0A 1KQGB 2CZVC 3AD9C 1XECA 1RP5A 5ETKA 3Q89A 4JUZA 1P27B 2BX6A 2E5JA 1R8AA 1YZ6A 3T9NA 4JI4F 3C6PB 2JFDA 4UW2A 3G2XA 4CH1A 1C0TA 2VPZB 4IM6A 4CP6A 2G0CA 2DITA 1NSPA 4PG4A 2MLZA 3RFEA 5J1PA 1UA0A 1R0BG 1KONA 1H2UX 3EE3A 5A76A 2ZJRQ 3TAMA 4ECVA 3PR5B 3G8SA 3GILA 1JX4A 3MECB 2W8KA 2R4FA 1RA7A 3LOUA 4IH7A 4DV4J 2MZ1A 2FIUA 2OELA 2AEMA 3G8TA 2BABA 4FYVB 2ZH4A 2K3IA 3LP0A 4Z8GA 1HWUA 4MIWA 3SQGB 2VA3A 5ETTA 2CDQA 3Q22A 2VJUA 2F63A 2ZBCA 4RW4A 4CLZA 2F5GA 4ZN1A 3NGUA 4IO1A 1M5OC 2OAUA 5KT6A 2HNZA 2C2RA 4USIA 1Q7YT 1HNIA 3H2UB 1NZAA 1PJ6A 4R09A 4YR2A 1XR5A 3QSIA 4A48A 1TQLA 2F8MA 2BE7D 2HQCA 1Q8LA 3DLKB 2C3YA 4KGZB 3ETOA 1RTIB 2MKYA 2C3UA 2N82B 5IWAJ 3T19A 5IXUA 1NB2A 1RGVA 1SIZA 2AW0A 2G0JA 2VU5A 4R8UB 5F8LA 2K8GA 2D41A 4G1IA 4PUOA 1X7VA 1RYRA 3WN4A 4P7TA 4NXNJ 2QL7B 3JSBA 3H42A 2DY1A 4HYKA 3VQ2A 4JP8A 4HLBA 4JI2J 3A8IA 1FKPA 3UO0A 2G13A 1F9EB 3O44A 4JI2F 3W8PA 2UUBF 3CDWA 4ZPBA 3C3LA 2LFVA 3KDNA 4AFFA 5KFSA 1LQ9A 2HFVA 3TYTA 3CJQA 1HIYA 2BQRA 1HI0P 1UVNA 4WYWA 3MEDB 2ELLA 2RUGA 4LSLB 3OVAA 2ZVSA 1XERA 4NWBA 4DS5A 4RWTC 5AWDA 2IIHA 3CB4A 3UVJA 4KT0C 2PEHA 4Z61C 2V8PA 3DOMB 2FVCA 2LQJA 4OFZA 4RNNA 4EBCA 2A1BA 5I42B 4DR5J 2E9RX 4DV0F 1VQ7S 4GT6A 3CJTA 4YB1P 3SDEB 3DLEB 3VAIA 4L3AA 1IVZA 4BWJA 4I67A 3S8SA 4AL7A 1HPZB 2WSCC 3VZIA 4ETXA 3EVMA 4PCQA 5J1NA 5DQIA 2V68A 4F36A 4DI6A 1FJGF 2NQPA 1OTNA 5E2QA 2KKHA 3IR6B 1NJIT 5ETQA 2Z65A 1UFKA 4FPRA 1N0UA 2ZBPA 4CLLA 3J81j 1X0FA 3C6TA 2X1FA 1RT2B 3HVTA 3UI3A 4NZRM 4AY9X 2G2ZA 2RH3A 2YQ0A 4WCEQ 1UWBA 3M7VA 5J2QB 1HFEL 4KHPF 1MSWD 2DGOA 1TL1B 1U6FA 3G8QA 3BH7B 2DKOB 2XCPA 3J7AN 4DV2J 1LFPA 3VAKA 2QG9B 3CDBA 2QMUB 5GAGU 5IV4A 2NSBA 3MGJA 1KQFB 4X62J 1OYDA 1S4EA 2KJWA 2R2SA 4ZK7M 3NGSA 1IBCB 2H5EA 5EUHA 2IFGA 2RQCA 3HM9A 2V9TB 4M5NA 3R1HA 3FBCA 2UU9F 3UL8A 5IM0B 1PSDA 1Q7LB 2ZM6J 2VIHA 3RTVA 4NLDA 3UCZP 3C15B 3W60A 1LXJA 2MQLA 1RWUA 4KIAA 2OD4A 4K59A 2C22A 1TU0B 2NR0A 2V2VA 2EFPA 3HX9A 4YB7A 2FJWA 1LK7A 4IQXA 2XWTC 2HEKA 1NSAA 4DR6J 2BJ7A 1I1GA 4J9NA 4NLXA 2K3KA 4UOFA 5GAEU 2EPIA 2ZUGA 5HAOA 4ECTA 3R97A 4CLYA 2VFRA 3JXOA 1T8EA 4R0AA 3JQJA 3POTB 4KKOA 4YOEA 1URRA 3U1NA 1U7LA 2VONA 3L9ZA 2R8IA 2BNHA 3HPOA 2CFXA 2V0NA 3ET6A 2JWNA 2X3GA 4M5MA 3W7BA 2P8IA 3MM7B 4ATNA 3SSSA 4M94A 4DX7A 2GMLA 1S1VA 1FKOA 3KG1A 2J6SA 3HSDA 1HWIA 1T9WA 2H9ZA 4TXSA 5JMNA 4PWDB 4R0JA 1PAUB 3UCUP 2VFSA 1UW4A 4V1Ak 1REGX 3H40A 3HVRA 4BDPA 4LFCJ 4WYKA 3CPWR 2VICA 3A8JA 4RWWA 3BREA 2X1BA 1WI8A 5J2NB 1EP4A 1ULRA 3QGGA 5CXTA 4A46A 2CJQA 5DZ7A 2QZ8A 3LP2B 3LPEA 4FYYB 1C1BB 2EI5A 5DDOC 4OHVA 2ADBA 4ILRA 4NL5A 5HMZA 4LSNB 4C6AA 5KG2A 2DHGA 4O0NA 2EEYA 3KJNB 1F3VA 1G9UA 1LFWA 2RS8A 3CCUS 1X5OA 2FQQB 3NG8A 3MI7X 1N5SA 4UZCA 5DRKA 4EMDA 5DG9A 3GIKA 1U4BA 1T3NA 3O6QA 3BGFA 1FESA 1JKHB 1X31C 3HD2A 4LF7F 3BM7A 2OPRA 4O3PA 2AJFE 1FO1A 3CCZA 1TL7B 3QPIA 4OJ3A 1DJ0A 4OZ0A 1Y10A 1KBRA 3KJFB 3RAMA 5HQLA 2DRAA 3D54A 3ILOA 2AYEA 3OFGA 1VBXA 4EZ9A 3B6BA 1FK9B 3B82A 3UD3P 3BBBA 4L3KA 4NLTA 2AQ4A 5D3GA 3RUBL 2WQWA 4JBCA 2IC3A 1S9FA 1CBKA 4LF9J 4PR6A 5DO2A 3VTIA 4PG6A 4CO1A 1TK8A 2YY3A 4EYIB 2ROEA 1U1QA 1Z1ZA 1N33J 2QFJA 3HSZA 3NWRA 2DBBA 1AZSA 1O51A 1RU2A 1JLCA 3ZZYA 4JV2A 3NGTA 3W61A 4WP9A 4ANDA 1VBYA 2WOMA 4JI4J 2WTFA 3B78A 2LDYA 1MU2A 3BYPA 2WB1D 1YJWS 4QIEA 4HI2A 4M5KA 3VALA 3KUGA 1E6VA 5KFWA 3MUVP 1U0HA 2YKNA 1WHXA 4ALZA 4DV1J 2V34A 1RZMA 4CTAA 3CE8A 3GYXB 5L38A 3D7SB 4UY85 1N5VA 2ZVIA 2ZITA 2HFSA 3MMAA 1TP7A 4LRCA 3FCHA 3OL6A 4ECWA 3BGRB 2QLBB 2MKKA 1S7IA 4JV5F 2HBYB 1HWLA 5LSOA 3FFIB 2A3JA 4GO5X 3GMGA 3GP9A 5DETA 3W2VB 1K5GC 1ZZNA 2KT3A 3M8QA 4FKXA 4USHA 2LQ8A 1EARA 4DU8A 2XLKA 4RUAA 2QL5B 3K89A 4ED4A 4CH0S 3VHQA 1IWAA 1GXTA 4N8NA 3TA0A 4QBUA 4X4QA 2OHDA 4DV2F 1PCAA 2DD8S 1TMJA 2KG1A 4O3SA 1P9QC 4MK9A 3BPSP 1YSJA 3BBCA 1F60B 2WW4A 2ZBIA 4OZJA 2PMZD 4MQWX 2ZH8A 2YQ1A 4LBPA 3VQ1A 1WHVA 2KRBA 1X8DA 5GADI 2F9DA 1U48A 2Z66A 3R5GA 3NGKA 4L3NA 4XDDA 2UZAA 1BQNA 3R5DA 4ZPWR 2UU9J 2P1OB 1S6QB 1QJHA 4C97A 2CJ9A 2ZC3A 2W9BA 5B0DA 2UP1A 2KO1A 4NZ6A 4KGVB 2OEJA 4KFBA 4NRTA 1S48A 2ROPA 2WQVA 5KT2A 3M19A 5IT0A 4K0KJ 5IJBA 3CVRA 4LVOP 2ZJQQ 4USKA 3MR2A 2HG4A 2YWWA 2VFVA 2AJ2A 3GSIA 4IQMA 2OMXA 3LWLA 2H48B 3IBCB 4J5OA 4OI3A 4G1QB 4YR3A 3KK2A 4F8RA 1CJVB 1VK3A 2X1GA 4G65A 3CJKA 4BBYA 2X51A 5E3AA 3K57A 5DDQC 3HHNB 1U49A 1DFJI 2RKIB 1IJFB 4KJIA 1AT1B 5E3CA 4DX8H 4N56A 1FA0A 4IOAQ 1U0ND 4DLEA 4DL7A 4ZJOA 3JAMY 1WC5A 1S1TB 3C6UB 1WG4A 5KFZA 4B9UA 1S1XA 4RW6B 4DS4A 3CT9A 2CPFA 1U45A 1PGVA 4C8ZA 5AWAA 3OXGA 3OR1B 1EKRA 1BY9A 2M70A 2WK4A 1WACA 5G0RB 4DV3J 4EYHB 4LXSA 1WEYA 1T0TV 1OY9A 3MMCA 2RRAA 3TO8A 5L46A 1KD1T 1KLNA 3WPHA 3W9HA 1KC8T 4R6AA 3DRSA 4I1TA 4AQYF 3PVXA 3THVA 3CF5Q 1Z2LA 3IXQA 3JS9A 3NS5A 4LMZA 5H9FK 3JTOA 3KTQA 4C0HA 3J81U 5EWGA 3ITHB 3GWCA 4DFJA 2VOPA 1AYEA 4CP5A 5IT9U 4X4OA 4QU6A 1SJQA 2HNDB 3PIPQ 2A2CA 3O1LA 1RA6A 2XMTA 5KFAA 2HZAA 4PEOA 2FDNA 4ZIWA 5AE3A 3KK1B 3UL9A 1S57A 3WX8A 4LXRA 1HNVB 4PAAA 3TEGA 4R08A 2LMIA 1H72C 3A79B 2ZM6F 4RW4B 2AV5A 4WK1A 4USUA 1MMNA 3I55S 4C2AB 1S9GB 4ZVHA 2JH3A 1W25A 1T9TA 1VBZA 1VGYA 4GMKA 2D3UA 4O0IA 2F3JA 4I2PB 4ZPCA 4B3RF 1K1QA 4RW9A 5L1JA 1R8CA 1HNZF 1U2RA 3UN3A 3DOLB 4CRJA 3FEYB 3MD1A 3OSNA 3CIGA 4NXMF 2C1EB 1O0PA 4K4YA 2DNZA 5ETMA 1ZA2B 2DK2A 4R8UA 2J0SD 3UDVA 2MQNA 4DUZJ 5E3PA 2IHR1 2H1YA 1VISA 4NLSA 2MXYA 5HP1B 4K0KF 1U24A 3D3CJ 1SL2A 1CJTB 2KRRA 4DPWA 2AYBA 3K8VA 4K2JA 3PW0A 1J27A 3U27A 4ILLA 1IKXB 4AXJA 2O1PA 2R9UA 4CQ1A 1SC4B 2ZWOA 3ZZUA 2OTLS 5D8HB 4YEBB 2JL9A 3FGVA 4UUWA 3H20A 2DR5A 3D6HB 1YLXA 3RW7A 3Q8UA 2KT2A 2CAJA 2MLYA 3I5BA 3MR5A 4DSEA 4ED0A 3U7JA 1XMQJ 2BEFA 3W9IA 1N8RT 4DSFA 2P6TA 1PG5B 1EETA 1CS4A 5K8OA 1BGXT 4H4OB 5I42A 1CVJA 1WOPA 1RHUB 5HDHA 4ILMA 1IKWA 2M88A 3DMJB 3H5YA 2GJFA 1URNA 1RACB 1C2PA 1QYYA 2OMLA 3VAMA 4ZHRB 1SUQB 4ELUA 1R3NA 3K0JA 2MZTA 1NO8A 2XY6A 5B7WA 2MZQA 1FD2A 1IKVA 3DI6B 4DQRA 4X66J 1Q78A 5AWBA 4CLSA 3EGZA 1GH8A 1V5VA 5CYQA 1XCDA 3G3AA 3KMQA 1R0AB 4LF9F 1H3DA 1TAUA 2W8LA 2DGSA 1IO0A 1C4CA 2J9DE 3H2VE 1VQLS 2BJDA 3QRPA 1FJ7A 3V81B 2JC1A 2O67A 4F7VA 1Z2ZA 2R8KA 2JQDA 1UJ6A 3RBZA 2HHUA 4MN8B 4J4LA 3TR5A 3UR3C 2ZH9A 4NEYA 1Y00A 2DNPA 4QJVA 4Y65A 2YNIA 1U2FA 2N4CA 4MJKA 4ZITA 1JK9B 1YJRA 4X4PA 4DR5F 4DV1F 4B8CD 3FZBA 3M2RA 3MEKA 1HNXJ 2QIFA 3TEHB 5KFDA 4DCPB 3GIMA 2HNYB 3TAPA 5T7LA 1XEUA 2RNEA 2BUNA 3FEXB 2B43A 1FJGJ 2HVDA 4M5HA 2OLWA 1WTBA 1R89A 3U02A 1M9LA 2E44A 4JB8B 2BE2B 2O66A 2KM8C 2KHDA 2I2YA 1S1UA 1N5TA 2IBOA 2KXFA 2L9NA 4H4MB 4Y2IA 4YB6A 3DRRB 5CYJA 4ED7A 3NBPA 2D3OR 1YI2S 2ALYB 4DUTA 2JVRA 4P73A 1ICEB 3PACA 3TI0A 3HJVA 3MPDA 2WVBA 4B17A 3PM9A 1BQXA 2COLA 2Z62A 3IBFB 3QGPA 4LRFA 3OFFA 1R8PA 4I2QA 2QA2A 1TELA 4LFCF 4IH5A 2EBGA 3T1HJ 5IJCA 2VG6A 3I0SA 2CIMA 3MMBA 2VQFJ 3T1HF 1GT8A 4PPDA 3BO4A 2CA6A 2F4FA 2FC8A 4NRUA 4XIUA 1VBKA 1AFJA 1Y3KA 1KDNA 3W64A 2QO3A 2CQHA 3CJ8A 3LP2A 4YDXA 2KFZA 5U47A 1W2IA 2CQBA 2GVZB 2CQ1A 4LSNA 4AL5A 4ZP6A 1WF0A 1Y0HA 3CIZA 3WBZA 2C2EA 4J9KA 3V6DA 1G7CB 1LW2B 2B5JB 2KDOA 3NOCA 4A47A 2BJ9A 4Z7CA 2BR0A 1RTDA 2ZKTA 4UY8T 2B4OA 4ZS6A 1Q16B 1VQMS 2M52A 2XHCA 3HZEA 4Y34A 2MKCA 2A0ZA 3I0RA 1JKHA 2ERRA 2CNKB 2RA8A 1JXLA 1J5OB 2MKHA 5HQ8A 1RT1B 1SC3B 5LMUF 4B9NA 1SJ3P 1JJHA 4C0BA 3V4MA 4LI1A 2HGMA 2V9SA 3FSXA 1WSVA 2AGPA 4JI0J 2QC3A 3QNWB 3N79A 2E9TA 3N4WA 4WP6A 4FVCA 3E01A 2B4PA 4WE1B 3CCSS 2RAQA 5E5NA 1SBRA 4QXEA 1RT3B 1ZM9A 2C2ZB 3QGIA 3W5ZA 4NLYA 2M7SA 3M32A 2JEGA 5ETOA 3TQ1A 4DV3F 5LL6d 1TK0A 2QEXS 1SL1A 1B0TA 1JXEA 3EZ5A 2MZRA 4B3TF 3RW6A 4QBZA 2CZ4A 4HH0A 2IJNA 1F9HA 1HI1A 3EVOA 4CDIA 5IZHA 4RBUA 4TU7A 4K4WA 3KNAA 3O53A 3I5CA 2BQ3A 3P72A 1RTHA 3UPFA 3MXHP 3R5JB 2AEFA 5HL7Q 1HKAA 2Q6BA 2RQ4A 2HS0A 2M5YA 1OMSA 2W25A 4IOBA 2DRDA 2W2MP 3PKYA 3WPGA 3CJ0A 4AXIA 3DC2A 2FD2A 3C14A 2D9OA 3DDIA 4YR0A 3BGRA 4WXWA 2IRXA 1Y9OA 1TL5A 2F1FA 3TAMB 3VAHA 1IWGA 1Q86T 4HT5A 2BOAA 2Z57B 2K1RB 2IVMA 2MJUA 2AKWB 2OPSA 4A8KA 4UOCA 1M0SA 3PHEA 4OYAA 1QUVA 4UOHA 5C25A 3M8QB 5L9NA 2K06A 5B0TA 3ZFVA 1NRKA 3FBEA 2CKWA 3QO9A 4I6YA 4JYAJ 2PFDA 3IG1B 2HS3A 5EWEA 1DZ5A 4MMOA 2HVHA 1A9NB 1H2TZ 3EZUA 2BYCA 3DLLQ 4IRDA 3QWUA 2PT0A 4Y2CA 2R7TA 5ETNA 5KFCA 1Q8IA 1YKWA 4HR2A 4QPTA 4Q3IA 2HS4A 3QGHA 2Z2MA 2XI3A 1GFWB 1HNZJ 3PO5A 2I6WA 4WF9Q 3MAQA 4KHRA 3HFZB 2ASSB 1FHTA 3MAAA 2IMWP 2ZKUA 2J0XA 4KY3A 3E2JA 3J7Z5 2B6AB 3NGRA 1MWQA 1DQ9A 3MF5A 4PUOB 2CPDA 4DL4A 2RQMA 4BSRA 1A6LA 2MJNA 4OZ5A 2OUGA 3ZTSA 4KHMA 3PR4A 3MR3A 1JLGA 3MPWA 4OZNA 1T9YA 3GFZA 4CLWA 1KEKA 2P6SA 4FD0A 4A8XA 3ADAC 4G1PA 5KOXA 2KTQA 1OOKG 1R6YA 3N01A 4H09A 2YBVA 4AL6A 3W8GA 2DR7A 2W7AA 2DH8A 4DPOA 2NXNA 1CJVA 1P9AG 4Q7AA 4GC7A 2W9CA 3G82A 1LKZA 2UV8A 3HFKA 1N88A 3QIPA 4P74A 3UVJB 4TLRA 4DQQA 1Y11A 2CQIA 1CJUA 1FWKA 3WQPA 4ZVUB 2C2KB 4PG5A 1PGZA 4ZVEA 4OHYA 5CQGA 1S1TA 4MYUA 3WZ0A 1KQKA 2DNGA 3QJPA 3SDEA 3AAWB 2HHVA 1L3SA 1VRTB 3GONA 4V2CA 1RI7A 3R2CJ 2MQ8A 1RAIB 1QAYA 3OTOF 1XWLA 3R7SB 5CD4H 3DLGB 3JYTB 2LXIA 4DSLA 5LFNA 3SCKE 1JLAA 2V4QA 2MB0B 3HKZD 4AQYJ 1TKXA 3KLFA 1RT2A 3JSYA 4CLPA 2RHQB 3L4BC 2KL8A 4ID5A 4IG0A 4MFBB 4ZVPB 2AF6A 5DG8A 3FCWA 2IVFB 3P4UB 3JTNA 5J2QA 3RAXA 1U1KA 3I82A 2AGOA 4DF8A 1FKAF 1YIJS 2FYXA 3OD2A 3ITHA 3BN7A 2YKQA 5KG4A 3UE2A 3CCRS 1BMQB 3WHIA 2CG8A 2Q79A 3KDOA 2AJ0A 2YWHA 4CO2A 1MWYA 1N4LA 2OPQA 1XWDC 1HBUA 4FDWA 1VRQC 4YY3J 4K50A 1DLOA 4WU2A 1I6JA 1M9SA 1HQUB 2FHKA 3A3NB 4U08A 2JNJA 1XK8A 4DQIA 3BZ5A 1XTZA 5L1KA 1U1PA 1B64A 1PILA 4QIGA 2YNFA 2BXJA 5J1EB 3BQ1A 3BKUA 2PIIA 5GMDA 2MGZA 1NHUA 4QWCA 3T5HA 2V2QA 2DGQA 2FZCB 1DY3A 4DQPA 1RTZA 2G1HA 1MROA 3MCOA 4RW9B 2CUYA 2H4WB 4HVZA 1HBMB 3U1LA 1RAAB 3O3LA 4OI4A 4LQ9A 4LRBA 5GMEA 2W7OA 4ZLNA 2V8VA 3HLUA 2HQ3A 7FD1A 4DR7F 2XSJB 5F8NA 4XGOA 3M30A 2AP6A 3BR8A 3HF5A 3MUTP 1LWCB 2AD9A 1SV5A 2VF3A 4PWWA 3RBDA 4DR7J 3W3GA 3EPIA 2DNRA 2LCWA 4NOHA 5M2RA 4NYPA 2DR8A 4C0OC 3NCQA 1LTXA 3J7ZT 4LSXC 3AT1B 3G6XA 1IKXA 1VHFA 5KFLA 1RT7A 2KFYA 4M95A 4QYZJ 2VQFF 1FX4A 2MPUA 4IFVA 1IKYA 1C1CB 1DQAA 1OY6A 3PRVA 4LF5F 3JTPA 4DV5J 1RT4A 1EP4B 2DNOA 4IG3A 2QLXA 4DV5F 1FXLA 3NS7B 4KO0B 2ZH3A 2DISA 2BVZA 3EXYA 1Y5NB 3I31A 2CNLB 2ASJA 2VPYB 2R7WA 4WTOB 3IC1A 2CJBA 3LALA 4A4JA 2VB6A 4A8YA 1M1GA 1S0MA 3ENWA 2HQIA 2FC9A 5HI7A 3R2DJ 4NLRA 4DQSA 1OTOA 4C11B 2DGWA 4RBTA 4ZHRA 3Q8PB 1DTTA 4V19X 2LQ5A 2NYHA 3NEKA 1XR6A 4RNHA 4PG8A 3J7A1 1Q82T 1NDCA 1UMJA 1TKZB 3KLIB 4PYAA 4U7LA 3RRKA 2VDIA 2ASTB 5F9NA 3MMJA 2CVIA 2QYGA 3EM1A 3MCNA 4NZ7A 2XLIA 5JVHQ 2ABYA 2I0XA 4OI0A 4Y28C 1RT6A 2R7RA 1RT5B 1VQYA 3EMTA 4MTPA 5T41A 1HW9A 2CPYA 1GMUA 1WI6A 2XS2A 5D3IA 2Y8WA 4QIFA 1REVB 1NU4A 2F7VA 1KVKA 3SMZA 3CO9A 1KFSA 2DNYA 3OJUA 4TY9A 4TU8A 2KYZA 4XSQA 2W01A 4O4GB 2KG0A 3TA1A 1WHYA 2IDEA 5E33A 3UN2A 4DR3J 1G6BA 3PTWA 4QQBA 3VGTA 2CJYB 1BC6A 3D6TB 3M05A 1FCAA 3M9OB 3K17A 4EI2A 4C3MA 1U0HB 3R6GB 4XDCA 2HAIA 2GIFA 4EK2A 4QPXA 1U2CA 1TUWA 5GAHI 3SIPB 2WONB 1VR6A 3B4MA 3BS9A 2AZ3A 5EX0A 4R5PA 1A9NA 4RU2A 3TX8A 1TAQA 3P5TL 3MHYA 4WYLA 4DSJA 1T3OA 1S79A 2LKZA 1LWFA 5M2PA 3IM9A 2H51B 3KUHA 2E1MC 3MM9A 1D8ZA 4QIWD 5F8GA 4A8FA 2WHOA 2LA4A 4EZGA 1RAFB 4I4BA 1T9VA 1WEZA 4DG1B 4Q3GA 5HMXA 1D0EA 2BQUA 2XHWA 2DHAA 3NBPB 1XMOF 4QYRA 2O3DA 1N56A 1G1XA 2GGPA 2HHWA 3HHLC 3D2WA 2YWGA 2MZSA 3ZZOA 1RWKB 1RADB 1U6BA 1F3FA 3PMHG 1BWVA 3WPCA 2ZZMA 3QATA 1M5SA 4WKYA 5C42A 4WFBQ 2FVQA 1F5BA 4F2SA 1G3OA 4G6VB 1CJKA 4HHJA 4L75A 3W2WB 3J7YI 2YH1A 1IBMF 1TFWA 2D74B 4U6PA 4TQSA 2XZDB 3NAHA 4FPIA 3I0SB 4RJVA 4YN3B 3V4IB 5HLFA 4KE5A 4ENOA 3A12A 2VL1A 3PHTA 5F41A 3J81Y 5F8HA 3K5NA 1D9DA 2VQEJ 3DYAB 1K1SA 1GMVA 1KKHA 2ATLA 4DEZA 3CJSA 1TVRA 1RWPB 3A13A 4EO8A 4CLUA 3IMQJ 4BHQA 1QAIA 5B0EA 1FDAA 2G2YA 2P9CA 3D1QA 3FRYA 2MKSA 2QGFB 4NYZA 3TP2A 4GC6A 2DNMA 1F9FA 3IRXB 2FHMA 5C24B 5KFFA 1G2EA 2OPPB 2CPXA 2W4PA 4ZCKA 3PO4A 4K4ZA 3BDEA 3LQVA 2HAFA 3SFGA 1FEHA 2B8PA 2VG5B 3ISZA 2XNRA 2BW7A 2R7UA 2HHXA 2M2BA 2FZKB 2AMCB 3BB5A 4UQGA 1F5CA 2RMLA 3R27A 1NEEA 1TTHB 1RT1A 4ECUA 5FIIA 4TU9A 4EZ6A 4F02A 2XEXA 4P10A 4LF2A 5FDLB 2O6QA 2IYIA 1GXUA 3RG6A 4CNZA 3CW2C 3CD6S 3PDNA 3PCOB 5DLFA 2FLNA 4FHOA 2LU2A 2U2FA 4Z79A 4WE1A 4LBHA 2UVRA 2JEFA 4URSA 4BSSA 2Z58B 4AT1B 3G6ES 4F3OA 2NXJA 3DLJA 3KLHB 4LSXA 2CQ3A 5DQHA 4B3TJ 3LUYA 2PFFB 3OR1A 3LAKA 5G0RA 2PI5A 3UN9A 4ZP8A 2DXDA 1RJJA 3HVAA 2DEIA 5D15A 4WPAA 1DAXA 1WELA 2ZHAA 1OSDA 2DHXA 3OTEA 3KJQB 4OYIA 1UVIA 1SPBP 3DM2A 1FVQA 1Q5YA 3BO2A 1R27B 4UF4A 3NLCA 2ZH6A 5LJ5Y 2E1AA 4X64J 3CJ2A 3ENVA 3KHRA 3CDAA 4TY8B 4Q43A 1VQOS 2ZE2B 4UQTA 2W4CA 3LANA 1IQTA 5GAGI 4DFKA 1S12A 2GVDA 1T03A 1GX6A 2WVCA 1DHMA 3M8YA 3ZO7A 2XB2D 3OVBA 2UXCJ 1S5ZA 4OV1A 3UWTA 4F04B 4X84A 5DLGA 4QU7A 4K8RA 3QJLA 2HFOA 2OPSB 2EC2A 2YNHA 3MM6B 4KGMA 4C8LA 1OZNA 2O6SA 3ZZRA 2OGUA 3GJQB 2BRKA 3LF0A 2QSWA 4M7EC 5A6WA 3BH6B 2PMHA 4JI0F 4F25A 3WDOA 5KFBA 1ZAXA 3PX4A 2OJ3A 4WFZA 1UFLA 3DZEA 3VGSA 3C16B 4WU3A 1JIHA 2ZUAA 2CNOB 3SXLA 3R5CA 4M5LA 3Q8QB 1X9SA 3P96A 4Q8EA 4PXEA 1X5TA 3L09A 3HDSA 5ADZA 4HI1A 4HACB 5LMNF 4DPTA 5LMNJ 4JI1J 3HMJG 1RAHB 5HJYA 2FHOB 1D0BA 2I38A 3VWSA 4JI1F 1N54B 3LH2S 2DO4A 3DGPA 1UW9A 1PBUA 5K9FA 4XTTA 3MCSA 3WPDA 3NOGA 4CM2A 4F4YA 1RK8A 1C0TB 2A6MA 1NJZA 1YGYA 2EG1A 3PFEA 5AXMA 1MMDA 4KPYA 2R2UA 2CPJA 2R8JA 1ZA1B 2XMMA 1HWKA 4DR1J 5KFRA 1UJ5A 4L73A 2B9YA 1KS2A 4USTA 2RD5C 1NNDA 4O44A 4ZLLA 4DR1F 3M2VA 1F1BB 4CI0B 5IJDA 3DXSX 4RUCA 1E6YA 1RAEB 2LXUA 3MEGB 2V63A 2YWEA 1JB0C 2WAQD 4O3QA 2WCXA 2UUAJ 3JSMB 2GS8A 4JI3J 2J9EA 2K7KA 4YHHF 3L7PA 5HQMA 3DRPA 4JV0A 1RE1B 3KJVA 3SYZA 3BYRA 3QLHA 3Q86A 3I87A 4BV4R 1IKWB 1ZETA 1HNIB 2CJXB 3CVKA 4X2BA 1YJ9S 2Z4PA 3GQCA 3UNGC 1B0VA 1HQEB 2CQPA 2GV1A 3EGWB 2FHJD 1R8BA 3IS9B 4CIOA 2MDAA 2J5AA 3DLGA 1OGQA 2OKQA 4I6JB 4MKYA 2GNKA 4IYQA 4LSZB 4AE5A 3AJ1A 4F67A 1U1NA 3QJJA 5HZLB 2XY5A 4LSCA 2RU9A 1S77D 5I3QA 2BZ2A 2DB1A 3N6MA 2A6OA 2PN6A 1A0OB 2IM0A 1FKPB 2V8DA 2B9XA 1ROFA 2D69A 4A8OA 1K5DC 2VKRA 3FRZA 3V81A 5A5CA 3D9BA 4B3MJ 4RW7A 1LV5A 1XR7A 1WEXA 1JLFB 3SCJE 1HD1A 4ECYA 2GAGC 1SCJB 3Q8RB 1NK0A 1DLOB 5FLXU 1NSQA 5K8NA 5BJRA 3ULAA 2YNIB 2HGLA 2HHHF 4DV0J 2GQCA 3FEZA 1NK6A 3MPVA 4B3OB 1T02A 1F6TA 1QTNB 4WTYA 1YRGA 3NWGA 4C7QA 3M2RB 1IBLF 3HHLD 4IR1A 2JVOA 2HURA 2KT5A 4ELVA 4GKJF 3P5BP 1W8AA 4Y2MA 4F2RA 4N41A 1QD1A 1VDHA 2DYAA 2J7UA 2QV6A 3K8WA 4QR1A 5D4OA 1RHKB 5K14B 3T1AA 5DGBA 2VBZA 3UCGA 1MROB 2DRBA 3OTOJ 1M0ZA 3G04C 1FTCA 1NK4A 4B08A 2BE2A 4U95A 3MOJB 3D6MB 5L1LA 3GB0A 1EZZB 4LR8A 4ER8A 3OGKB 4RCAB 4MYTA 3W5YA 4QZVB 4PEQB 1Q1KA 2MYFA 1XMOJ 1B99A 1L3KA 1RUSA 3TAQA 1OO0B 2QA4S 4DLGA 3E4GA 4J7CA 2HRYA 2QT7A 5EGYA 4DFPA 1FD8A 1IXKA 4WXOA 4ZN3A 4B3MF 1RQ0A 4ECNA 3IM8A 2XNQA 2OP5A 3SV3A 2F8HA 4P71A 3K58A 1NDPA 1QSSA 3OL9A 1IBMJ 6AT1B 1X4AA 1RLDA 2F65A 2HVIA 2ZHBA 3TX0A 1K8AT 3MMBB 5JVGQ 2EFVA 2IFXA 2HWTA 1WHWA 5KFGA 1RTJA 2D3O1 3OJAB 1IQZA 3BF4A 2WRMA 4C48A 4RNOA 2BANB 1SQEA 1NBEB 2OEMA 2V2ZA 3N6LA 2IMOA 3WIUA 4ETZA 1FTRA 3HCXA 2I5JA 4DL5A 1W7WA 5KG5A 2JEIA 1KVIA 4B3RJ 5KG7A 1S6OA 3Q8SB 3NNAA 2CQGA 1V6HA 3AHPA 2R7OA 1QY7A 2HIYA 2GW8A 4EO6A 2B5JA 1RWOB 3D4JA 3EYZA 3W3MA 1NXIA 3L7UA 3JAMU 2C3PA 3R5AA 2GA7A 5KFJA 1N36J 3W3SA 4ECXA 5HVGA 2Z82A 2V70A 1N48A 1J5OA 4HKQA 2VKZG 4YP3A 1LW0B 3OPKA 4Q0BA 3POTA 1RKJA 4DN0A 1WF2A 1XQIA 2OEKA 3CDUA 4DWIA 3QRQA 1TFYA 5LT5A 1BQMB 3VAFA 4RNMA 2Z2LA 1RT5A 3E01B 2UVWA 4OI2A 3R7NB 1RT3A 5IYXC 2V9WA 2XS5A 4FDFA 3UQSA 4DV6J 2CYYA 3O2IA 4PWDA 2P5VA 3PJ9A 5KG3A 4DV6F 4NLGA 1FJCA 2WZ1A 4ECRA 2E5LJ 5D0RA 3SCLE 1V3ZA 3KK3A 1O6VA 4DR3F 3PW5A 2AJ1A 3KG4A 5GAEI 1RTHB 4OJGA 3AFGA 1DARA 3FSIA 3KHLA 4OYMA 3IGVA 3DHWC 2MTLA 2QYCA 4KQZA 3ZTRA 1L5UA 3FKBA 4I6WA 4Q8FA 3MPUB 4EBEA 1R7IA 1OJ4A 2W4DA 3QZ7A 3NCPA 2GQ2A 5A8KB 3PFOA 4J91A 4L76A 4R07A 1JXVA 2BKPA 4MK8A 2CPEA 3H90A 4OI6A 5B0BA 1YRUA 2FGCA 4CLTA 3T5JA 1ZS6A 1J5EF 3DCAA 4BC7A 2OIHA 3P49B 2Z81A 1S0NA 4R6JA 4KPCA 3NGDA 1F2GA 4I0WA 2ZH1A 3PZPA 1NK5A 2QA4G 1WWHA 3WPFA 6FDRA 3IG1A 2W2PP 1OY8A 1VQKS 1TR0A 4KC5A 2BJ3A 3CCWA 2QFIA 2FJAB 4M5DB 1M1KT 1WKKA 3AOCA 3K5PA 2IC3B 4P2FA 4QWEA 3VAJA 1KNZA 4W90B 4RW8B 3MCMA 3FVYA 3HKWA 4IFYA 3V4IA 2V8GA 5A8WA 2LECA 2DH7A 1EKSA 4NI2A 4QWBA 5H9EK 4OZ2A 2HHHJ 2KZMA 2DGVA 3PNIA 1H7WA 2B9EA 3DYAA 3GYNA 3US5A 1PYSB 5THWA 3ZTPA 2YX4A 3VR1A 3PJXA 5HMYA 4K5SA 3BSOA 4W92B 2MMYA 2O6RA 2FVPA 5B08A 1YJNS 2E9ZA 3IN5A 4PKDB 4PQ8A 2FJBB 4J9MA 3JB9k 2HBZB 2KU7A 3TZWA 3VVTA 8ATCB 4CILA 1S72S 2LEBA 5FTTB 1RKIA 2HW3A 1NJYA 4DCOB 3C2PA 3R3TA 3I4PA 4Q2MA 3MECA 3OXFA 3BN4A 3FFIA 1PJ7A 5F0WA 7FDRA 3W2VA 2Y0SD 1WC1A 1SIWB 2UUAF 2JFKA 5FDLA 3QZ8A 1U02A 3CC2S 4P6QA 1A4YA 5D0GA 3W63A 3SZ2A 3W3LA 2R3VA 2XGQA 1K73T 3ZNUA 5CMNA 3PRDA 1CJUB 3U1MA 2F4VF 3E2EA 5A8RB 3F41A 3DU5A 4TVAB 4PPZA 3GLJA 4RR5A 5LSLA 5AXNA 1S1WB 5DS7A 4FF4A 3GOZA 1ZBTA 2XMVA 1YHQS 3LP1A 3NS6A 4OX9J 4HEA9 4FYDA 4FS7A 4P72A 1NKEA 1DBDA 4B9LA 2FT3A 4QC0A 3OBIA 3MURP 1KTVA 3JYTA 3RRGA 2ZD1A 5RUBA 4ICLA 3PW7A 1QVGR 1QAJA 4FNHA 1YWXA 2W9BB 1Y3JA 1HL6A 4Y2AA 2B7BB 4C8MA 3ULVA 3SBMA 3G9CA 4AW4A 1J2VA 5I3PA 1T03B 2DNQA 3BBFA 1M10B 3KHHA 4ARRA 4JI8J 4A8SA 3AD7C 4UOGA 4PZVA 3OLAA 1LEOA 2GFFA 1HYSA 3F0NA 1ZPWX 2CZ9A 4DOZA 4KT1A 3OL7A 1SKUB 4KV8A 3MEDA 1TV6B 1N0VC 4G1QA 1L3UA 5CHCB 4H4KA 3CJKB 1HQUA 4RLEA 2LYVA 1IR0A 1NPKA 3BGUA 4N8OA 5D78A 4Z2XA 2ATCB 2RQKA 3PEHA 5AWCA 4WJBA 3BQ0A 4X4SA 2QL9B 2R7QA 3NL0A 4ZP7A 4OJHA 3BKFA 1C0UA 3IP0A 2YNGA 3W5XA 1R43A 1GEHA 2EC0A 5K5MA 1NZ8A 2G2OA 1VC0A 1Q4RA 3VV2B 3PX0A 1RBAA 3L95X 1HPZA 3ISNC 2UV8G 2YKAA 4PXCA 1TKDA 1OTMA 4CO0A 4CH7A 3CNQP 1IR1A 5CYMA 2XCAA 4FF1A 2Z7XB 1LXNA 3MTKA 4OZ3A 4O3NA 5LXYA 3RRHA 2XSJA 2IBKA 3ZZPA 5F8MA 2WQUA 4C2BB 1VYAA 4LIWA 5GVQA 2ZH7A 4F0KA 3I32A 1VQPS 2AT1B 1FF2A 1UKUA 2DY9A 2BACA 2E5GA 3MDFA 4LI2A 3E3XA 4OYWA 1P9YA 1QSYA 1PYOB 1EHWA 3CJ3A 2IJFA 2IM1A 2P1QB 1VC6A 1ZPVA 2DGXA 4IRKA 2HK3A 4CNMA 2WSEC 2HNDA 3KK1A 4ITSA 1H0HB 3GCXP 2GAHC 3A4TA 4NYOA 3TARA 3G06A 1HNVA 2Q43A 1AROP 4JOUA 1W2BR 3T5LA 3QSYB 3CMQA 4NPOA 3A3OB 5K8PA 2AU0A 1RHRB 8AT1B 3DRPB 3W66A 3KJVB 5I4MA 1FRKA 5IM0A 2W9AA 2CJKA 1T94A 2M9KA 1N32F 2PD1A 3OTBA 3Q8YA 3OW2R 1U8SA 1NK9A 4KNGA 1YZ7A 2HNZB 2LU1A 4C11A 4KBIA 5KFQA 3DOLA 2AIRB 4WIIA 1SKWA 3WC0A 4UT4A 1ZIWA 2D7SA 2J8AA 1V9OA 3EWGA 5H1SV 2CVEA 1BLUA 1VIXA 5J2MA 4FCGA 3CCVS 3ZZZA 4ZVFA 2IA6A 2FHJA 2DNLA 2DIVA 3CD7A 1JNRB 2Z2ZA 3BDPA 1NPPA 1S1VB 2GJ2A 3HSGA 2FTRA 4RW7B 1CSJA 3LPYA 1WC4A 4OI1A 1REVA 1ELOA 1JLFA 4ZVQB 5KFYA 2LXFA 4FS1A 2E5LF 1LWXA 2KXHA 3UD4P 1KOHA 2Z30B 2G4BA 3ZYOA 3AOBA 2GHWA 2POKA 3GE9A 4I7FA 3SFUA 3QFHA 4F0HA 3TANA 4CYUA 2R42A 2XWYA 4U67Q 4OX7A 1YBTA 1XEZA 5HROB 4GKJJ 4R5DA 1CS4B 3H7HB 3FUYA 3NXZA 4N76A 2DGTA 4KH1B 2EFGA 3D0HE 3H0PA 4OX9F 1U25A 2ASDA 2ZNZA 5J2PA 2DR9A 4LREA 4CLFA 1IN0A 1C4AA 4I56A 1LWFB 2FLPA 4B3SJ 4RX6A 5AT1B 1PC5A 4F4KA 2BKOA 1HW8A 2OTJS 2P1MB 2G0IA 5JUMA 1QUPA 1OQ3A 4DG1A 3ZZ0A 2ASLA 3AB2B 1S10A 1IKVB 4RCWA 3ICLA 4NLOA 1JJCB 3M6VA 1EIYB 2OH2A 2GGPB 2O01C 1B7YB 4DPYA 2L41A 1XNQF 3NMAA 1VRUA 3TUPA 3IFEA 1TMMA 3HVTB 5C42B 4DX6A 3UR0A 3T6JA 2VPWB 4K17A 2C2OB 3VQSA 4J9UE 1SB6A 3RB3A 4LR9A 1YDLA 5H9EJ 2RB7A 1QSLA 2LLZA 4XK8C 1MG7A 1TL1A 1NKBA 4B9TA 2IAJA 2HK2A 1M1HA 2WBRA 2NLWA 4CNYA 2R2RA 1D9AA 3AQOA 3I56S 3ZTQA 3Q83A 2HVZA 4ELTA 3CULA 4W98A 2H3EB 4IR9A 4X4NA 2XTJP 4TKTA 2DCUB 2WOMB 4P2XA 2G9OA 2Y1LB 1UCNA 3CJ4A 1GNKA 3V6JA 5DG7A 4KGXB 3DGVA 5AE2A 3E6JA 2JE0A 1E6VB 1T95A 1DS9A 2NXUA 2VASA 3HVWA 2CWXA 4NLPA 2Y9HA 2YKNB 3OTCA 1JLQA 4L74A 4N47A 5CZVA 4J37A 4DHVA 4YFUA 1N36F 2ADCA 3ISND 5CD4A 1FNXH 1Q8BA 3AA9A 2KN4A 1Q81T 2EK6A 4L3FA 2MLXA 1YVFA 2V4JB 3C8YA 2EK1A 5D0EA 4E98A 3GIIA 1ZAVA 3G71S 2ILYA 3WX4A 3FXIA 1NH8A 3D66A 2DPJA 2UXDJ 3VF0B 1CEZA 1P8TA 1T9UA 3UL7A 3DRRA 1X4DA 3LGMA 2DHSA 1S6PA 1FRXA 3HP6A 5ETRA 2P9GA 1FFWB 5KFMA 3AJ2A 1FXDA 1HHQA 3AODA 2VJVA 2HBRB 4HQ1A 3AA8A 3QAUA 1SC1B 3ET6B 4PXDA 2M3DA 2CDRB 3OTDA 1SQ0B 3SB4A 3KLHA 2B4VA 2AYGA 3PYGA 1U0SA 4GVBA 4I2QB 3OGLB 1HQ2A 5L9XA 2BV3A 4QYZK 2C2NA 3CMAS 1VHIA 3M8PB 4ZKAA 4UZBA 1YQHA 1MWZA 3KK3B 1OYEA 2KFNA 2OSQA 3F56A 4FXWA 3TWZA 3IR7B 5IV3A 5IQ6A 2MY7A 3LWMA 1XNRF 3PG9A 2AHOB 1VCTA 4FN5A 5FJ4A 1KP6A 2W7PA 4YUDA 1XN9A 2ZBQA 4TY8A 3L7OA 2LEPA 3TRGA 2YKOA 3H2LA 4KFBB 1C1BA 1RHQB 2EFNA 2HLTA 2ZWPA 3AY0A 4F3MA 5GAHU 4YQWA 2UXCF 5KFTA 3QBCA 2QLJB 4J9PA 5LMUJ 3VZHA 3SQOP 1HHSA 3S7RA 3IGNA 4EU0A 2ASYA 2YXLA 3V6HA 2A10A 2ZNYA 1PYTA 4B9MA 5BR8F 5JJBA 4G8AA 1BWEA 1VQ6S 3PJWA 1SH3A 3PIOQ 2H4YB 4O3OA 3KWMA 2HPUA 1IM6A 2JZ5A 3E8OA 5IC6B 3IR5B 1H38A 4HTJA 2HFUA 1GMWD 1RAGB 2BJ1A 3CC4S 2DCLA 3LA0A 1FK9A 5ETSA 3QMQA 2E7VA 1S1XB 4RW6A 4OQJA 3PYFA 5D3GB 1L3VA 4EFAC 4DL2A 1NDLA 1RWXB 4Q44A 1ZM4A 4F4ZA 1U1LA 3RFSA 4DCJB 3G96A 3OFHA 2E29A 1U1MA 3EVWA 4ECSA 1WDDA 4J9RA 5ITHA 4CC4C 2C3OA 2UUTA 2WVDA 4IH6A 8RUCA 4LFBJ 3KYLA 1IJEB 3DKDA 1NKCA 3TVYA 4V2EA 3OHBA 1S9EA 1V3SA 3HHEA 3H5UA 2C2MB 1N34F 2HHSA 4F4AA 5D6GA 1FWLA 4ANCA 2JC0A 1L3TA 2FJXA 4P8SA 3MMAB 1CC8A 4K4VA 2FPHX 3PX6A 2IVYA 5F8JA 4NCAA 3O5TB 2F40A 1E6YB 3MEGA 5KFHA 4ED2A 1U1RA 3D1OA 3CC7S 4JI3F 4OQTA 5ETPA 1NK7A 1AW0A 1WOOA 4NMLA 3V6KA 3AH6A 5LSRA 3BPDA 3CSKA 3G86A 2ZOFA 1PAEX 1XBWA 2LVWA 3MEEB 4I68A 4OYZA 3QLHB 2H5IB 4YB5A 3MOZA 5L39A 1UTAA 5KT7A 1YJUA 3LP1B 4PERA 2D3ZA 1CQMA 2VQEF 2GHPA 3FK4A 4I2PA 1AUSL 2HHTA 4FBUA 4KXFB 1A7GE 4QOTA 3ENQA 2B3TB 3JQMA 3M1VB 1HMVB 2B6AA 3ONQA 3DLKA 4ICLB 2E1RA 5HVHA 2XYPB 5B0GA 4A8WA 1H7XA 2F9JA 2HKEA 2Z8QA 5A2QY 2UZYA 2E5HA 4URQU 5B0AA 4D3GA 3CJRA 2KYXA 1S6QA 5E3QA 2GMHA 4DF4A 1DQ8A 1WD6A 4ZCMA 3BKTA 4R6FA 4IO9Q 3OL8A 3FQKA 2X1AA 1CJTA 1QE1A 4NKHA 1Y5LB 3FBFA 2I1RA 1AB8A 2YPZA 2B51A 2B9WA 4OMFG 1RABB 4CO5A 2XS7A 4NXNF 2OMWA 2YWFA 5KFIA 3TOQA 1KOOA 2AX0A 1OS5A 3BGOP 4EEYA 2HYIB 2UXDF 1TUVA 1KN6A 3MM8B 4KR0B 2ZH5A 1HD0A 2XYGB 5HK4A 2BA9A 2JOQA 2VBXA 4K7QA 3KK2B 3QIPB 1WC3A 2E1CA 4LF8J 2NCKL 4RKUC 3AOAA 1WKLA 1RDRA 2VBYA 4AYBD 3Q24A 3IWLA 1JJ2R 4I69A 3AXKA 1TL4A 3OFEA 4DV7F 1VQNS 2JRSA 1VRTA 3LAMA 1Y7PA 3TJ9A 5HBMB 4JI6F 1SKSA 1DURA 1I5OB 5GMHA 1SUQA 2E7XA 3M8SA 2ALZA 2VZ9A 4QR0A 5LXRA 3TUZC 2MQOA 2IPOB 2K2PA 1XNQJ 1VOMA 1TKXB 3ZZTA 3KLFB 2AEJA 2YKPA 4FVMA 4ID5B 4MFBA 2GMJA 1RB0A 1SH0A 2MZJA 3B54A 3HHLA 4NLWA 4DN9A 3TQEA 2OMZA 2XMAA 2BOPA 4TN2A 3ULHA 1UWBB 4NKGA 1B3TA 4U06A 2P1NB 3RFJA 1DCEA 3E51A 2L9WA 1UL3A 3PRBA 4RO0A 2Q6CA 2H54B 3G3BA 5E3RA 4ES3A 1RTJB 2YKMA 5HMWA 2XMWA 3H5SA 2XBPA 3M9MB 3RGXA 5F3TA 1WG1A 2YTCA 1X5SA 4NCGA 3J80Y 3M8ZA 1FE0A 1X4FA 4MIAA 3J7YU 3V5RA 4X62F 1Q79A 4RUBA 3O8WA 4BWMA 1RHJB 2MGZB 2JLGA 2IY5B 2PA8D 3DOKB 2QE5A 4C9DA 4OYOA 3ETMA 2C28A 1HLWA 1WWLA 1KHVA 4M5JA 2XLJA 2MEWA 1QAXA 4CT9A 1Z4UA 2YX1A 1SL0A 4DR2J 1WDTA 2VC0A 4LFBF 3TUIC 3RIZA 2FLLA 5AXKA 4F26A 4RZRA 5B0FA 4P2SA 2RRNA 5HJXA 2IYGA 3N9UC 4OLOA 5J2MB 3H25A 1LWCA 1S0OA 1P6TA 2Y1JA 4CZCA 1RCOB 1TL3A 2FY1A 2QMXA 2Q4GW 3IA0A 5CZXA 2JX2A 2OMOA 1NK8A 3K5OA 1GTEA 3ENAA 5HP1A 2NSCA 2IDLA 4F0MA 1U8WA 1R0CB 1WG5A 2XMKA 2BDPA 3NNCA 3NP5A 4PXBA 4ZMMA 4JV1A 2D1CA 4U7CA 4KB7A 1C1CA 2PC6A 3GJRB 2UUWA 4NLVA 3D6FB 4XAKA 4YHHJ 1UVMA 1RT4B 4IG3B 3C6NB 4CM0A 1ZH5A 4CYUB 4ZJLA 1P8VA 4O23A 3BR9A 5J2NA 1V3RA 1SJFA 3BSCA 2KB2A 4NA1A 1PJ5A 5HVFA 4Q45A 4I64A 1I94J 4UUXA 4K5RA 4WKRA 2V94A 4HL9A 1N32J 3ZYJA 4BSUA 4DXLA 1UAWA 4U7UK 4CLKA 1EETB 2EG2A 1T9XA 4LIRA 3UD5A 5J2PB 3M4XA 5DZ6A 3Q0AA 1CG2A 2BJEA 2OFHX 2IA0A 2WW8A 3ZTOA 4QR2A 5CCMA 3RB6A 1RTDB 1EQMA 3R6LB 5BR8J 3CXCR 4FBTA 2V67A 1KQSR 3QT5A 2MHNA 2YQ3A 2HVEA 1UA1A 3GFHA 1TKZA 3CJ5A 2RDDA 3KLIA 4ZVOB 4WWSA 3GIJA 3Q23A 2UVUA 4E8UA 3EDRB 3M8RA 1FRMA 2ROGA 4DPUA 2DT9A 1TL7A 4WFYA 1YJTA 2GCFA 2IJRA 2KI2A 4ZDNA 4LR7A 4U9RA 4FNIA 5CAAA 3BJYA 4IUFA 5KFOA 3WPBA 4USMA 1JLBB 3UDCA 1WUUA 2ZOMA 5IS2A 2OMTA 3M32B 4OHWA 2IAJB 3NMRA 1RXOB 2CG4A 2N3LA 4RBVA 3PYEA 3GZ7A 2OMVA 3M18A 2FGOA 1LWEA 3BV8A 4AD6A 2XZTB 3FQLA 4RU9A 2OO4A 3BO3A 2FVSA 4XO0A 5KFNA 4F50A 3KMSA 3HT0A 2IM2A 4K4XA 3T9ZA 1AZSB 1KSPA 1GQEA 4PQAA 3ZC4A 4Y0FA 2PI4A 4C98A 3PEJA 1FDDA 1H2VZ 1YRXA 2VDHA 1IM4A 3FNNA 3RB0A 1N33F 2C3MA 3I4HX 4J9LA 4C2MA 1S4FA 5IT4A 2VC1A 3C14B 3OT9A 4B3SF 4P9SA 5D77A 4WZQA 1ZOTA 3C46A 4K4SA 1XKUA 2RSQA 4R25A 5DM6Q 1Q53A 3R9LA 3RR8A 3MM9B 4Y00A 4LF4J 4Y3CA 3UDEA 2PSZA 3BGLA 5MLCV 1LOUA 4ZP9A 1NMEB 2FZGB 1S6PB 4LUBA 1DTQB 3W9JA 1H73A 4H4MA 3GFXA 1IR2A 2GX8A 2W24A 2HGNA 3MD3A 1ZYQA 3SV4A 4JV5J 3PW4A 1FFSB 1VIOA 3I9ZA 4TYBA 3PY8A 2N7YA 3V2UC 1SJ4P 1VQ8S 2UUCJ 3W2WA 5A2QU 4LRAA 4EUVA 4GVBB 2XGPA 5KFKA 4BS2A 2L08A 5KT3A 3JQKA 3MWBA 2CADA 1LK5A 3M8PA 1KLMA 1H6UA 1JLEA 3M6UA 3JB9j 5MAOA 1S6UA 1HNWF 4Z7YA 4DL0C 3IWXA 1D9FA 1QDUB 2QLWA 4AUKA 1RAOA 4LRDA 5E0OA 2HIQA 4Z37A 2V4RA 3UN5A 5B0CA 3AQPA 2EBEA 1X60A 1MN7A 2HBQB 4RL1A 1BQNB 4TNOA 1CULB 2HFZA 2IRYA 1WC6A 2PDAA 4ZVRB 1FWPA 3H4BA 2RS2A 5C24A 1GX5A 5L1IA 1N6QA 2OPPA 2HLUA 2ZZNA 4NE9C 4NCBA 2VG7B 2VG5A 1RWWB 4M63A 1HYSB 1S76D 5HANA 4DFMA 4R0EA 1FS2A 4NZ0A 1O6XA 2VPXB 3D28A 4QW8A 4J9SA 1VQ9S 4Z64C 2M8HA 2W9CB 3G82B 5JXSA 2HSEB 2LQBA 4Q2LA 5AE1A 4LF6F 3BEGB 2E5IA 2CRLA 3Q2TC 5BYQA 1M5PC 2ZEJA 2V8HA 2NUHA 1C0UB 2CA9A 3CD5A 3THPA 1UVLA 4HDHA 2CPHA 2JDJA 2RDJA 4B02A 1WOSA 4A8QA 1ZM3A 2LQ9A 4JI6J 3REZA 1GTHA 1JL5A 2Q1LA 5BYSA 1M90T 1OIAA 2A18A 3TSRE 1ZAWA 3GSDA 5H9FJ 3OR2A 1FFGB 5IC4B 4XPEA 3N6NA 4EBDA 1S0VA 3X1LB 1Z7XW 3ZYNA 2VUGA 2AJ4A 3GJSB 1TK5A 2GQQA 3EJMA 1QM9A 2BKNA 2FVRA 1IBKJ 3MMCB 3FSYA 4DJBA 4B9SA 2R7VA 1FE4A 4FYWB 3RZAA 4FXDA 2PEBA 2R7XA 5GMFA 1RU1A 2KVIA 1J5EJ 3OVSA 5I3UB 1BE4A 1V5IB 2J6UA 4WZMA 4YMEA 3GCWP 3DRYA 3P8BB 3UDLA 1BUXA 2HZVA 3FCVA 1SC6A 3FMWA 5T14A 2QTWA 1HBUB 2MQPA 5KFEA 4U7UD 4FZVA 2CXEA 2J9CA 3FMBA 5GADU 2HMIB 1WNEA 1APSA 2ID5A 3K7RA 4OX8A 3HI9A 5C25B 4KTQA 1KRPA 2XY7A 1EB0A 2V5HG 2X3DA 1U6ZA 2AZ1A 3MEEA 3QO9B 4UTGA 3CCQS 4OZ1A 3W3JA 4F4XA 1VK8A 4HTIA 2YNFB 1YRTA 1R6VA 2W2QP 3MM5A 5J1EA 3K2YA 2QLFB 3BSAA 2NZ4A 4F3QA 5ETVA 1S49A 1KR4A 1NHVA 1WJ9A 2XO6A 2DXFA 1NDKA 3OGMB 1YITS 3Q2SC 3L3CA 1TKTA 2DO0A 4ED8A 2DVIA 4X4VA 2RF2B 1VS3A 3TUJC 3AB4B 1MW7A 3M9NB 4PYDA 3DGPB 1JWWA 3LTOA 1W26A 3M30B 2V2KA 3HHKA 3R7BB 3THTA 5M2UA 3G6VA 2WQXA 1RAJA 5SZTA 4URGA 4Y61B 1B4SA 1N34J 1HA1A 4MKVA 3M2UA 3B8HA 4DR6F 1H74A 3T3FA 1VJQA 3VGUA 3QFWA 1D09B 1JLGB 1BHNA 2B7CB 2XI2A 3DN9A 3OXLA 3RBXA 3S6EA 3UNYA 1RISA 3GTYX 2E1PA 3KKFA 3TNVA 5IFMA 1D1UA 2P9EA 3QT8A 4M5IA 4IFVB 1S97A 2M4MA 1T11A 3M2VB 4ZVTB 1YJ7A 3MM8A 1SXLA 3KLGB 3K5LA 3IWNC 3OQ2A 2X7IA 4I7FB 2W2NP 3G6YA 4D3HA 1P1TA 3JSMA 2W2OP 4ES2A 4DV4F 3QWPA 1ZTTA 1ZZFA 1T7PA 5HROA 4J0MA 1XJWB 3LP0B 2RE1A 2OSRA 3KUEA 4OLPA 2LA6A 1X5PA 1UEVA 1D8YA 2V69A 2Q3PA 4CC4A 3QRRA 3K5MA 5HBMA 1F5AA 4Q5VA 1CQNA 2H5JB 5D0HA 1NB7A 2VFUA 1XIQA 3MFIA 2R9LA 1SQGA 4KSEB 3IO1A 3IS9A 1XMQF 4ERDA 1UFWA 2DGUA 1N5QA 5D4NA 4X4UA 1K0TA 5GMGA 4I6AA 2BM0A 3QT7A 4MKBA 3GV7B 4FS2A 2N7CA 3CIMA 3D67A 3DXBA 2R7SA 3KXDA 3DRXA 3DI6A 1JLAB 2RU3A 4PQUA 2OMUA 4GO7X 3HHLB 1RT6B 3IAM9 4M5GA 2BEXA 1FNMA 2XO7A 2L9DA 3SI8A 2CPIA 4GKKF 2FY8A 5SUHA 3C66A 4FYXB 2VA2A 1WTFA 4X66F 5LJ3Y 4IOCQ 4DL6A 3ELHA 2J76E 2QX0A 4KAIA 1OSCA 5GMKa 1UETA 4PG7A 4N5SA 2VH7A 4IDKB 1IBLJ 2OPQB 3SSQA 1SJRA 2BMBA 3ILLA 2Y0BB 3MTJA 4LF8F 1HBOA 2BM1A 4DSIA 4B3OA 3SSRA 3H4DA 4MH8A 4J9VA 1VLYA 3NRBA 4LJMA 2E7WA 2FJVA 2L3MA 3OLBA 5C2CA 3P3DA 2EFOA 2JHEA 2WONA 2GIRA 4L72B 4WBFA 4ZVSB 3A1YG 4USVA 2L48A 1SH2A 3PXGa 2HNYA 2OI2A 2CNNB 1WSRA 1YBAA 3FJ2A 2KM8B 1X9MA 4P91A 3DLEA 4DR2F 2V4JA 1WC0A 2VFTA 5DJBA 5A0YA 2YWKA 4OL8A 3KOAA 2XZWA 3D1HA 1HBMA 2OMYA 5KG6A 4V19J 2RJZA 3KLVA 1S1UB 2M8DB 5EX3A 3UW1A 1GXLA 6FD1A 1UZDA 3KFWX 2Z56B 3S1TA 3WPIA 1VJWA 2HQDA 2F8EX 5L8RC 3GV5B 3OSPA 4MKAA 1G4CA 2CQCA 3QIDA 4O4RA 1AXQA 3RYLA 2XG8A 4C3LA 5AJ3F 4QW9A 1HBNB 4CCHA 4C3KA 4RWXA 3OUYB 2PE8A 3MFHA 3ZNJ1 3OHAA 3SCIE 2CPZA 1H98A 2NXCA 3M8WA 4KGKA 2KH9A 1IKYB 2B8QA 3TW0A 1SKRA 3OJAA 4YS2A 3NAIA 2BANA 4H54A 4ZCLA 3DU6A 5DM7Q 1TVRB 1M5VC 3HJFA 1RHMB 1EJ7L 3HO1A 3NNHA 5CABA 1O6SA 1ACMB 2XSFA 4HDGA 4ZLJA 5HN0A 3KHGA 1X4CA 3CUNA 2W1BA 2N4DA 2GVZA 3IRXA 2RDIA 3M6WA 4YDDB 5LOQA 2Z0GA 5E41A 4ECQA 5F3ZA 3BQ2A 4E0DA 5FLXY 1B70B 1VLOA 3C15A 3V6DB 1LW2A 5K8MA 3ULUA 3I9V9 1NUEA 1VI7A 1XMBA 2AJQA 2EXUA 2A2DA 2E66A 1B7FA 3ZYIA 2ZH2A 2AGQA 3I0RB 1FVSA 3HXMA 3EICA 3PV8A 1OPIA 3MR7A 1FNOA 4OHZA 3F44A 3W3KA 1YK9A 5KOWA 5KT4A 4XOSA 1X4BA 3HT3A 1NJWA 1N5YB 2EVZA 4KKOB 3B4DA 2CQ2A 1Q5VA 2ZZTA 2HZCA 2DXEA 4ED1A 3MM7A 3IRWP 5CCLA 5D4PA 2A0FB 1FKOB 4DSKA 1PIEA 1JQGA 3G39A 2G1DA 4ZLPA 4ZOSA 5B4PA 1FT8A 2KVQE 3X3UA 1X0PA 4NA3A 3PYDA 5E7OB 3FDSA 4ZPDA 3DLBA 1HWJA 1EX8A 2RVJA 4DZ6A 1IBKF 5IT9Y 2DEJA 1FI4A 3FZ2A 3MAHA 1PC4A 2FJDB 3MPYA 1QVFR 1K44A 1S9EB 1FERA 4K4TA 4ZPVR 3D68A 3NKYA 3UFCX 1RCXB 3MR6A 2XYHB 1UJ4A 3RBEA 5A8KA 3A8KA 3GV8B 4V2DA 4USJC 2NS1B 4HT7A 4L6V3 4YEAA 3DLHA 2EWHA 4LF4F 2Y1RI 4NEZA 3WIVA 2ZDPA 2EFQA 2GHVC 4DPXA 2HWIA 2K1RA 3EDQB 1TUGB 4HH1A 1Y5IB 4ED6A 1EQ0A 1DTQA 1ITPA 2OPRB 1NAQA 4R58A 3KLEB 2JJ4D 1VC5A 2UUCF 2UXBJ 3CCTA 4WIQA 3SEOA 4ZIVA 4DBQA 2EW9A 2R2TA 3T5KA 3RR7A 4ED5A 4X65J 3GFYA 2OFGX 3D0IE 4PKIG 2HRTA 4PRFA 2DNKA 4JYAF 2C2DA 4O3RA 1KLMB 1K0VA 5AZ5A 2XMJA 3KG0A 4MIBA 5A8WB 1IUJA 3M1VA 5HLFB 1HMVA 4OYPA 2KJVA 2ZHOA 1AA1B 1U1OA 4JI7F 3OJSA 3MAAB 5EN1A 4JI7J 1H6TA 4NZTM 1JNZB 3LW5C 3OV7A 2DNNA 4OYXA 1UVKA 2WB4A 4N7TA 4LBIA 1MU2B 1X9WA 2C42A 3EXCX 3N28A 4ZJQA 1N6QB 4ZPTR 1NH7A 4NXMJ 4USWA 2Y8YA 2J0WA 1QE1B 2Z63A 4LSAA 5DDRC 2XC9A 2RR6A 2VG7A 1MMLA 2R8GA 1VQ4S 3W3NA 4OX6A 2D9PA 4O44B 1NCLA 2ZC4A 2F4VJ 4QWAA 2KHCA 4C4WA 1X4HA 3HD1A 2DHHA 2CQDA 2O5DA 4LF6J 3TZYA 3CEDA 3DHXA 4WP8A 3TVKA 1FX2A 3H98A 2J6TA 5AJ3J 1SI9A 4EWTA 2VBWA 3D5MA 3R5BA 4FP9A 3SQGA 3VQTA 2NZCA 4ED3A 2XULA 2QA1A 3GU0A 1X4GA 1NPRA 1RWNB 1NLKL 2K7JA 5K20B 3PW2A 2GO8A 1UEUA 3IAS9 4Q62A 2B0GA 2CWKA 1BXNA 4X4TA 4A8MP 1HNWJ 3OR2B 2QMWA 3QQCD 3CWJA 1F2HA 2ZD1B 5FD1A 4WFXA 3TJ8A 3RB4A 4LT6A 1RTIA 2DTJA 2NUUG 4ZA1A 3FC9A 5CMPA 5F8IA 4JI8F 2JE1A 2LP4A 2R8HA 4J9OA 2KZZA 4LFAF 1RWVB 1KFDA 3CDEA 2HHQA 4LFAJ 2BW2A 2GJIA 2SXLA 2DIUA 4IG0B 4NMXA 3TZZA 3CCES 1K47A 4OJ1A 1FQVA 1R31A 1S59A 4H4KC 4CO3A 2GVDB 5B09A 1VQ5S 3O6NA 1O6TA 1P8GA 1NSKL 1CC7A 1NM2A 2MQMA 2YKMB 4IRCA 3I6PA 4M1KA 3GPAA 4EGLA 4J9QA 1T05B 4NLUA 3VVUA 4NCGB 4ARNA 2VOOA 3CO0P 1Y4ZB 1UEKA 1UPPA 2PA3A 2WBMA 2RT3A 3NY0A 4LSLA 3W1YC 1B0PA 1QTMA 1DFDA 2CQ4A 4N77A 3N5FA 3CD0A 3GR1A 3DOMA 3MM5B 4PABA 2DJWA
chains in the Genus database with same CATH topology
3LO3A 3T6BA 1BD6A 2GO9A 2HFNA 3H59A 3WPEA 3DOKA 1WF1A 3C6UA 4C8NA 4FF2A 2RIJA 2EKYA 2RILA 1AFIA 4F4WA 5CYMB 1TKTB 1HNXF 2Z7XA 2AJQA 2RF2A 2YH0A 2ZFHA 1HHTP 5C5JA 2PGCA 2ZOGA 1CPZA 3GG1A 2XOTA 4QWDA 2HRUA 1FDBA 4LVNP 1TL3B 4R6GA 1ZTWA 3M2UB 3C6TB 1SV5B 3DRSB 2PO4A 5BYRA 2MSSA 5GS0A 5KFUA 2ILZA 1X4EA 5EHHA 4PSJA 2J0QD 5KTQA 4RNFA 1RT7B 3KLGA 2CQ0A 2FLOA 4KRWA 3K59A 3CGIA 4OIXA 5KG1A 4CT8A 4Y6IA 3DDKA 1JMTA 4OHXA 3HHDA 3KNGA 3P6YC 4DUYF 2J7WA 4KO0A 5CH7B 4ES1A 4K4UA 1KHWA 4U09A 3GR0A 4G3IA 2J9DA 4JI5F 4TQRA 3BZQA 2Y5QA 3DDNA 1S9GA 3I96A 2IRUA 2XMUA 3BSNA 2APOA 1HQEA 1K9MT 2NREA 2IM3A 1FRHA 1DTTB 1UP1A 5EDWA 3R1LA 1TZ0A 3CCJS 1FRLA 3RAQA 2NYIA 1YTYA 1M5KC 1S99A 4ZPAA 5IWAF 5KFXA 4PQUB 1HARA 3CMES 1BQMA 3JSRA 1GWBA 4GLPA 4P7VA 1H6KX 2YX7A 1JLBA 3G4SS 4DUZF 4WFAQ 5F0UA