1FO1A

Crystal structure of the rna-binding domain of the mrna export factor tap
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
240
structure length
215
Chain Sequence
TIPYGRKYDKAWLLSMIQSKCFTPIEFHYENTRAALKAVNYKILDRENRRISIIIELKPEQVEQLKLIMSKRYDGSQQVLDLKGLRSDPDLVAQNIDVVLNRRSCMAATLRIIEENIPELLSLNLSNNRLYRLDDMSSIVQKAPNLKILNLSGNELKSERELDKIKGLKLEELWLDGNSLCDTFRDQSTYISAIRERFPKLLRLDGHELPPPIAF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of the mRNA export factor TAP reveals a cis arrangement of a non-canonical RNP domain and an LRR domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein
molecule keywords NUCLEAR RNA EXPORT FACTOR 1
total genus 67
structure length 215
sequence length 240
chains with identical sequence B
ec nomenclature
pdb deposition date 2000-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09162 Tap-RNA_bind Tap, RNA-binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1fo1A01
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 1fo1A02
1K9MT 3BEGB 1VQOS 3THTA 1KD1T 3UWTA 2HZCA 2RRAA 2YH1A 1O6VA 5B4PA 3W3KA 5GVQA 3UCZP 2XNQA 3VAHA 5B0TA 1X4DA 1XEUA 2KXFA 5HO4A 1SQ0B 3O6NA 3U1MA 3G06A 1WG1A 3WPCA 2DNYA 2M8HA 3JB9j 2O3DA 3UE2A 4QC0A 1M5OC 4Y61B 1UFWA 4WFAQ 3CUNA 4IOAQ 4PKIG 3VF0B 1K73T 3CCUS 1K5GC 1OOKG 4NKGA 4ECOA 1DZ5A 3CCJS 5AWDA 1U1LA 2Z82A 2LA4A 2MQMA 4HQ1A 2YKAA 3G96A 3MI7X 2GHPA 2OMWA 3RIZA 2MY7A 1H2UX 3UL8A 5AZ5A 2DHSA 2KT5A 1HD0A 4TLQA 3CTRA 1Q7YT 2J0QD 1M0ZA 3ZYJA 2LQ5A 2ZJPQ 3CCRS 4P91A 3CCVS 2D9PA 5JVHQ 3SDEA 2Z7XA 1VQ6S 1UW4A 4IO9Q 1R8HA 1URNA 1VQKS 1FJ7A 2DNOA 2KHCA 4FCGA 1NU4A 5LXRA 1L3KA 3UN9A 1U1MA 1KQSR 1VQ7S 2E5IA 3C6OB 1P1TA 1YJNS 3NMRA 4Q3GA 3E6JA 3I56S 3G8SA 1VBYA 3I55S 2X1AA 2JRSA 3P49B 1SJQA 1OTOA 1A7GE 4KT1A 4TZHA 2X1GA 4Z79A 1M5KC 1X4BA 2HGNA 1UP1A 4YOEA 2DNKA 3DZEA 2CPZA 3G04C 1H6KX 4MQWX 4BV4R 2BOPA 1DFJI 5LJ3Y 4IM6A 1YTYA 1M9SA 2DISA 1FQVA 4U06A 2MPUA 4ECNA 2MZRA 1CVJA 1VBXA 1BY9A 3R1LA 1PO6A 2CQ2A 3RFSA 2DHAA 2DK2A 4R6GA 1NJIT 3UCGA 5LSOA 1X5OA 3VAMA 3V4MA 1P27B 2MMYA 3UL7A 2K3KA 2BEXA 1SJRA 1KC8T 1M9LA 4QXEA 5GQRK 3RW7A 2X1BA 3ZYIA 3UCUP 3GOZA 2RA8A 2LKZA 3H2UB 1OO0B 5IM0A 4TU8A 5CYJA 1P9AG 3EX7B 3B4DA 2LECA 1QVGR 1U1RA 2P1NB 3KJ4A 4H09A 2B0GA 2QA4S 3IWNC 3NS6A 3RJ0A 4P6QA 5DM7Q 4K17A 5GADU 3CULA 2Z81A 3SXLA 3CF5Q 3RW6A 1KOOA 1N52B 1VQ4S 4OZ0A 2XS2A 2DB1A 1F9FA 3OGMB 4RCAB 2MKHA 4Y00A 3TSRE 5IJDA 1WI6A 5GMGA 2VOOA 2Z62A 3E2JA 1OIAA 1WF1A 4V19X 1WI8A 5GAHU 4XSQA 2JVRA 2MYFA 1W2BR 2XNRA 1VQMS 2G4BA 3WPDA 4UQTA 3S01A 5JVGQ 3MUTP 2N3LA 2CQIA 3WPBA 3BO4A 1FS2A 1FNXH 2OMZA 2DH9A 3G8TA 2AYEA 2RRBA 4B8CD 1VQPS 1WEYA 1VBZA 3R27A 1X4FA 2HYIB 2M88A 5D3IA 2M0GB 1VC6A 1U1OA 3RFEA 2XB2D 2MJUA 4L3FA 3WPHA 2SXLA 2MQOA 2XS5A 3C6NB 3G4SS 2MQNA 2CQ0A 1O0PA 1N8RT 1VQ5S 4KNGA 1JL5A 2WQUA 2DHGA 4RU2A 3CMAS 3MDFA 1WWHA 3HHNB 4Q62A 3MURP 2QEXS 2OMYA 3BS9A 2UZYA 3B4MA 2KH9A 5AWCA 3WPIA 1YJ9S 3WPEA 5LJ5Y 2M52A 2CPYA 2DIUA 2FHOB 5ITHA 2P1MB 3MXHP 1SJ4P 2WQXA 1WEZA 3OGKB 3ULHA 2Z63A 1WG4A 5A5CA 1WG5A 4OQTA 5HDHA 4LXSA 1NO8A 5IQQA 3L3CA 1UAWA 4F25A 4ARNA 4CH0S 2ADCA 3LQVA 2DGSA 5GAEU 1AUDA 1OTNA 3W3GA 3P5TL 1YWXA 3Q2TC 1R8PA 1O6SA 2KU7A 4M7EA 2DITA 1WHVA 2DNNA 2EVZA 3SDEB 2RNEA 2LXUA 3G71S 1FO1A 3CC4S 2Z7XB 2RT3A 4R58A 1ZIWA 3VQ1A 2RVJA 3A79B 2DGXA 3P3DA 1DS9A 2F3JA 1WEXA 3CCSS 2Y5QA 4V2DA 2MZTA 3TO8A 3CCMS 4FXWA 1OPIA 2KN4A 2MKSA 1LTXA 5LSLA 4CNCA 3WN4A 2QFJA 2LEAA 2X1FA 1JMTA 2MKJA 2KG0A 3JB9k 3EGZA 2MZJA 2RS2A 2AD9A 2D9OA 3OW2R 2U2FA 3PMHG 2L9WA 1RK8A 3G3BA 5GS2B 3DXBA 4M7EC 2VONA 4R6AA 1U1KA 2CQBA 2KVIA 2NZ4A 4I6JB 1JJ4A 4PR6A 2U1AA 4CQ1A 4R5DA 1XWDC 2DH8A 4PRFA 2R9UA 2YTCA 2YH0A 2LMIA 4A8XA 2IFGA 3M18A 4FXVA 2ELLA 4XOSA 3US5A 1XN9A 1JJHA 1N88A 2GO9A 2O6SA 2M7SA 3K0JA 2DNMA 5DM6Q 2DGOA 2RU3A 1Q81T 4EGLA 2XS7A 2A3JA 2CQDA 3VAGA 1YIJS 2DNZA 2RS8A 2Q4GW 4UFRA 1U1NA 1XECA 2FC8A 4J4LA 1B7FA 1H2VZ 4PKDB 1SXLA 2N82B 1YHQS 3J7ZT 3ULAA 2CQHA 2V94A 1PGZA 2J8AA 2OSQA 1YI2S 2DGUA 5DDQC 1WF2A 2ZJQQ 4ARRA 4FDWA 2Q79A 3CCQS 1YITS 1M5VC 2DO4A 1Z7XW 5DDOC 2RR6A 2ID5A 4LI1A 2A0ZA 1FHTA 2VOPA 3G9CA 2JE1A 3VALA 4W92B 3Q2SC 2KM8B 4PERA 3PIPQ 1QM9A 2CQ4A 2E44A 2PE8A 5GAGU 5GS0A 3W3MA 2O6RA 1U2FA 2JX2A 1VQNS 2M9KA 2LXIA 4UY8T 2HGLA 3DLLQ 5LXYA 3CIYA 1D9AA 4Y0FA 2M8DB 4P8SA 4BSSA 4LMZA 3P72A 3W3JA 1QYYA 1FJEB 5HL7Q 2CQ3A 2DNRA 4QQBA 2PEHA 2G0CA 4NKHA 2OJ3A 1FT8A 2KYXA 3BO3A 3R1HA 3G3AA 4U67Q 2MGZA 1Q82T 1YRGA 2E5GA 3P6YC 2DIVA 1WF0A 3ZYNA 1WWLA 1IQTA 2DO0A 2M4MA 1WHYA 2MQLA 3CD6S 2V70A 3W3NA 1HL6A 4CC4A 2KI2A 2DGWA 2OMVA 3OGLB 2ASTB 1X4CA 3OJAB 2CPDA 2MY8A 1U0ND 3W3LA 4ZKAA 4QBZA 1X4GA 3NNAA 3G6ES 2DHXA 5FJ4A 2HGMA 1SJFA 1K5DC 2HVZA 2MKIA 1DRZA 3ZZZA 4TU9A 4AW4A 5IJBA 2EK6A 2VODA 2RUGA 2MXYA 2OMTA 4RWTC 4Q3IA 1KOHA 1K8AT 4GT6A 2OTLS 1X4AA 2D3OR 4XGOA 4CILA 2JVOA 5IJCA 2N7CA 4CH1A 5IM0B 1VQ9S 1A9NA 4TU7A 2CJKA 2J0SD 2LYVA 4LSAA 3RGZA 3H2VE 4Z61C 1OGQA 2J76E 4LI2A 2I2YA 4BS2A 2MQQA 3VQ2A 4CIOA 2YWKA 2AYGA 4U09A 3UL9A 4CC4C 1U6FA 2Z64A 4BSRA 2FC9A 2DGTA 2Z65A 2XOTA 3RGXA 1U6BA 1RKJA 3IRWP 3WPFA 3VAKA 4R09A 1ZZFA 1XKUA 3UD4P 2WQWA 2CQCA 2MKCA 4C0OC 3D2WA 2P1PB 4KXFB 4W90B 1M1KT 2KXNB 4FMZA 2CPEA 2OIHA 1VC5A 4BSUA 5GMFA 3S8SA 1N54B 5H1SV 3CC7S 1O6TA 2UZXA 5AWBA 3SMZA 3S7RA 2KG1A 1S72S 3ULVA 3PIOQ 4R07A 2DNHA 5AWAA 3CIGA 3CMES 5IYXC 1X0FA 2L41A 4ERDA 4F02A 4LIRA 1A4YA 3M19A 2AYBA 4LJMA 3CXCR 1G2EA 3E3ZA 1W8AA 5CA5A 1GWBA 2ASSB 2O6QA 2OTJS 1FXLA 4Z8GA 2OMUA 1H6UA 4YB1P 4PEQB 3THPA 2WFHA 3BO2A 4LSCA 4V2CA 5CMPA 3ULUA 1XCDA 1H2TZ 2JE0A 2NLWA 1OWXA 2CPJA 3J7YU 5LFNA 2V9SA 2DNPA 1QVFR 4GLPA 1M5PC 5D77A 4U08A 3FEXB 2XWTC 1G9UA 1ZH5A 2P1OB 2ERRA 2DNGA 1M90T 2DNLA 2F9JA 3MD3A 1H6TA 2LCWA 5DETA 4C4WA 4WF9Q 1FJCA 4C2AB 1P8VA 4QU6A 3REZA 1X4HA 2V9TB 4CP6A 1U1PA 5HZLB 1PGVA 4LSXC 4MN8B 1X5SA 3MD1A 2MSSA 3O53A 1VQLS 3CPWR 3G39A 4C7QA 2RQ4A 2CQ1A 4WFNQ 4R5CA 1A9NB 2MB0B 2ADBA 3CCLS 3N9UC 2KXHA 2OSRA 2DH7A 2MKKA 2OMXA 2MQPA 3MUVP 2KFYA 4R6JA 4J0MA 1OTMA 2MZQA 2WQVA 5B0NA 4QU7A 4R08A 2E5HA 5GMHA 3S6EA 3VAIA 1OZNA 4IUFA 2BNHA 2E5JA 3OJAA 1D8ZA 2FPHX 5CMNA 4OZ1A 4M5DB 4LXRA 1S79A 4PQ8A 3WPGA 2CQPA 4WYKA 2M70A 1M10B 5D78A 5IFMA 2MGZB 3MOJB 1VQ8S 4LSXA 3BZ5A 3C6PB 2CPXA 2MJNA 3ZZYA 4FD0A 1WELA 3HI9A 1WHXA 1JJ2R 1P8TA 4FS7A 2F9DA 1VC0A 1WTBA 4R6FA 1D0BA 1X5PA 2L08A 4YEBB 1ZZNA 3CCES 5MLCV 2P1QB 3CC2S 3VAFA 4WCEQ 2WBRA 1U1QA 3U1LA 4AY9X 4C2BB 5EN1A 2MHNA 2KRBA 3TYTA 1WHWA 4Z2XA 2DGQA 2MZSA 3FEYB 3LPYA 4U7LA 4V2EA 4G8AA 2M2BA 4Z94G 3ZYOA 4EZGA 4R0AA 2KRRA 3UD3P 2LEBA 4FHOA 1SJ3P 2FT3A 2ZJRQ 5CXTA 1DHMA 3NS5A 5BJRA 3FXIA 2MSTA 2K8GA 4QPTA 5FTTB 2JQDA 4F26A 2N3OA 3EGNA 5GMKa 5DDPC 2FY1A 1HA1A 2MZ1A 3MUMP 4WFBQ 1DBDA 2CPIA 2AYMA 4RCWA 2G1DA 5DDRC 3TP2A 3NNHA 4IOCQ 4L3AA 3SB4A 1X5TA 3CVRA 2CQGA 2UP1A 2CA6A 1DCEA 3E4GA 2JWNA 4YUDA 1IO0A 2RQCA 4CNMA 4Z64C 2I38A 2BZ2A 4J5OA 1Q86T 2CPFA 4ED5A 3RFJA 2CPHA 2DGVA 2LA6A 2Z66A 4WKRA 3NNCA 4WIIA 1X4EA 2DNQA 2XSFA 4WP6A 2KM8C 4PSJA 1HD1A 2EK1A 3VAJA 1YJWS
chains in the Genus database with same CATH superfamily
4U95A 1U0SA 2OPPB 1VQOS 4NA3A 1YRTA 2AZ1A 4O3PA 4ZCIA 4I6AA 2W9CB 1SJ1A 3PJWA 2W25A 2IVMA 3ILIA 2V4JB 3FKBA 2BUNA 4YDXA 4CO5A 2ASJA 2ZBQA 4EBDA 2W2QP 1SCJB 2YNIA 1X4DA 2BJ3A 4FYDA 2D69A 8RUCA 2PI4A 1QAIA 3IR7B 4F4ZA 1HYSA 3RBDA 1WG1A 2IJRA 4LF8J 2JHEA 3WPCA 2QRRA 3UVJB 4KE5A 2O01C 3QIPB 3KK3A 4C8YA 3D28A 3R5JB 4ILLA 2UXBJ 1UFWA 2H65B 2HS4A 3TA0A 3V6DB 4IOAQ 4OZ2A 4K4WA 1T9WA 4XAKA 3M8QB 4R0JA 4XO0A 2Z82A 3QGIA 4WZMA 3PW5A 2YKAA 3F73A 1ITPA 3GJRB 2GHPA 3RB6A 1NNDA 2B5JA 1CQMA 1RWVB 2VBWA 3WX8A 3WIUA 3EMTA 3EZUA 3NCPA 3NGKA 4OI6A 4DFPA 2XC9A 2XLKA 3HKWA 4G1IA 1R27B 2Y0BB 3OXGA 4KKOB 3TUJC 4YY3J 5DQHA 2LQ5A 3HXMA 1L5UA 2FLNA 1XNRF 1QAJA 2XZTB 3RYLA 3RB3A 1R31A 1HNZF 1WDDA 2V9KA 4OYBA 5HMZA 2BQRA 3SDEA 1BGXT 2IYGA 1VQ6S 2RSQA 1CEZA 1B7YB 1FESA 1P6TA 2DD8S 2EI5A 3AOAA 2IDLA 3LGMA 4MJKA 4OI1A 3UQSA 4MTPA 2W7OA 2XHWA 1VQKS 1RAGB 1FJ7A 2KHCA 4U8YA 3ISNC 3TOQA 5LXRA 1T7PA 5D4LA 4OYAA 5F3ZA 2DVIA 3TWZA 4U96A 4A8KA 1UWBA 1VQ7S 3NOGA 1RHMB 1P1TA 2JZ5A 5RUBA 3T5HA 1YJNS 2JEFA 4O3NA 1FE4A 3ETMA 3I56S 3M6XA 4DZDA 3I55S 1VBYA 4OZNA 4P9SA 4XDDA 1A7GE 1IJEB 1URRA 1YRUA 2V8GA 3BSNA 4KT1A 1TK5A 1JLGA 3T1HJ 2K7KA 3GPAA 5E2QA 3WIVA 3V6HA 1HHQA 3M2VA 1IKYA 1KLMB 2DNKA 3H2LA 4FPRA 4RW7B 3CIMA 5M2UA 4ECXA 4BV4R 5LJ3Y 3MECB 2ZBRA 4TY8B 3CWJA 4DV0F 3M9OB 4WTOB 1RHKB 2VKZG 3RAMA 4C3LA 4O4GB 4XPCA 2LEPA 3BDEA 2MZRA 3I87A 4DG1A 1BY9A 3IBFB 4HT7A 3R1LA 1EIYB 4B3TJ 4CDIA 1S0VA 1Q8BA 2LXFA 3DU5A 4IFYA 3RJMB 4NCGA 4R6GA 2FHMA 3DRSA 1N5YA 2KJWA 4OX8A 3DI6B 4OJ3A 5LSRA 4DQSA 2V68A 5I42A 4LFAF 2MMYA 4CLFA 4FVMA 2K3KA 2UUWA 3FEZA 4PG6A 2BEXA 1M9LA 2B43A 1KDNA 3IG1B 3D7SB 1JWWA 3CCWA 4OJ1A 5IC4B 3R9LA 4HDGA 2PA3A 4ENOA 5IZHA 3BF4A 4DPYA 5DGBA 1ROFA 3GJSB 3H2UB 2Z56B 5IM0A 1FXRA 5CYJA 3OTOF 1P9AG 3UO0A 3B4DA 1R3NA 3FCVA 4Y34A 2QMWA 3KK1A 1QVGR 4LFCJ 2PFFB 1RAHB 5J2MB 2KO1A 2CDQA 3K5MA 4F0HA 3IWNC 4BWJA 4P6QA 4K17A 3WHIA 1HFEL 1TUVA 3U7JA 1VRUB 3SXLA 3OFGA 4DR1J 5LM7E 3CF5Q 4DSLA 1KOOA 1N52B 1JLBA 3TEGA 2B7BB 5CYQA 3TSRE 2QFIA 5IJDA 3I6PA 1TKXB 5GMGA 3E2JA 2Z62A 2XHCA 4UFRA 1BQNA 4V19X 4YR3A 1VMBA 1WI8A 1ZM4A 4WFXA 2CJAA 1RISA 5HMYA 2CZ9A 3KK1B 3AOBA 4LF1A 1W2BR 4FDFA 4UY85 2DXEA 2XNRA 2NUUG 3PYEA 3HHLA 5JVGQ 5EGYA 3CDBA 3MUTP 2PIIA 2N3LA 4OHXA 3BO4A 3IG1A 5GAHI 3SZ2A 2OELA 3GFZA 4QIFA 1HIYA 3G6VA 3R27A 5I42B 2ZD1B 4BBYA 2QLJB 3C8YA 2IDEA 2M0GB 3DI6A 4FVCA 5M2RA 4CO3A 1N5YB 1C4AA 2JEGA 1DTTA 1K1SA 4NCGB 2SXLA 3Q0AA 1RAIB 2DPJA 2XS5A 4B08A 2GFFA 4M95A 2BMBA 2JC0A 3KG0A 1VQ5S 1NK4A 1RT1A 4NLTA 4CNYA 3LO3A 4O4GA 1S76D 1M5SA 3ISND 3MDFA 3DRRA 3MURP 3HHLD 1HBMB 1RA7A 2H5EA 5ETVA 4ZLJA 3W5XA 3MECA 1SQGA 2G13A 3BS9A 3KUHA 3TNVA 1FD8A 2KH9A 1KNZA 1M10B 1WC4A 1XR7A 2OD6A 3FCWA 4RW7A 2VFVA 4F04B 2M52A 5ADZA 3WPEA 2N4DA 2DIUA 2FHOB 5FIIA 5GAGI 1U25A 2UXCF 3KDNA 2F4FA 2ZZNA 5SZTA 4ZMMA 3CDAA 5BYSA 3IM8A 2UXDF 4KGMA 3GSIA 1J5EJ 2HLTA 1WG5A 1VIOA 3JSBA 4N8OA 4KPYA 3OVSA 5HDHA 3GP9A 1UWBB 2GC8A 4HL9A 2IHR1 3J7YI 4LXSA 4I7FB 3BH7B 1SUQA 1RHRB 3MTKA 3PCOB 2ADCA 1XNRJ 3LP2A 2DGSA 1XTZA 2RILA 1AUDA 2W7AA 4JI3F 4JI3J 2CNLB 1WOPA 1NSAA 3KJFB 2R2SA 1RAAB 4OYXA 3DGVA 1R8PA 3BREA 2R2UA 1C1BA 1WHVA 3GR0A 4C8KA 1LW0B 1TQLA 2B6AA 2LXUA 1FO1A 3OTDA 2V8HA 3QT7A 2FVQA 1ZIWA 5L1KA 2ZE2A 2FZKB 1X31C 3QGHA 1I51B 5ETQA 1N5QA 1RP5A 1ZM9A 3SCLE 4EEYA 1EJ7L 3BM7A 3CCSS 2BJ1A 4V2DA 1N32F 4DV3F 1NHKL 3O8WA 3SEOA 3EXCX 1VQSA 3CCMS 1IN0A 1OPIA 3OT9A 4KGZB 3RRGA 2YKNB 3DRPA 5E3PA 2F1FA 4CNCA 1WOSA 1ICEB 1KONA 3K8VA 1EKRA 2A2DA 2MKJA 3JB9k 1O5JA 4N77A 2X51A 1B70B 4NL5A 5DZ7A 1NDPA 1P9YA 2BX6A 2D9OA 1IKVB 4L3KA 4B9NA 2GVZA 2U2FA 2HQ3A 2WVCA 4X4TA 2C3MA 4ZPWR 3PMHG 4OLOA 4DV0J 1IQZA 2HHSA 2OHDA 1CC7A 5KFZA 4N76A 4M7EC 2YKNA 3DRPB 2IBKA 3GFHA 3KJNB 4DU8A 2ASLA 2J7UA 4G1PA 1OSDA 4F50A 3KLIB 2ZBIA 2KVIA 2DKOB 1U6ZA 3DRXA 3D0GE 4ZVUB 3DDNA 5A8WB 3KHLA 1SKSA 1JJ4A 1S7HA 3V81A 3BGUA 3E3XA 4XDCA 2C28A 3LPEA 1WNEA 1VHIA 2R9UA 1N0UA 3QRPA 5I4MA 4A8XA 3M18A 2IFGA 1S9EA 4FXVA 2QO3A 3CJRA 3CJQA 3IXQA 4KV8B 3W2VA 4XOSA 2HS0A 2CNKB 2M7SA 1C1BB 2O6SA 2KT3A 4QPXA 4JI5J 2QN6B 4WP8A 5HLFA 4JV5J 3LGNA 4IOBA 3NBPB 3TUPA 2WQXA 1FX2A 4WU3A 4EGLA 2CQDA 3NEKA 5A8RB 2ILZA 5KFWA 3MFHA 2W8KA 4LF6F 2KFNA 2AMCB 5A6PA 3PW2A 1S1WA 2RB7A 1B7FA 4J4LA 3FUYA 3UD5A 1YHQS 1RAOA 4ZVSB 9ATCB 4JP8A 5ETOA 1QLNA 4OLPA 3EDRB 3Q8SB 4ZLNA 2OSQA 4ECSA 3CD7A 4PCQA 2UVWA 3L7PA 1GQEA 2IJFA 3A3NB 5HBMB 4QWAA 4YB6A 4BDPA 4JI0F 2AGOA 4ARRA 3GZ7A 2H1YA 4Y6IA 2Q79A 4QJVA 3D3BJ 1IWGA 2DO4A 1BQMB 3HLUA 4QR1A 2HVHA 3OLAA 1MN7A 1Z7XW 5C7PA 3PR4A 5DDOC 4HHHA 4L76A 2BXJA 2VOPA 1NBEB 2VBYA 3NL0A 3MEKA 4DR6J 2ZKTA 2UVVA 4WK1A 1OY8A 1S57A 3AQPA 2ILYA 2HBRB 3O1LA 3PIPQ 1N34J 3W66A 2IMWP 3W3MA 1F5CA 2NPIA 2RIJA 1X9WA 1SKWA 2O6RA 1U2FA 2RE1A 4LR9A 4FBTA 1VQNS 1QTNB 2W2NP 2B9WA 3CW2C 4OHZA 1DTTB 4DI6A 1Y9OA 5KFYA 5JUMA 2EFGA 1M1HA 2CZ4A 1HPZA 2AJ0A 1PYTA 3O44A 1UVKA 3W5ZA 3KLEA 3CSKA 5KOXA 3D68A 4CLLA 4BHQA 1VLYA 1S97A 1QE1A 4ATNA 3TUIC 2V0NA 2PEHA 4ZJQA 2ZUAA 3TA1A 5F0UA 3BO3A 2CRLA 2OPQB 2CDRB 1OY6A 2WZ1A 2QIFA 3CJTA 3T19A 4CT8A 5IQ6A 4KSEB 4PXEA 4K5RA 1IQTA 2DO0A 1HL6A 2I1RA 4FKXA 3VCDA 3I0RB 1NKCA 3OGLB 2OP5A 4LF8F 2X3DA 3DMJB 4RW9A 3GIKA 1YZ7A 2F5GA 1KVIA 4QBZA 3W3LA 4DF4A 2DPIA 1X4GA 3BR8A 3D1HA 3IWXA 4M1KA 3VZIA 4CI0B 2HGMA 3JTPA 4ZP6A 1SJFA 3OLBA 4XIUA 3D67A 2MKIA 4JI7F 2KYZA 4AW4A 1VRUA 2EK6A 2D3O1 5KFAA 1D09B 2MXYA 1N5VA 3D0IE 4KT0C 2AGPA 2OMTA 4C11A 1FRHA 4JYAJ 1GX5A 4IO1A 2GMJA 1K8AT 4XGOA 2JVOA 4ZVGA 3VV2B 4TLRA 2N7CA 3KJVA 3M8SA 2UXBF 3I96A 2CJYB 2EFOA 2ZWOA 4GKJJ 2OO4A 2YNFB 2CKWA 1U2RA 3ZNUA 1E6VB 1EAYC 1EHWA 3I4HX 4KO0A 1Y5NB 2V67A 2G2YA 2YKPA 3RUBL 5KAKA 4YP3A 1T3NA 3E2EA 1OGQA 4K4VA 1RTDA 4BS2A 2AKWB 3HPOA 5FD1A 3KK2B 2IRYA 1RBLA 2YWKA 1H72C 4A8MP 2AYGA 4U09A 3RBEA 2VQEJ 4DBQA 3RGXA 1ZAWA 2GAGC 3SSQA 2HBQB 5HROB 2HG4A 4DV7F 4DR2F 2WRMA 3HT3A 3PR5B 1DCEA 3FSXA 1XKUA 4LRAA 4P75A 3W60A 2FLLA 4XK8C 2P1PB 5M2PA 1FDDA 3CJ5A 1X60A 1M1KT 3GIIA 2DR8A 4F3MA 3FRYA 4BSUA 4LBPA 7FD1A 2DBBA 1QY7A 2PMWA 3JS9A 1WSRA 5B08A 5H1SV 4ED2A 2ZVSA 2C2MB 4K0KF 4FNHA 2RJZA 5A2QY 3M2UB 3SMZA 3K5NA 4LF7F 2HFVA 4Z64C 5B7WA 2OD4A 3PIOQ 1NJWA 4R07A 4NLRA 2N7YA 2DNHA 4PYDA 4K7QA 5KFPA 1EB0A 4J9SA 2L41A 1SKRA 1DY3A 1RU2A 2COLA 4NLYA 4LIRA 4PXCA 5D0HA 4F02A 1A4YA 3CXCR 4JV1A 4Y65A 4FF2A 1F2GA 1W8AA 2AJFE 2ASSB 5F8MA 4CLUA 3D6HB 4Z8GA 3KYLA 2GX8A 2Q1LA 3M32B 5F8JA 2GVDB 2LFVA 1UETA 2K2PA 3THPA 3BO2A 2QL7B 1W25A 1OYDA 4RBVA 3S1TA 3ZZUA 1TR0A 1YJ7A 1AUSL 1NUEA 2CJ9A 4PG7A 1R0AB 4DR6F 1DJ0A 2Z8QA 2GW8A 4C48A 2BDPA 5AE2A 4CO1A 2C2ZB 4RZRA 4MIWA 1NEEA 2V9SA 3OTEA 3JAMY 4NCBA 4U7UD 2FHJD 3QWPA 4KKOA 3TRGA 3ZFVA 4DFKA 1M5PC 1N32J 4WTYA 4U08A 1V5VA 1ZH5A 2P1OB 2W24A 4KC5A 1I94F 2DNGA 2JEJA 4A8YA 4A4JA 3DLHA 1LQ9A 2B5JB 5EHHA 2LCWA 5DETA 5AJ3J 4M8LA 3N5FA 5HVFA 2R4FA 4C2AB 3REZA 4PG8A 1U1PA 4WK3A 7FDRA 5L39A 2R8GA 2HHUA 4KO0B 1GMUA 4PAAA 1I6JA 1XNQF 1L3UA 2B7CB 4MN8B 1K47A 4NZ6A 1F2HA 1VQLS 1OY9A 2BACA 2MKYA 3HFVA 4ZHRB 4OYZA 4NRTA 3QIPA 2XMTA 4R0EA 3TJAA 1RHUB 2K1RB 5DQIA 3KJVB 2F40A 3KK3B 2KXHA 2HYIB 2DH7A 4OYOA 1FERA 4LSLA 5D0RA 2OMXA 3E01B 2BVZA 3MUVP 4OFZA 2AX1A 4YDDB 2LQ9A 4GC6A 2Y1IA 4RW4B 3PO4A 2EFNA 1S6OA 2HFSA 1R7IA 2YNIB 2MZQA 3SSRA 4FBUA 2WQVA 5HMXA 2JE0A 2E7WA 3P8BB 4R08A 1K44A 3CVKA 3S6EA 5T14A 1UFLA 1OZNA 3G6XA 4IUFA 3OFHA 3MCMA 4GVBB 5C24B 3KLVA 1UFKA 3MR5A 4TN2A 1TL1A 2BNHA 2W9AA 3CT9A 3HO1A 1BC6A 2WVBA 2HHTA 2E5LJ 2Y0SD 4PQ8A 1JKHB 1CJTA 1FTCA 2CQPA 5F9NA 5D78A 4F2RA 2D3ZA 1HNIA 4YB7A 3BZ5A 3CB4A 2CPXA 4NRUA 2VPYB 1TL7A 5C2CA 4ZVEA 1QE1B 5LMUF 5AJ3F 3W9IA 1WHXA 3M6UA 5DQGA 3BSOA 4USJC 2F9DA 2C3UA 3MGJA 4R6FA 3LF0A 3JQMA 1HPZB 2J8SA 4TYAA 2JLEA 2P8IA 5E3RA 3BQ0A 4FF4A 3CIZA 1XR5A 1N5SA 5MLCV 3JYTA 4R6JA 4O44B 3DHWC 3CC2S 3VAFA 4X4VA 3TJ8A 2YWHA 3W63A 2MHNA 1HKAA 4O23A 3D9BA 4NYPA 4U7LA 3GG1A 3UR0A 4A8SA 1RYRA 3UN3A 5CCLA 4G65A 1KQGB 4RX6A 4USVA 4G8AA 2RKIB 2LEBA 2E9TA 4J9RA 1K0TA 2J6TA 4NLSA 2ZJRQ 4B3OA 1XMBA 4FS1A 3HVAA 2JC1A 2K8GA 3TW0A 4F4YA 4IR9A 2N3OA 4DUYJ 1XMQJ 3EGNA 1HMVB 2UZAA 5DDPC 4P73A 3MUMP 2FY1A 3P45B 3VGSA 2AYMA 4ID8A 1U45A 1TU0B 2G1DA 1RWNB 3AA9A 5HBMA 5IWAF 4C8LA 4RR5A 3NNHA 3D6TB 3A8KA 5H9FJ 1C2PA 2IC3A 2LU2A 3IC1A 2IA6A 4ZCLA 2E29A 2XWYA 4GO5X 2A18A 4WU2A 2XGQA 1IO0A 2RQCA 2HHVA 1S1TA 3OBIA 1IBLJ 2LA6A 3Q8YA 2QMUB 5CZVA 1CJKB 4WKRA 4WIIA 1KQKA 4LVNP 2L9DA 1MMLA 1YJVA 4OZJA 2KDOA 4YFUA 1IM6A 1XEZA 2RQKA 5HI7A 4A47A 3D1OA 4KV8A 1VISA 2Z2MA 3G2XA 2VHGA 1S9EB 3PX0A 1QVFR 3THTA 3CMQA 2PFDA 4H4MA 1KD1T 1JXLA 1O6VA 3H4BA 4OJHA 1S0NA 3W3KA 5GVQA 1IKXB 3BQ2A 2F63A 1T9YA 4DR4F 5IT9U 2OLWA 3LP0B 3TZYA 5AXLA 2KXFA 4HACB 4CO4A 3EE3A 3NGUA 1SQ0B 5E3CA 2FYXA 1FX4A 2MLZA 2OFHX 1RAFB 2W2PP 4X65F 3JB9j 3UE2A 2FUG9 1Y4ZB 1FRLA 2UUAF 3VGUA 3DOLB 3IRXA 1M5OC 1H38A 1PCAA 4Y61B 1LXJA 4ZVPB 2GO8A 2EEYA 2PMHA 3EZOA 3MPWA 1R43A 1RWOB 1SPBP 4GRSA 4UOGA 4UUXA 2B9EA 2QMXA 2DRBA 2I5JA 1DZ5A 1SC1B 2GZOA 5AWDA 3RB4A 3NLCA 3MCSA 2BA9A 4KHPF 4FS2A 2OMWA 1H2UX 3PG9A 5KFLA 1RWPB 4ZVQB 4CLKA 4IH5A 2B4UA 2DHSA 5SUHA 4ZIVA 4QYRA 2FVSA 1HD0A 1XJWB 1ZM3A 3CTRA 4TLQA 4WYLA 2JLGA 1U47A 3FQLA 1X8DA 1FJGJ 4LR7A 1TL3A 2B8QA 2ZE2B 2BJ9A 3CCRS 3CCVS 2D9PA 1GFWB 3K17A 5JVHQ 1GNKA 1LW0A 4TXSA 3DM2B 4ZPTR 1U8WA 1UW4A 2ATCB 4RU9A 4IO9Q 5LMNJ 1R8HA 5KFUA 3DNCA 2V69A 1JLQA 2AP6A 2Z2ZA 4HEA9 1R8CA 3UN5A 4FYYB 4DQPA 2CUYA 2DNOA 3W64A 3LP2B 2BR0A 2VASA 2WB4A 1L3KA 2Z2LA 3DHXA 2RH3A 4YY3F 2XMUA 3B82A 2CIMA 3BKFA 4I7FA 3NGDA 4DV5F 1NJYA 1PIEA 3IWLA 1JJCB 1FRIA 2E5IA 2G0JA 4WPAA 3C6OB 4Q45A 3G8SA 1L3SA 2XO6A 4CLZA 1NJXA 4B9LA 3P49B 4X64F 4KHPJ 1OTOA 4H54A 5CYMB 2OKQA 2ROPA 3BGRA 2XMAA 1M5KC 1Y7PA 3CO9A 3HP6A 2XY5A 2WSFC 5ETKA 1QSLA 4IM6A 1CS4A 3HHKA 3MEDB 3QLHA 4DUYF 2IAJA 1YTYA 2HK3A 2DISA 5HSPA 1D8YA 1HBMA 1FRKA 1YSJA 2A6MA 2QT7A 1GXUA 3AH6A 3D54A 1TELA 1T95A 2EFQA 3J80Y 2V6AA 3KMSA 2KVQE 3A12A 3ZZ0A 1VBXA 4LF9F 2UU9F 1Q8KA 1BHNA 3ZTRA 1XWLA 4DSIA 2CA9A 2DK2A 2RQMA 1NJIT 1RT4A 3ENAA 4I2PA 3VAMA 5H9EK 2YX1A 2ZD1A 3M8ZA 3V4MA 1P27B 4K4XA 2OFGX 2W4PA 2H3EB 2OUGA 4HH0A 1SJRA 4ECYA 1RB0A 1KC8T 5GQRK 2X1BA 4DMZA 4LF6J 4KHRA 5EWFA 1CJVA 4LRBA 4W4MA 4LF4J 3GOZA 4DF8A 4NOHA 3LWMA 3JSRA 3HHLB 1LWFB 5D3GA 2WB1D 1WC5A 2IVYA 1KS2A 2HQFA 3ITHA 4X4SA 2DXDA 2VQFF 2HHWA 1U1RA 3KJ4A 3K89A 1FKPA 1FXDA 1SQFA 2B0GA 2W4DA 2CYYA 3JQKA 2XO7A 2QA4S 1TKXA 5GADU 3CULA 3LGHA 2P9EA 3DOMA 4LSNB 5I3UB 2EFPA 1KTQA 1YRXA 2EG1A 2KL8A 4HHUA 4HT5A 3SQGB 3VQSA 2ZH2A 4GC7A 1IJFB 1RHJB 4M5NA 5DS7A 2VFTA 3OGMB 2LDYA 2LLZA 2YBVA 4Y00A 4JI8F 3HULA 3QFHA 5J1PA 1WI6A 1UJ5A 4DDFA 3KHHA 4ED8A 1ACMB 1WF1A 2VZ9A 1NLKL 4XSQA 4RW8B 5J2MA 1KP6A 3UPFA 2EC0A 2MYFA 5G0RB 5KFOA 1RWKB 2WVDA 1VQMS 4HKQA 1BXNA 1Y3JA 2ATLA 1TP7A 4RNMA 2WOMA 2HWTA 3K7RA 1I1GA 1GK8A 2MHEA 2ZBPA 3VGVA 1QSYA 4IFVB 3CJ0A 1FS2A 3WPBA 2WW8A 5KFXA 2RRBA 3ZTOA 4DL5A 3CJ3A 2VKRA 1W2IA 3MF5A 3WZ0A 5H9EJ 5C5JA 2Q3PA 4DV6F 3TI0A 5D3IA 1VC6A 5E41A 3IR6B 1AA1B 1U2CA 4IFYB 3I0SA 3KLGB 3KKFA 2ZUGA 4QWEA 1FRMA 2VDIA 4R25A 3W5YA 3NMAA 1O0PA 5B0EA 4RU2A 4LFBF 1WWHA 4U8VA 4LUBA 1MU2A 1RWMB 2OPRA 4TY8A 1S77D 1EP4B 2ZKUA 3KHRA 2HURA 2I9SA 1ZPWX 2ZC4A 2BM1A 3KWMA 1GX6A 5A76A 1IKYB 1KLMA 1XIQA 3T1AA 5LJ5Y 2UUBF 4M5GA 3C2PA 1Z4UA 4MK8A 3LWLA 2V8VA 4X4UA 4NLXA 4MFBB 1R0CB 4JI2J 3G87A 3EGWB 4K5SA 3IAS9 2JH3A 2AX0A 4L75A 3CD6S 3OGKB 4NYOA 3IMQJ 1EETB 5KT2A 4DQIA 1IM4A 1XECA 3Q23A 2EWHA 1WD6A 3HFKA 1PYOB 4DR5J 1MROA 2CFXA 3ENVA 1RTIB 2V2ZA 4ICLB 4CH0S 4ZCMA 1VOMA 4DSJA 4G1QA 4KTQA 3LQVA 4ZVFA 3DN9A 4KHMA 4ELUA 1Z2LA 3HD1A 2G9OA 1JX4A 4OZ5A 3T1YF 5DLFA 2E1RA 1O6SA 3A1YG 5GMDA 3MR7A 2NXNA 4M7EA 3RRHA 1R6YA 3CJKB 3G71S 3SDEB 2ZITA 4IG3A 2H48B 1HBNA 2RT3A 1S6QA 2V9WA 2VPXB 3VQ1A 1AFJA 1N33J 2HPUA 5DZ6A 3AXKA 2BE7D 3H8YA 4HTJA 6AT1B 4QWCA 3H4DA 1Q5YA 3A79B 2UXCJ 4WE1A 4AXIA 3IGNA 2Y5QA 4I64A 4H4OA 3TO8A 5BXIA 2XSJB 3T5JA 3V4IA 3FVYA 1RTZA 1U09A 5GMEA 2KN4A 3DLEA 3V6JA 3PM9A 2AWZA 1T05A 5LSLA 1S5ZA 3LW5C 3ZTPA 2X1FA 2KG0A 2YXLA 3T6JA 1UZDA 3M8QA 1G7CB 1JLFB 4JB8B 2R3VA 2YY3A 4KR0B 1KQFB 3ZZTA 4B3SF 1CSJA 1WJ9A 2VG7A 2FVRA 2MLXA 4PZVA 4CLYA 1RXOB 1RK8A 4G6VB 2BKNA 2QSWA 1T94A 3DXBA 2XGPA 1MLAA 1A0OB 4MT1A 3PFOA 5HJYA 4R6AA 5KFCA 1FF2A 1HWUA 3QYYA 4DLEA 4DR1F 3RU0A 1S49A 2HVIA 4ZPVR 1Q53A 5B0CA 2XCPA 2NXCA 1Q78A 2DH8A 3HDSA 1JLAA 5J2NA 4XPEA 2LMIA 1BE4A 2CJBA 3RR7A 1LNQA 4FP9A 4JV2A 3N6NA 1F5BA 2KB2A 1XN9A 1JJHA 1N88A 2ELLA 1PAUB 2GO9A 1RHQB 2I8EA 2L3MA 1YBTA 2P9GA 3CDWA 4EUVA 1WC6A 3KLFB 1YG0A 2FY8A 2DNMA 5A0YB 3ZZOA 1WTFA 5DM6Q 3C6TA 4X66F 1Q81T 2HHHJ 3HVTA 3VVTA 2HRUA 1YIJS 1UVJA 1HBUB 2DNZA 4FKYA 4A8WA 2Q4GW 1HW8A 4O0NA 3CD5A 1KVJA 1LWEA 1H2VZ 1FCAA 1VRQC 4PKDB 1U4BA 1F3FA 4USHA 3E51A 1SH0A 5KFNA 4DV7J 2V94A 1WC3A 2QE5A 4L74A 4U7CA 4ZN1A 2J8AA 3DFEA 4WYWA 1YI2S 1NDLA 3QBCA 2DRDA 4ANEA 3T9NA 1FTRA 1Y0HA 2ZJQQ 2YX4A 4NZRM 2GQ2A 2EXUA 3O5TB 2NSBA 4FYVB 1H7WA 2FD2A 3OTOJ 4PUOA 3CCQS 1M5VC 8AT1B 5K8MA 3NGRA 2BEFA 1LK7A 1F9EB 3KHGA 1NXIA 4RUHA 2KJVA 4B9VA 2RR6A 4LI1A 1SKUB 2NCKL 2R7QA 3NP5A 3MFIA 3G9CA 3NAIA 4Y3CA 3FK4A 4X84A 3VALA 3Q2SC 4LFAJ 4W92B 4PERA 2AJ2A 5L1JA 2NS1B 3MR6A 4ECUA 3PW4A 4CWBA 1Q7LB 3QJPA 4IH6A 2XZDB 1RADB 4ED7A 2FJDB 3WX4A 3BBBA 3HJFA 1SB6A 4UY8T 1DLOB 1QJHA 1UJ4A 4ELTA 4CTAA 2HGLA 3DLLQ 5LXYA 3ZC4A 1D9AA 4J9OA 1CBKA 1SC6A 4JBCA 1H98A 4OI4A 2M8DB 1C0TA 3PTWA 1S1XA 3M05A 3CJ4A 3PX6A 2HQCA 3K8WA 3W61A 3HSJA 4LMZA 3MMBB 3NCQA 4K8RA 1TFWA 1DARA 3HSGA 2CQ3A 1FJEB 2G0CA 1VR6A 3QGGA 2VG5A 4USWA 5HQLA 2E9RX 2JFKA 1FT8A 2OJ3A 1ELOA 5A8KA 2ZBCA 3QO9A 2JEIA 2BYCA 2CWXA 3QRQA 3BBCA 3K2YA 2MQLA 4YEAA 5HMWA 4M5DA 5D6GA 4X66J 3EPIA 2YKMB 1EARA 3EVMA 2KI2A 5U47A 2KKHA 2QYCA 4TYBA 1HHSA 4BCAA 4EO8A 4KGVB 1X4CA 4KFBA 2W8LA 4ED6A 2ASTB 3A13A 2OMVA 2UVRA 2B9YA 4QIVA 5D0EA 5T7LB 4QW8A 2ZH5A 2ZOFA 3C15B 4DPXA 2DHXA 4HI1A 1HBOA 3R8YA 4WZQA 5FJ4A 4EBEA 2HVZA 3FRZA 2QLWA 4ZA1A 3GSDA 3HHDA 2YNGA 2RF2A 2RUGA 1VYAA 3MEEB 4UT4A 2KTQA 4RWTC 2C2EA 4Q3IA 5IT4A 3NKYA 2C2KB 1Y00A 3C14B 3C66A 3ENWA 5IWAJ 1IVZA 1X4AA 4GT6A 2K06A 4NASA 4OYMA 1B0PA 1TFYA 3KXDA 4CILA 4CH1A 3F0NA 3OJSA 4USTA 1A9NA 3OR2A 4J9VA 4TU7A 2CJKA 4FXDA 1FRJA 2AQ4A 4LSAA 2WCXA 2O5DA 1N4LA 3RGZA 4X65J 1FJGF 4AL5A 2QLXA 3H2VE 3M30B 1S4FA 2J76E 3R7NB 2I2YA 5AXNA 2MQQA 2VJVA 3WC2A 4F3OA 3VQ2A 1S6UA 4CIOA 3EDQB 2NR0A 2AJ4A 4DR4J 1HQEA 2VG6B 3UL9A 4P74A 4PXBA 4BSRA 2FC9A 2DGTA 4OYPA 4URSA 3ISZA 1U6BA 2XOTA 2JSXA 2Z65A 3M8PB 3IRWP 1VK8A 4DQRA 4ZP7A 2VA3A 2VFSA 4CO0A 1FFSB 2WSCC 1N48A 4ED0A 2MKCA 2YNHB 4CNZA 2F4VF 4C0OC 3D2WA 3M8RA 3PX4A 4HR2A 4RUAA 4W90B 1T3OA 4KH1B 2KXNB 4EWTA 1U0HA 2CPEA 2OIHA 2GMHA 4DWIA 1RTJB 4CO2A 5D0GA 3S8SA 5AWBA 2DEJA 2ZOGA 3DOKA 2DTJA 2NSCA 5C2GA 1JLCB 3H20A 4LRDA 4NMXA 3HT0A 1KSPA 1G4CA 3QRRA 1RT3A 2YWEA 3ULVA 4IH7A 4IDKB 4H4KA 5KFTA 4Q2LA 4DUZF 3CMES 1MWQA 5EDWA 1UVLA 4J7CA 4ZPAA 1X0FA 1NH8A 4ERDA 4KH0B 3LP1A 3C6UB 1HNVB 3H90A 1RLCL 4USKA 4LJMA 5D4NA 5LOQA 3J81U 2AYBA 1G2EA 3E3ZA 5CA5A 1RT5B 3MM7B 2O6QA 2W2OP 2OTJS 3R5CA 3G86A 4RL1A 5L9XA 1H6UA 3MAAA 1RDRA 4NXMF 4NE9C 4V2CA 3FZBA 2K7JA 1RTHA 4PWWA 3FCHA 1T03A 4NLOA 5BYRA 1H2TZ 1LW2B 4NI2B 5KFBA 4MKYA 1VJWA 1YLXA 1S99A 2YQ0A 4DV3J 1HWIA 4JI1J 3R2CJ 1RUSA 5CABA 2AV5A 4AUKA 4GVLA 4Q8FA 1WSVA 2DNPA 1IR0A 1CJUB 2VFUA 4NLGA 5AT1B 3RRKA 4U9RA 4IRCA 3KLHA 1NPRA 3CNQP 3FEXB 3CO0P 1G9UA 3AB2B 1C1CA 2PC6A 3GYNA 3K5OA 2MDAA 2EFVA 3KG4A 2R7VA 2LDIA 3TVYA 3C16B 1VJQA 2UV8G 1CULA 2GCFA 3AQOA 4DV2J 4QU6A 3OR1B 4Y2CA 5DG8A 3FBFA 1HNXF 2V9TB 4N8NA 5HZLB 1GMWA 2BM0A 1X7VA 2XBPA 2MSSA 2E1AA 4ED1A 2E5LF 3ONQA 2J5AA 2RQ4A 4I56A 4JUZA 5IOLA 3TJ9A 4OHYA 5KFRA 2MB0B 2VH7A 4TQSA 2GIFA 4KJIA 2H5JB 5KT3A 1KHVA 2OSRA 3NCRA 1S9GB 3W9JA 1NB7A 2PD1A 3R2DJ 5DJBA 1SV5B 3ADAC 4P72A 1K0VA 3QIDA 4NLQA 4OYWA 2KFYA 2GIRA 3POTB 1HWKA 2HK2A 2YQ1A 1S1UB 3D4JA 5MAOA 2HKEA 4S0MA 4KBIA 1F6TA 4F4AA 5B0NA 2E5HA 5KFVA 4DV6J 3H5YA 1NAQA 1UW9A 2HAFA 3JSMB 2HVEA 3V5RA 1T9VA 1D8ZA 3CE8A 1P1LA 1SIWB 2JOQA 2RHSB 2YWWA 2HNZA 3C46A 3OUYB 1KBRA 2NREA 2G2ZA 1DTQB 3BPSP 3QNWB 4WYKA 4F3QA 5CAAA 1E6YB 5IFMA 2MGZB 3MOJB 3M1VB 3AXMA 1VQ8S 2OPSA 1HNXJ 2R7XA 4LSXA 3DYAA 4B3MF 4B9SA 3DRYA 2AHOB 3M6WA 1RT7B 3HI9A 1P8TA 1PJ5A 2NYIA 3D1QA 4C8OA 2YWGA 4RKUC 1WTBA 3GWCA 2E9ZA 1D0BA 4RLEA 3TANA 1HHTP 2L08A 3ZXWA 4R5PB 2HMIB 5AE3A 3AHPA 2F7VA 4DR3J 4C2BB 3BN7A 1HNWF 2Q66A 2C2RA 2DR5A 5EN1A 2KRBA 2BJEA 3MEGA 4Z2XA 4V2EA 3FEYB 1FK9A 3G82A 4Z94G 5KG6A 2UUTA 3AJ2A 1IKWA 3B8HA 5EX0A 3RBXA 1T02A 5CZXA 4B02A 1VIXA 3IBWA 2R8JA 1HI0P 1ZA2B 2ZM6F 3N28A 4NLUA 4F26A 3MM5A 1N56A 5B0AA 1I94J 5GMKa 2GHVC 2CAJA 5J2QA 3UNGC 4R5PA 4KY3A 1REVB 2CXEA 1G6BA 2WAQD 3NWRA 4RNOA 2CQGA 2UP1A 2F65A 1LWCA 1O51A 5FDLB 2R8HA 4DFJA 2IM1A 4JI6F 4YUDA 2VJUA 4KRWA 2FJWA 4CNMA 1PJ6A 2O67A 4J5OA 1QUPA 1Q86T 3RFJA 4DOZA 2DGVA 1E6YA 3OPKA 1TV6B 1GEHA 3HK2A 1DTQA 1YQHA 2AT1B 3Q22A 2DNQA 1L3TA 2XSFA 3NNCA 4WP6A 3SQOP 2BJDA 1U7LA 2EK1A 4ER8A 3GMGA 1Q79A 2B4VA 1K9MT 3JSMA 1V9OA 3BEGB 4JYAF 4E98A 5IS2A 2RRAA 4QYZK 2YH1A 2OEJA 1IWAA 3LAMA 1UKUA 3VAHA 2JLFA 4ZP9A 2HMIA 1QAYA 4UF4A 1OQ3A 5JJBA 5B0TA 3AJDA 1SV5A 1XEUA 1AT1B 1T11A 3H5UA 5HO4A 3W1YC 7AT1B 3T3FA 4B3TF 1VQPS 4NYZA 2DNYA 2M8HA 2O3DA 1I3OB 4PPDA 3MM9B 4ZPCA 2E7XA 4P2SA 5ETRA 3NGTA 4WFAQ 2Q43A 4PKIG 2HNYA 1J2VA 4EFAC 3VF0B 5KT4A 2ZDOA 3CCUS 3RAXA 2ZZTA 3BH6B 1V5IB 3OTBA 1Y5IB 1OOKG 4NKGA 2PSZA 5T41A 1NKBA 2LA4A 2MQMA 4HQ1A 2GIQA 3W2WB 2IIHA 2HWIA 2HWHA 3DLGB 4I68A 4OHWA 1DQAA 1NDCA 4M5LA 3RBZA 3PY8A 1Q1KA 2V2KA 2G1HA 1TKTB 4NMLA 4P7TA 4C8NA 2QA4G 5KG7A 3BYPA 2XY6A 3C3LA 2J0QD 2EBEA 1P9QC 2O66A 2WHOA 1M0ZA 2L9NA 1CJUA 3CCTA 4P91A 2ZHAA 2GGPA 4QIGA 3VTIA 3QAUA 2GQCA 1VFJA 4DSFA 2E1MC 2Z7XA 3L9ZA 4L73A 4CYUA 3FSYA 1T03B 3I82A 1AROP 2EKYA 3EGVA 3IS9A 2JNJA 4FCGA 2PA8D 3SSSA 1R89A 1NU4A 3PYDA 1JNZB 2WVFA 3DLJA 5KFFA 1RT5A 3MM7A 5HP1B 1F9HA 4PYAA 1KQSR 4DX7A 4DV5J 3NMRA 2W4CA 4IG0B 4Q3GA 1MG7A 2C3OA 4OL8A 2ZFHA 4WXOA 1NPPA 1XERA 1LOUA 3KFWX 5CCMA 4GKKF 1DURA 1S6PB 1C0UA 1NSPA 3BV8A 2FB0A 3H25A 4TZHA 1TZ0A 4E2FB 3HCXA 1F3VA 4LQ9A 1B3TA 3G8QA 4E0DA 3KUGA 1LK5A 2X7IA 1X4BA 2P2CB 4FYXB 4P2MA 2HGNA 4P7VA 3U02A 1W26A 2J6SA 4YOEA 3DLKA 1CLFA 4PWUA 3DZEA 1H6KX 4MQWX 2BOPA 1DFJI 1Q95G 2RAQA 4F36A 1M9SA 3ZO7A 1EQMA 1PJ7A 4RO0A 2QL9B 3RAQA 2UUAJ 4WBFA 4AE5A 3DXSX 3CD0A 1FQVA 2HNDA 4EBCA 3LA0A 4LR8A 4NLVA 3SV3A 1EKSA 1CVJA 1NK5A 1PO6A 2CQ2A 2F8EX 2HVDA 1OSCA 2FZCB 4PWDA 2FGOA 2DHAA 2RDIA 2XI2A 3M8PA 5J1EB 3R97A 4YR0A 3UCGA 5LSOA 2ZH6A 3QPIA 2VG6A 1MMNA 4I0WA 4L72B 1OS5A 2PGCA 3J7Z5 4I6WA 4HHJA 3UL7A 1FHTA 4QXEA 1V3SA 2NYHA 3IA0A 3Q8UA 3M30A 3ZYIA 3OXLA 3GV8B 5C25A 3UCUP 4TY9A 2RA8A 4OHVA 4PPZA 2CNOB 4JV5F 1M0SA 1OO0B 3OR2B 5LMUJ 4NLPA 3I5CA 4TU8A 4CLWA 1RE1B 1RT6B 2NZCA 2QGFB 4N5SA 4JI0J 1GH8A 2P1NB 4H09A 3OQ2A 3JSYA 1H73A 1V6HA 3PHTA 2BE9B 3ZTQA 5DM7Q 3UN2A 1S10A 3Q2TC 1REGX 2Z81A 2BE2A 1UJ6A 4CRJA 4EO6A 3CDEA 3SCIE 2OH2A 2D3UA 1HBOB 2DYAA 1N36J 1IR1A 2BW7A 3PJ9A 3R3TA 2DB1A 4OZ0A 3ZZPA 2ASDA 2XS2A 2ZNZA 2MKHA 1UVNA 2XQCA 5GS0A 4AD6A 5EWEA 2XG8A 1B99A 3HZGA 2MLYA 2VOOA 5C42B 2UXDJ 2HBZB 2YKMA 1TK8A 1OQ6A 4OX6A 4UUWA 3ZTSA 2J7KA 3O2IA 2JVRA 5GAHU 1MW7A 4P2XA 5L1IA 3ET6A 3VHQA 4B3MJ 2POKA 2WK4A 1NJZA 2DT9A 4DJBA 4O0IA 3BZQA 5E3AA 2G4BA 2ALZA 5DRKA 4V1Ak 4DEZA 1VRTB 2IA0A 4XTTA 3GIRA 3AAWB 4ZVTB 1FKOA 2MQ8A 3Q86A 4JOUA 1FNXH 3G8TA 3QZ7A 4C8ZA 1S12A 1RGVA 1S1XB 3UDCA 3J80U 3TZWA 1DFDA 1WEYA 1S4EA 4O3QA 1Q8LA 1X4FA 4ANCA 4HYKA 3RFEA 3EICA 1KN6A 4YR2A 1Q16B 4GMKA 2G2OA 4OZ3A 4RW6B 3VVUA 1TL4A 2EKNA 3N0VA 2M5YA 4CH7A 2PMZD 1RJJA 2QV6A 4HH1A 5KG3A 1SI9A 5THWA 2F8MA 2MQOA 1O8BA 2EW9A 2YVSA 3GV5B 3OFFA 2CQ0A 3KNAA 4N7TA 1N8RT 4KNGA 2VD3A 2DHGA 2HNDB 5E7OB 4WFYA 5K14B 2WONB 3HVWA 4BLGA 1UEVA 4Q62A 1YX2A 3T1YJ 1LWXA 2UZYA 5J2PB 3JTOA 5AWCA 3WPIA 3MM6B 1KWMA 1KFDA 1QD1A 2GMLA 3DDIA 3IR5B 3N4WA 4ZLLA 5ITHA 2P1MB 3OV7A 2W7PA 3MXHP 3TAMB 3FBEA 3UFCX 4P2FA 3H7HB 1C0UB 3HSZA 3QMQA 3HZEA 2PEBA 4RBUA 4WJBA 4YN3B 5E5NA 4DV2F 5G4DA 1WG4A 2YPYA 3SIPB 3RB0A 3FMBA 3GONA 3FJ2A 4JI8J 2WSEC 1M1GA 4RBTA 5ETNA 2DY9A 4LBIA 3KTQA 4PQUA 2OMYA 4A8QA 1RU1A 3R5DA 3T5LA 1OTNA 3MMCB 1U49A 4AYBD 4OX9F 3BPDA 4WIQA 4DPTA 3P5TL 2XI3A 2VFRA 5A0YA 2B51A 4CYUB 3I5AA 1SH3A 2RNEA 3CC4S 3D5MA 3HSDA 3OTCA 4DX5A 2KZMA 3DCAA 4ECRA 2VL1A 3IGVA 2RVJA 1TKZA 3PEJA 2HRYA 3MPVA 1H3DA 3QATA 4JI2F 1IBCB 3P3DA 3Q8PB 1O6XA 3BKUA 2MZTA 3AD8C 4IYQA 2W9BB 2DHHA 4LF5F 1YJUA 1LTXA 1SIZA 2DJWA 3SCJE 1RWXB 3TARA 2QFJA 2LEAA 1N0VC 1ZS6A 1JMTA 1SBRA 4ID5A 4R8UB 5HQMA 3AFGA 2VG7B 4EYIB 3EGZA 5L1LA 1RT2A 5F8HA 1UVMA 1S1VA 4QWDA 2RS2A 2AD9A 1S1VB 3ETOA 4ZVRB 1PG5B 3BGFA 3TR5A 3PACA 4R8UA 2LU1A 2FLPA 5L8RC 1UMJA 3W7BA 1MMDA 4WKYA 4F4WA 4X2BA 3JXOA 1Z1ZA 1T0TV 5BR8J 1RCXB 2OGUA 2W9BA 2XSJA 2JL9A 1TVRB 3V4IB 2J6UA 2VONA 3MPYA 1YBUA 1NKEA 2F4VJ 4CQ1A 1HLWA 4R5DA 2HLUA 2BKPA 1XWDC 2VQEF 4ITSA 1Y3KA 2YH0A 3O6QA 3BR9A 1EX8A 2BANA 1TKZB 1T9XA 1GMVA 5B0FA 1TKDA 4V19J 1S6QB 2FJXA 3US5A 1RBAA 4LFCF 3LTOA 2QA1A 5E33A 3L09A 3K0JA 3QJJA 1IXKA 4RPFA 3PXGa 2DGOA 4MIBA 4TKTA 2HAIA 2A3JA 3VAGA 2RS8A 3MMCA 4PEOA 5KT7A 3PV8A 3R6LB 4G1QB 1U48A 1F5AA 1S7IA 2E66A 2J9CA 4X4NA 1SXLA 2N82B 2XY7A 2VU5A 2YKOA 1LWCB 3TA2A 5F3TA 4N47A 2CQHA 4P52A 3J7ZT 3F41A 1PGZA 1XC9A 4AQYF 4Q0BB 4I67A 2XCAA 1CQNA 4KAIA 4OZLA 5JMNA 1PYSB 2DGUA 1WF2A 2QX0A 1ZM2A 3KG1A 2V2VA 1FVSA 4LQ3A 2FHJA 2GAHC 4MFBA 2WVEA 4Q7AA 1ZPVA 2BQ3A 3MM5B 1GXLA 1HWLA 1RSCA 3DU6A 5F8IA 1EP4A 4UQGA 2A0ZA 4JI4F 4UTGA 4K2XA 1MU2B 1IKWB 5ETLA 1RI7A 2WONA 3DC2A 4URGA 4K4UA 1RA6A 2JE1A 1F1BB 1FK9B 3G82B 3R5GA 2CQ4A 1TMMA 3MEGB 4QIEA 2NQPA 5KFDA 2J0WA 1LFPA 3MMJA 2D74B 3W3SA 2AEFA 2YX7A 3KLGA 3I0SB 1WC0A 4OV6A 2M9KA 1N6QA 2LXIA 4DSKA 4RW6A 2NUHA 2ALYB 2J9DE 1PC5A 3CIYA 1XMOJ 2B9XA 5F8LA 4WFZA 1W7WA 2Y1JA 3PW0A 4EU0A 2J7WA 1FKOB 2I6WA 1GT8A 3GIMA 4AQYJ 1FNMA 2DNRA 3HHLC 1FD2A 3KDOA 1RCOB 2KYXA 3G3AA 4DXLA 1YRGA 2MGZA 4LIWA 3R5AA 3H98A 3OL8A 3ZYNA 1WWLA 1NK7A 3X1LB 2HNZB 2BKOA 2V70A 5IV4A 4FN5A 2HQGA 4RNFA 4CC4A 2RHQB 5C42A 2AJQA 2HHHF 5F8NA 2DGWA 2FTRA 3OL9A 2CPDA 1U0ND 1XMOF 4ZKAA 3MR2A 3N6MA 1AB8A 1BMQB 2DXFA 4DZ6A 4LRCA 2XYHB 5CD4A 3G6ES 1K5DC 3ZZZA 1WORA 3DOMB 3MTJA 2BE2B 3LUYA 4J9UE 4LSNA 5AE1A 1J5OB 2VODA 5IJBA 1OYEA 1SL1A 5IT0A 3GR1A 1NK9A 1Z2ZA 1PKUA 3LH2S 2DCUB 4DSEA 5IJCA 3MOZA 1OMSA 1RT6A 1S59A 1YKWA 2HZAA 2RD5C 3KUEA 4MMOA 3QZ8A 3ITHB 1VBKA 1X9SA 3PJXA 1VQ9S 4WP3A 1R0BG 1VGYA 2ZDPA 2LYVA 3I31A 4NEZA 2J0SD 5C25B 2YKQA 1NK6A 3GJQB 1FDBA 4B3RF 1CJVB 2VB6A 2KHDA 4WXWA 3OJUA 2XM3A 4Z61C 1DQ9A 3EVOA 5DG7A 4K59A 1L3VA 1RQ0A 3C16A 3M2RB 1HI1A 4ZP8A 1EZZB 2GJ2A 4RNNA 2H4WB 1Y10A 4FDWA 1AYEA 2EG2A 1U6FA 2BW2A 1S9FA 4I69A 2Z64A 1UZHA 2LQJA 1V3RA 5ETSA 1VS3A 4I2QB 5HQ8A 5J1EA 4MYUA 2ZH7A 3IAM9 1RBOB 4FPIA 3WPFA 4R09A 2Z0GA 1H7XA 1ZZFA 2V8PA 1HQUA 3FFIB 3H0PA 4W98A 3H5XA 2HS3A 2FDNA 1NHVA 2CQCA 2IRUA 2WQWA 3FMWA 2Z57B 1DQ8A 1XBWA 4FYWB 4KXFB 2GJIA 1IBKJ 2FJVA 1B64A 5K20B 3HX9A 3UR3C 3K59A 5GMFA 3DGPB 2A6OA 4FNIA 1O6TA 2R2RA 1LFWA 4WP9A 2XEXA 1T9TA 3KJQB 1AZSB 3S7RA 4DR7F 2R7UA 2KG1A 4N56A 4ED4A 4ED3A 5JXSA 3CIGA 1S6PA 2V2QA 2QLBB 3GQCA 3P4UB 2QYGA 3OL7A 5I3QA 4ECTA 5KFKA 3D3CJ 4NCAA 5DGAA 1HNVA 4IG0A 2MEWA 4DPWA 3PKYA 2QSFA 1ZOTA 1GWBA 5KFSA 5HVHA 1R6VA 4IDKA 2OMUA 3R5BA 4D3GA 4YB1P 2R7SA 5KFHA 4PEQB 1AZSA 1NPKA 5K8PA 1JLCA 4ETXA 2WFHA 2YPZA 4ES3A 5DG9A 2XULA 3QSYB 2Z30B 1A6LA 4ECZA 1D9FA 3NNAA 1XCDA 3DGPA 4AFFA 1H74A 4YHHJ 3T5KA 2FIUA 2NLWA 1OWXA 2CPJA 3DM2A 4ZCKA 4OQJA 2H54B 4ZITA 4Q43A 2UUBJ 2HZVA 2VBZA 2GGPB 4OX9J 2YNHA 1BD6A 2E1CA 1XNQJ 1VBZA 2D41A 2PDAA 4DR3F 5K5MA 1HQUB 1UWAA 2QLFB 3FFIA 4M94A 4GLPA 3PEHA 4Z7CA 4I2QA 5IXUA 3BBFA 2XWTC 2B4PA 2XTJP 3OSNA 4Q5VA 4DR5F 1NM2A 2AZ3A 1M90T 1NSKL 4H4KC 3WBZA 2F9JA 4O3RA 1HQEB 2HHQA 3MD3A 1H6TA 4C9DA 4C4WA 1XR6A 5D4PA 3DLGA 2VBXA 3H42A 3M2RA 1KEKA 1N33F 4WF9Q 4B9UA 1P8VA 1X4HA 5F41A 2IY5B 4J91A 5EX3A 1PGVA 4LSXC 5K9FA 1X5SA 3MD1A 4K4YA 3O53A 3CPWR 2C2NA 4OX7A 2HNYB 2CQ1A 3G39A 4R5CA 1A9NB 4A46A 2ADBA 4Q44A 2LQ8A 3N9UC 3MCOA 2ABYA 2HQDA 3N01A 5D15A 2MKKA 3C14A 5KFGA 4Z37A 1FWKA 1U02A 3GLJA 3SV4A 3LP0A 4L6V3 2YNGB 2C42A 4YB5A 3OL6A 1J5OA 4J0MA 3BYRA 3CJSA 1NZ8A 4A8OA 4I4BA 4QU7A 1IKXA 1JIHA 3C15A 4LREA 4M5JA 3Q24A 5T7LA 3IO1A 3AOCA 4H4MB 4USIA 5AXKA 3THVA 4B9TA 2E5JA 2BABA 1WKJA 5KG2A 1N5TA 4ILMA 3OJAA 2AIRB 3Q83A 4OZ1A 5CMNA 4X4QA 3P5BP 4M5DB 2R9LA 3VAJA 2YQ3A 4M5MA 3VQTA 4CCHA 4LXRA 3PO5A 1S79A 3WPGA 1TV6A 2M70A 4F8RA 2DR6A 3SYZA 1RZMA 1S1TB 3W8PA 1PBAA 1WELA 2DY1A 4WWSA 4MYTA 3HF5A 3PRDA 5FDLA 2OAUA 4LF4F 3T41A 3K58A 1VC0A 2VA2A 1FWPA 4B8CD 4Z7YA 4NZTM 3PKMA 4DL0C 1ZZNA 3CCES 4NXMJ 2GNKA 3OVAA 2V4QA 1N6QB 1KVKA 3B78A 1ZTWA 1JB0C 3D6FB 2WBRA 3QWUA 1Q4RA 2XMMA 4X4PA 1U1QA 4IRDA 2HW3A 2V34A 1SC4B 1WHWA 4K4TA 4EZGA 3E8OA 4JI1F 2K3IA 1BQXA 2EC2A 4QIWD 2QL5B 1WACA 4DQQA 1VI7A 2HBYB 4FHOA 2D7SA 2RKIA 5CXTA 3NY0A 4DU7A 4F0KA 6FDRA 3C6NB 3LALA 3QT8A 2ZHBA 4P10A 4QPTA 5FTTB 3PYFA 4F4XA 3EWGA 4QCLA 3CEDA 3W65A 4Y2IA 4O44A 4WFBQ 4UOCA 4ZVHA 1MWYA 2E7VA 5HN0A 4MAKA 3QJLA 4LRFA 1YJRA 2ACMA 3SB4A 4AL6A 4Q0BA 4N41A 1X5TA 2XMWA 3BB5A 5A6WA 1WUUA 2GQQA 1P8GA 3GG0A 2G0IA 5BYQA 2VPZB 1SQEA 4PXDA 5IC6B 3R7SB 5KG1A 3W62A 4F0MA 1LWEB 1D3WA 4YS2A 4OI3A 1TL7B 1ZBTA 3FC9A 1TAQA 3SI8A 2BZ2A 4EK2A 3V2UC 4QR2A 4ED5A 3ILOA 1HNIB 3M8WA 2CPHA 3NGSA 2Z66A 1SC3B 4QZVB 3RTVA 4B3RJ 1IBKF 4U7UK 2KM8C 1WC1A 3A8JA 4MIAA 2R2TA 1HD1A 4PSJA 4NLDA 2APOA 1TL1B 1TAUA 1YJWS 4NWBA 4O3OA 4B9MA 4GVBA 5C24A 2BANB 2XWXA 3UWTA 2HZCA 1JLAB 5J2NB 4CLPA 5B4PA 4C3MA 2YWFA 1HNZJ 3WDOA 2R7OA 3UCZP 2VPWB 2XNQA 1NH7A 4MKVA 3POTA 1NDKA 3AT1B 3Q89A 1VQYA 4KYZA 4RW4A 4DLGA 4DL7A 1TVRA 4JV0A 4K0KJ 3ELHA 3P96A 4TVAB 4CT9A 1NK0A 3O6NA 2Y1LB 3U1MA 4LSLB 3U1NA 4CM0A 1S9GA 3G06A 2HHPA 1D0EA 2H4YB 3TEHB 4QC0A 4ZHRA 2IJNA 3CUNA 1ZAXA 2H51B 3PNIA 4ECOA 1K5GC 4ZN3A 1RT2B 2BBEA 3OVBA 1JLFA 4X4RA 3CCJS 1U1LA 4ID5B 5CQGA 4ALZA 2R8KA 4CLSA 3G96A 3MI7X 1T05B 3RIZA 2MY7A 5F9LA 2Q6CA 2HFUA 1KHWA 1FEHA 1PSDA 2H9ZA 2CNNB 3LOUA 4QOTA 1C1CB 1JXVA 3WQPA 5GADI 3UL8A 5AZ5A 4FF3A 2KT5A 1NCLA 1ZTTA 2BV3A 2V8DA 1Q7YT 4Y2KA 2DCLA 1J27A 4BC9A 5ETTA 3OHBA 3ZYJA 3FBBA 3PYGA 2FVCA 2ZJPQ 5LL6d 4DPOA 5HVGA 1FNOA 1HBNB 2IFXA 3CJKA 3QQCD 8ATCB 2C22A 1LW2A 2Z4PA 4NI2A 3R7BB 3TAQA 3TX0A 3MWBA 1URNA 2PN6A 3F44A 1Y11A 2RRNA 1T8EA 2RDDA 2VUGA 4J9MA 1B4SA 3FBCA 3MAAB 3M32A 1NSQA 4I1TA 4J9KA 4DCOB 1TK0A 4PQUB 3V6KA 1U1MA 2Z58B 3OJAB 1MROB 4C0BA 2KT2A 3MZIA 5ETMA 3GILA 2ZH1A 3C6UA 4JI6J 3E6JA 1EETA 1UTAA 2JRSA 2X1AA 1SJQA 2H5IB 2WBMA 2CJQA 2V50A 2X1GA 1PILA 3MHYA 4Z79A 2DEIA 2ZC3A 3TAMA 4OYIA 5DLGA 1UEUA 3RG6A 5HK4A 3I9V9 2C2DA 3M2UA 1SL2A 4DN9A 1JK9B 3QSIA 3DOKB 1UP1A 4K2JA 3G6YA 3G04C 2CPZA 4O3SA 1CG2A 3MM6A 2XZWA 3J81Y 2KZZA 3M6VA 1U0HB 2GV1A 2MTLA 5J2PA 3NAHA 4PQAA 3VZHA 3PDNA 1PBUA 4U06A 5K14A 2DR7A 1B0VA 2MPUA 2WW4A 4ECNA 1BWVA 2B3TB 2JJ4D 2BJ7A 4ECVA 3RFSA 2FZGB 1HWJA 5HROA 1T9UA 1X5OA 3EYZA 2D1CA 2ZEJA 4KIAA 2VC0A 3QGPA 3A3OB 2E1PA 3B6BA 4DV4J 3PHEA 3RW7A 5F8GA 5L38A 4BWMA 5BR8F 4LF5J 1E6VA 3CJ8A 4X4OA 2WOMB 2NXJA 3P72A 1VRTA 2YNFA 1FWLA 2LKZA 2AEJA 3L95X 4ANDA 2WTFA 1PC4A 4GO7X 3EX7B 3ET6B 2LECA 5L46A 1R8BA 3CGIA 3NS6A 4C11B 2XYPB 5KT6A 4UZBA 3RJ0A 1OJ4A 3X3UA 4F4KA 3UN9A 2M3DA 2Y3YA 4Y28C 2IVFB 3QT6A 1VQ4S 3RW6A 2R42A 3SQGA 1HQ2A 3EM1A 1F9FA 4X62F 1FDNA 4RCAB 3MCNA 3Q8VA 2PT0A 2NXEA 4KFBB 4J9QA 2C3YA 2HIYA 2AEMA 2QC3A 1OIAA 2XMJA 3M4XA 3OD2A 4DS5A 3N79A 1FKPB 4O4RA 1S0MA 4EZ6A 1MWZA 1XK8A 4DS4A 3JQJA 3FSIA 5L9NA 1HR0J 4PG5A 4B3SJ 2FLOA 3NS7B 1LWFA 4ZPBA 5D3GB 3GU0A 4C2MA 4UQTA 5KG4A 2VG5B 2L48A 3HKZD 3S01A 3K5LA 4J9PA 3SBMA 2CQIA 4MK9A 4BC7A 5KOWA 1IBMJ 3MMBA 5K8OA 2OMZA 2DH9A 2AYEA 3UW1A 1C0TB 1WDTA 2O1PA 1HW9A 3EXYA 4NX9A 1QDUB 2VDHA 4DX6A 4AXJA 5KFJA 2ZH4A 2M88A 3PZPA 1LV5A 2AF6A 4I2PB 1U1OA 1AW0A 1RT4B 3KNGA 2XB2D 2MJUA 2LVWA 4L3FA 2QG9B 3H5SA 3H59A 3BGLA 4PWDB 2OEMA 3G4SS 2UUCJ 2MQNA 2XMVA 1HI8A 4I6YA 4ZDNA 1TUWA 1WKLA 3GJTB 1JL5A 1KKHA 2VIHA 2B56A 3VWSA 3CMAS 2WQUA 5HJXA 3MAQA 3HHNB 4CLTA 3EZ5A 2HFZA 2IRXA 5E3QA 2QEXS 2EPIA 2IAJB 3B4MA 3BSAA 1BUXA 2FHKA 4URQU 1RABB 2NPFA 4CP5A 1YJ9S 3DLKB 2HFNA 3HD2A 4DHVA 2CPYA 3BGRB 2J0XA 4YHHF 4ECQA 5IT9Y 2I0XA 3QT5A 1MN9A 1SJ4P 1OPZA 5CYMA 1WEZA 3I32A 3SFUA 2CJXB 1IR2A 2ZH8A 3H40A 1RYSA 3ULHA 3W9HA 3FGVA 4GKJF 2AU0A 5KFQA 2Z63A 3BQ1A 3GYXB 5A5CA 3D66A 1Q8IA 2CG8A 3BSCA 2FGCA 4OQTA 2OMLA 1AXQA 1F60B 3BDPA 2P5VA 4DL2A 1NO8A 3D0HE 4NA2A 5IQQA 3L3CA 1JNRB 1UAWA 2PO4A 4EI2A 4F25A 5HP1A 1N36F 3KOAA 4ARNA 1FKAF 2ZVIA 4USUA 1KR4A 2FVPA 5GAEU 1HBUA 4UZCA 3OHAA 3D6MB 3W3GA 3MR3A 1JLQB 3C6TB 3NBPA 4FZVA 3IS9B 1YWXA 2XS7A 5HLFB 4C6AA 2KU7A 3A4TA 2DITA 3FDSA 1ZAVA 4LFBJ 2DNNA 2EVZA 2Z7XB 4DL6A 4R58A 1TL5A 3DDKA 1G3OA 3W2VB 2J9EA 4ZJLA 5HAOA 5CH7B 9RUBA 4RWWA 3HVRA 3WC0A 2ZH3A 3N5BA 2DGXA 3AJ1A 3V81B 2Y9HA 1DS9A 2F3JA 1WEXA 1TKTA 4DV4F 1U8SA 3GE9A 4QYZJ 3KLIA 5A8WA 1VDHA 4M63A 4FXWA 3I4PA 1CPZA 2MKSA 5IV3A 3UI3A 3BJYA 3W2WA 4DCJB 1C4CA 3JAMU 3VGTA 3WN4A 4USMA 4OMFG 3IM9A 4Y2AA 2CWKA 3ICLA 2I5JB 2GVZB 2MZJA 2BQUA 1IKVA 4DR7J 3ILJA 5HANA 2BRLA 3GFYA 3MPDA 2QZ8A 4C97A 5KTQA 1VK3A 2IPOB 3OW2R 3GFXA 1G1XA 3IRXB 2ZH9A 4ECWA 3MM9A 2HIQA 2L9WA 3HMJG 2PI5A 3HHEA 2ZZMA 3G3BA 5GS2B 4UOFA 2XMKA 3DLEB 5LT5A 2R7RA 2Y1RI 1APSA 4D3HA 3DKDA 4IRKA 1ULRA 4NZ7A 2JDJA 4H4OB 4L3NA 2CQBA 3IBCB 1U1KA 2NZ4A 4I6JB 3LANA 2RMLA 4PR6A 2U1AA 2ZWPA 4WE1B 3ILLA 2V4RA 4DR2J 4EMDA 1WKKA 1KTVA 4PRFA 1XQIA 2YTCA 3PRBA 3ENQA 4JI7J 4Q8EA 1HR0F 4ZK7M 2C3PA 4LF9J 2VQFJ 2R7TA 2UZXA 4IG3B 2B6AB 1UA0A 1J5EF 4QWBA 4RJVA 4NPOA 5FLXU 2RU3A 3HM9A 1NHUA 1UCNA 2VICA 4HVZA 4X62J 5LMNF 1YZ6A 4MKAA 2FC8A 1U1NA 3JTNA 1I5OB 1SUQB 4ICLA 1RTIA 5J1NA 4B17A 4AT1B 3OSPA 3T1HF 3ULAA 4DL4A 2VF3A 4RWXA 1NB2A 2UV8A 3TUZC 4C0HA 1R8AA 4X64J 2EBGA 4NLWA 5DDQC 3RR8A 1REVA 4DFMA 4LF7J 1VLOA 4F2SA 5J2QB 1LEOA 3GB0A 4RUBA 2X3GA 4TNOA 1YITS 1FDAA 3PFEA 3Q8RB 1K73T 4DN0A 1UA1A 2ID5A 4HLBA 4LVOP 4UOHA 2A2CA 4UW2A 5K8NA 1LXNA 2IBOA 2OPRB 2XLIA 1N34F 3DRRB 3BGOP 5KFIA 4IQXA 4G3IA 3GCWP 2KM8B 4ES1A 1QM9A 3F56A 4U6PA 1KFSA 1JXEA 1RT1B 2E44A 2FJAB 2PE8A 3L4BC 3QAEA 5AXMA 5GAGU 5H9FK 3CJ2A 3PRVA 2JX2A 3I5BA 4ZOSA 4Q2MA 4KGXB 1FI4A 1GXTA 2CVIA 1U26A 2ZOMA 2FQQB 2QA2A 1HARA 4NEYA 3MAHA 4Y0FA 1KRPA 4P8SA 4BSSA 2XLJA 3W8GA 5DO2A 2HEKA 5HATA 3W3JA 4IFVA 4QW9A 1QYYA 1LKZA 1RT7A 4QQBA 5HL7Q 2IMOA 1V3ZA 4LF2A 5B0DA 3DYAB 4NKHA 1QAXA 2Z2YB 3R1HA 2OPSB 3M1VA 4LBHA 4U67Q 4DV1J 1Q82T 1GTHA 1CJTB 1Y5LB 2E5GA 2DIVA 3UDLA 3P6YC 1WF0A 5G0RA 1ZA1B 5KT5A 2P6TA 3OUYA 2M4MA 1JQGA 1WHYA 4RW8A 4ZLPA 2RDJA 3W3NA 1BQNB 2DR9A 4ETZA 4JI5F 1IBLF 2MY8A 5CYQB 1FFGB 1IUJA 1FFWB 5KFMA 4ZPDA 1JLBB 4FF1A 1S1UA 2LQBA 3L7UA 5I3UA 3RZAA 4TU9A 1DRZA 1D1UA 3U27A 5KG5A 2B8PA 3NOCA 4QBUA 1ZETA 4MH8A 1KOHA 3E01A 5F0WA 2BJ8A 3FQKA 1RWUA 2V63A 4OI2A 4F7VA 4DV1F 2OTLS 2FJEB 2D3OR 3TVZA 4OI0A 3J7AN 2K1RA 4J37A 3NRBA 3CCLS 5IM0B 2A0FB 3FNNA 3OXFA 4NXNJ 1NRKA 4QR0A 2ZM6J 3RGIA 3AB4B 2GHWA 1FA0A 2Y8WA 3OR1A 4NZ0A 4LI2A 2N4CA 1CULB 2VV5A 3AA8A 4K4SA 3TAPA 2HQIA 3C19A 3WPHA 1M5HA 1UVIA 4CC4C 2C1EB 3NWGA 3DRSB 4HDHA 3SCKE 1S0OA 1HNWJ 2HSEB 1RKJA 4HTIA 3T9ZA 4DCPB 3BN4A 3LAKA 5B09A 4YQWA 3VAKA 4ZIWA 3KLHB 2FJBB 4DG1B 2QTWA 2W2MP 3EJMA 3A8IA 3UD4P 3PW7A 3EVWA 4JI4J 2GS8A 4IKAA 2DRAA 1XMQF 3IFEA 4ZVOB 3IP0A 2UVUA 2HHXA 4C8MA 2RUSA 3Q8QB 2LP4A 4RUCA 4FMZA 1CS4B 1SH2A 2ACYA 2W1BA 3MEDA 3QLHB 1R0AA 1VC5A 3AY0A 4E8UA 1N54B 1RTHB 3TZZA 3CC7S 1NZAA 2Q6BA 3M2VB 4DPUA 4ZS6A 2GVDA 1S72S 2KFZA 1JLGB 5A2QU 2AW0A 5I3PA 5AWAA 5IYXC 4OIXA 1RLDA 3CDUA 4PG4A 1WOOA 3TQEA 3M19A 3LP1B 1YDLA 4KQZA 1X0PA 1B0TA 3GIJA 2IM3A 3TX8A 1FXLA 1TMJA 1D9DA 1RT3B 2W01A 4ELVA 3L7OA 1UPMB 4LSCA 1FE0A 4PABA 5CMPA 3K57A 3ULUA 1RTJA 5EUHA 3J7YU 3NXZA 2CVEA 2OMOA 5B0GA 1KLNA 2BRKA 2R7WA 4A8FA 5LFNA 2XYGB 2J9DA 1TL3B 1YGYA 2GJFA 5D77A 1AFIA 5KFEA 1EQ0A 3FZ2A 2OEKA 2ERRA 2DNLA 2IM0A 3I9ZA 4A48A 2C2OB 3A8EA 3KK2A 4EZ9A 2ROEA 1FJCA 5FLXY 4J90A 4C98A 1GAOA 3TVKA 1Q0NA 5KG0A 4HI2A 1RWWB 1RTDB 4CP6A 2AJ1A 2HFOA 2NXUA 4K50A 2P9CA 1NMEB 3J7A1 3V6DA 4C7QA 4WFNQ 3N6LA 3CCZA 4KB7A 4DX8H 3DOLA 3WPDA 4Y2MA 3K5PA 3M8YA 5E0OA 5ETPA 1UEKA 3UVJA 3KMQA 1FVQA 4CZCA 2MQPA 1SVDA 1HYSB 4HACA 1QUVA 2A1BA 3MPUB 1FRXA 1QSSA 1RAEB 2RF2B 3MEEA 2UUCF 1U24A 2A10A 3TZXA 1CC8A 3T6BA 4CM2A 1BWEA 1OTMA 4ZJOA 2V5HG 3A3PB 2V4JA 4LSZB 4OJGA 1ZYQA 1GTEA 1DAXA 3B54A 3GCXP 3VAIA 3M9NB 2W9CA 1UL3A 2Y8YA 4J9LA 3DMJA 1YVFA 2OPPA 4RW9B 3J81j 4EYHB 1UPPA 4KPCA 3MM8B 2FPHX 3I0RA 2IYIA 4MKBA 5CD4H 3UDEA 4ILRA 4P71A 3VR1A 1QTMA 4RNHA 3GV7B 2VC1A 1CJKA 3MMAB 1RACB 3QO9B 2OPQA 4F67A 5A8KB 3O3LA 3C6PB 4TQRA 5GMHA 2MJNA 3ZZYA 1RKIA 5CHCB 3NG8A 3DLBA 6FD1A 3TQ1A 4FD0A 4DUTA 3ZNJ1 3HFZB 3M7VA 2IM2A 3UNYA 1JJ2R 4J9NA 3BKTA 4FS7A 3HJVA 3KLEB 2R8IA 4KGKA 2IC3B 1X5PA 1YBAA 1K1QA 2ASYA 4M5KA 4M5IA 1BLUA 4YEBB 4CTAB 4K4ZA 1TUGB 1F0XA 1DLOA 2OI2A 1VCTA 2HRTA 1JLEB 2P1QB 4M5HA 4WCEQ 4AY9X 1HMVA 3U1LA 4C3KA 5B0BA 3EPGA 1MSWD 3TYTA 2DGQA 2MZSA 3LPYA 3ZYOA 4R0AA 2ZNYA 2M2BA 3AODA 1GMWD 1S48A 2KRRA 3R6GB 2UU9J 4B3OB 3UD3P 1X9MA 2QJ3A 1SJ3P 1Q5VA 4YMEA 2FT3A 1DHMA 3NS5A 1VHFA 4OV1A 2MSTA 5BJRA 3FXIA 4ES2A 2CZVC 3OFEA 2JQDA 1BQMA 1YJTA 1TTHB 4PUOB 1HA1A 2MZ1A 1YK9A 1JLEA 1DBDA 2CPIA 2CG4A 3GTYX 4IQMA 4LT6A 3JYTB 3SFGA 4RCWA 5GAEI 4IR1A 4MK7A 3TP2A 5DDRC 1H0HB 4IOCQ 4L3AA 3QFWA 1MNEA 3AD9C 4DUZJ 1IBMF 1SL0A 3CVRA 2CA6A 3ZZRA 4GKKJ 2ROGA 3E4GA 1RAJA 2F8HA 2JWNA 5D8HB 2BOAA 2RU9A 2AGQA 3GYGA 1S1WB 1NK8A 2P6SA 2I38A 2ZHOA 2B4OA 2CPFA 2GA7A 4DL3A 2JFDA 4AL7A 3HVTB 3MMAA 1PAEX 1FEEA 1JKHA 3AD7C 4NA1A 5D4OA 1X4EA 5A8RA 3M9MB 4NXNF 5EWGA 3KLFA 3IN5A 3EUNA 2CADA 3UDVA 3PVXA 3MM8A
chains in the Genus database with same CATH topology
2OPPB 1VQOS 4NA3A 1YRTA 4O3PA 4ZCIA 2W9CB 4I6AA 1SJ1A 3PJWA 2W25A 2IVMA 2V4JB 4YDXA 2BUNA 4CO5A 2ASJA 4EBDA 2YNIA 1X4DA 4FYDA 2PI4A 1QAIA 3IR7B 4F4ZA 1HYSA 3RBDA 1WG1A 3WPCA 2JHEA 2QRRA 4KE5A 2O01C 3QIPB 3KK3A 4C8YA 3D28A 4ILLA 1UFWA 4IOAQ 2HS4A 3TA0A 3V6DB 4K4WA 4XAKA 3M8QB 4R0JA 4XO0A 2Z82A 3QGIA 4WZMA 3PW5A 2YKAA 3F73A 2GHPA 3RB6A 1NNDA 2B5JA 1CQMA 2VBWA 4DFPA 3EZUA 3NCPA 3NGKA 4OI6A 2XC9A 2XLKA 3HKWA 4G1IA 1R27B 3OXGA 3TUJC 4KKOB 5DQHA 1L5UA 2LQ5A 3HXMA 2FLNA 1QAJA 3RYLA 3RB3A 1R31A 1HNZF 2V9KA 5HMZA 2BQRA 3SDEA 1BGXT 2IYGA 1VQ6S 2RSQA 1CEZA 1FESA 1P6TA 2DD8S 2EI5A 4MJKA 4OI1A 3LGMA 3UQSA 1VQKS 4MTPA 2W7OA 2XHWA 1FJ7A 2KHCA 3ISNC 3TOQA 5LXRA 1T7PA 5D4LA 5F3ZA 2DVIA 4A8KA 1UWBA 1VQ7S 2JZ5A 1P1TA 3T5HA 1YJNS 2JEFA 4O3NA 1FE4A 3I56S 3M6XA 3I55S 1VBYA 4OZNA 4KT1A