1FO1A

Crystal structure of the rna-binding domain of the mrna export factor tap
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
240
structure length
215
Chain Sequence
TIPYGRKYDKAWLLSMIQSKCFTPIEFHYENTRAALKAVNYKILDRENRRISIIIELKPEQVEQLKLIMSKRYDGSQQVLDLKGLRSDPDLVAQNIDVVLNRRSCMAATLRIIEENIPELLSLNLSNNRLYRLDDMSSIVQKAPNLKILNLSGNELKSERELDKIKGLKLEELWLDGNSLCDTFRDQSTYISAIRERFPKLLRLDGHELPPPIAF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein
molecule keywords NUCLEAR RNA EXPORT FACTOR 1
publication title The structure of the mRNA export factor TAP reveals a cis arrangement of a non-canonical RNP domain and an LRR domain.
pubmed doi rcsb
source organism Homo sapiens
total genus 67
structure length 215
sequence length 240
chains with identical sequence B
ec nomenclature
pdb deposition date 2000-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09162 Tap-RNA_bind Tap, RNA-binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1fo1A01
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 1fo1A02
4W90B 2FPHX 2KXFA 1VQ8S 2OSQA 3UN9A 5IM0B 3SB4A 3SXLA 1F9FA 4FMZA 1UP1A 2ZJQQ 2CJKA 3O53A 2DHAA 1X5OA 2DIVA 4UFRA 3CC2S 5GS0A 4CH1A 1O6SA 3S6EA 3DLLQ 1FS2A 1A9NB 3S7RA 2KM8C 2KFYA 5GADU 3R1LA 3FEYB 3K0JA 2EK6A 1ZIWA 2MQNA 2DNNA 2N3LA 1YJWS 2DGSA 4PQ8A 3OW2R 2OMUA 4Z64C 2VOPA 2IFGA 1DRZA 1Q7YT 3CTRA 2YWKA 2LYVA 3JB9k 4GLPA 2CPZA 5LXYA 4C0OC 4CIOA 2Z7XA 1VC0A 2RQCA 1N54B 2RVJA 3JB9j 1K8AT 2MGZB 3DZEA 4CC4A 2J0SD 4IOAQ 1FO1A 1WHVA 1P8VA 2ADBA 1VQ5S 3ULHA 1L3KA 1DZ5A 1WG5A 2JRSA 1VQOS 1D0BA 3WPBA 2P1PB 3ZYNA 2DNPA 3R1HA 4BV4R 4CNMA 2LEAA 2Z66A 4R58A 5LFNA 2KRRA 3SDEB 1M1KT 3VAHA 3ZZZA 3G3AA 4LSAA 1XCDA 2Y5QA 2CQDA 3MXHP 1HD1A 4J5OA 4TZHA 2DGUA 5B4PA 1U1NA 2DHXA 2HGMA 3THTA 2X1BA 1UW4A 3CVRA 3IRWP 1O6VA 1A4YA 4FDWA 5GQRK 3UCUP 2LXUA 1XWDC 3TSRE 1WG4A 2LEBA 4U09A 2NLWA 2MQQA 2FT3A 1H2TZ 3UCGA 4C2BB 3WPEA 3VAKA 2O6RA 5DDPC 2ASSB 3W3JA 3U1LA 2JWNA 2HYIB 1G9UA 2N3OA 2YKAA 3I55S 4U67Q 1OTNA 4FD0A 5CXTA 2X1AA 2DGQA 2RRBA 4LXSA 4FXWA 2MKHA 3WPDA 1X4CA 2Q4GW 5GMGA 4F26A 1R8HA 1BY9A 3VAGA 4WCEQ 2ID5A 1WF0A 2BZ2A 3REZA 2F9JA 1FJCA 2WQUA 3RW6A 2JVOA 1H6UA 3KJ4A 3RFSA 1VC5A 3BS9A 3J7ZT 3UD3P 4ZKAA 1VQPS 3CCVS 2I2YA 5DDOC 3VAJA 2E5GA 1OZNA 3G4SS 3P6YC 5HO4A 5FTTB 1M0ZA 4R08A 1JMTA 2OSRA 5DM6Q 3CCUS 4RU2A 3HHNB 2ERRA 1D9AA 2MXYA 4P91A 2M8HA 1NJIT 4IUFA 3CUNA 2XB2D 2MKKA 4CP6A 3RJ0A 1A7GE 3CMES 4QC0A 2MMYA 2KYXA 1YI2S 1U2FA 4R0AA 3H2VE 4K17A 4BSSA 1D8ZA 3ZYJA 2M4MA 2OMYA 3Q2SC 4PERA 3M18A 3D2WA 1OTOA 2M88A 2WQVA 1YTYA 2VODA 2G0CA 2OIHA 2BOPA 3EGZA 2RS8A 1FNXH 4FXVA 4V2DA 4OZ1A 4BSUA 4YUDA 5AWAA 2AYBA 1W8AA 2MZRA 5AWDA 2D3OR 1KOOA 4GT6A 3P72A 5LSLA 2OTJS 1XN9A 2RUGA 4LSCA 2FY1A 1HA1A 4LMZA 1WF1A 5LXRA 2CA6A 2QFJA 5IYXC 2N82B 1OGQA 3WN4A 5GAHU 1WEYA 1SXLA 1X0FA 4LSXA 5A5CA 2DITA 4PEQB 3RFJA 5IJCA 1QVGR 3P49B 4RWTC 2MPUA 2MQPA 4IOCQ 5GAEU 2F9DA 2KM8B 1SQ0B 3IWNC 1P8TA 3B4DA 1WEXA 2M7SA 2RS2A 3BZ5A 2MKJA 4CH0S 4G8AA 1K73T 4LXRA 1PO6A 5GAGU 2V9SA 1PGZA 5IJDA 1DHMA 3W3MA 2DHSA 2ADCA 1FT8A 4B8CD 2O6SA 3ULVA 2ASTB 4ARRA 1G2EA 2LQ5A 4QPTA 4CC4C 3CC4S 2F3JA 2MZTA 1X4EA 2DGXA 5ITHA 3VF0B 1RKJA 4XSQA 3BO4A 3S8SA 1K9MT 2CQ0A 1VC6A 4Z2XA 1DCEA 3RW7A 2YH1A 2KI2A 3LPYA 4TLQA 2K3KA 3MD3A 3MDFA 1R8PA 4KXFB 3UCZP 2CPDA 1YJ9S 2DNZA 4PR6A 4LIRA 3CCRS 3SMZA 1X4FA 4ECOA 5GMFA 2L08A 4QU6A 2FC9A 1FQVA 2BEXA 2MY7A 3NNHA 3WPFA 2JVRA 1X4DA 2G4BA 3ZYIA 3W3LA 1U1PA 3OJAA 3ULAA 1YJNS 4F02A 4M5DB 2DGWA 4R6FA 2MZJA 1X4BA 1WHYA 4WP6A 1N88A 2LECA 4QXEA 1LTXA 2MSSA 3G96A 3PIPQ 3HI9A 3G71S 4C4WA 4CQ1A 1XKUA 2MKSA 2P1NB 1X4AA 4QBZA 5GS2B 4AW4A 4RCAB 4QQBA 3L3CA 2U2FA 2MJUA 1Q82T 3G9CA 2CQPA 4W92B 2NZ4A 5IM0A 1WHWA 2J8AA 2MHNA 3P5TL 2DO0A 5IQQA 1S79A 2OMVA 1Q86T 2QEXS 2ZJRQ 3VAFA 5CMPA 2CQ1A 4V19X 3U1MA 5DDQC 1SJ3P 2DGTA 1VBYA 1OWXA 2JQDA 3CF5Q 1A9NA 1M9LA 1Q81T 1CVJA 4YOEA 4FCGA 2J76E 5HL7Q 4V2EA 5LSOA 4WYKA 3WPHA 2AYMA 2O3DA 4CILA 2MSTA 4YB1P 1VQNS 3MUMP 2KXNB 2P1QB 3G04C 5GMHA 5DDRC 1YRGA 4R6GA 5AWBA 4R6JA 1JJ2R 1URNA 5IJBA 1X5TA 3H2UB 2CQHA 2JE1A 1P27B 4I6JB 1M10B 4A8XA 2XS5A 1M5KC 4P6QA 2M9KA 2MGZA 1N8RT 1QM9A 3M19A 3LQVA 2Z64A 1UFWA 2MYFA 1NU4A 4QU7A 5BJRA 1NO8A 2V94A 1YITS 3MOJB 5HDHA 2CPYA 2Q79A 2LA6A 3N9UC 4M7EA 2L9WA 1ZH5A 2MJNA 3W3KA 2KT5A 2KVIA 3G06A 3E6JA 5GMKa 3CCSS 5DETA 2DH9A 2RT3A 4LI2A 2M52A 2RRAA 4KT1A 3W3GA 1UAWA 3CPWR 3CCLS 3US5A 2V70A 4Y0FA 2M0GB 2BNHA 4H09A 3WPCA 2DNMA 3VAIA 1U1QA 2I38A 1X4HA 2DHGA 2XWTC 3C6NB 2CPHA 2CQ4A 3TYTA 1JJHA 2PEHA 2MY8A 1VQMS 2DNQA 3R27A 3BO3A 2P1OB 4F25A 1M5PC 2HGLA 5IFMA 3FXIA 3TP2A 4Z61C 4Q62A 4LSXC 1M90T 1OPIA 1FJ7A 4J0MA 4Z8GA 4PSJA 4CNCA 2XSFA 2V9TB 4PKDB 2R9UA 5LJ5Y 1FJEB 2KHCA 2DNHA 3CCMS 2LCWA 3UE2A 3CCES 2JE0A 1JJ4A 3W3NA 1U1OA 2LA4A 1X5SA 1U1LA 1H6TA 2CQ2A 2XOTA 3OGKB 1X5PA 4LJMA 3ULUA 4OQTA 5AZ5A 1SJRA 2XNRA 4ED5A 2M2BA 2LKZA 3FEXB 2MZSA 4RCWA 4OZ0A 3E4GA 1ZZFA 2GHPA 2AYEA 5GVQA 2Z7XB 1B7FA 5DM7Q 2MB0B 5JVGQ 4J4LA 2MKCA 3C6PB 3NS6A 2RU3A 3EGNA 3ZZYA 3VALA 1WI8A 4FS7A 2DNYA 2CPEA 3V4MA 1KD1T 1M5VC 2G1DA 2OMTA 1P1TA 3CIYA 2DNLA 2MQOA 4WFAQ 2FC8A 2CPXA 4ARNA 1VBZA 4Q3GA 3UL8A 4BSRA 4ERDA 2MZQA 3RGXA 3G8TA 2J0QD 3CULA 1FHTA 3OGMB 1U6BA 2XS2A 2WQWA 2KG0A 4R5DA 2OMWA 2EVZA 3G39A 4L3AA 2YTCA 1OTMA 3CD6S 2Z82A 4HQ1A 2OTLS 2UZYA 2CQ3A 1YHQS 4C7QA 3BEGB 3UL7A 1KOHA 4XGOA 1U0ND 2E5IA 2HVZA 2KN4A 4BS2A 3CC7S 2M70A 2AYGA 1JL5A 2O6QA 3P3DA 2SXLA 2YH0A 3PIOQ 3I56S 5CA5A 2UP1A 1X4GA 2E5HA 2QA4S 3B4MA 5HZLB 3UL9A 4FHOA 2CQIA 2DISA 5MLCV 2P1MB 3WPGA 5JVHQ 2KU7A 1OO0B 1RK8A 2D9OA 1U1KA 3NNAA 3CXCR 4IM6A 4WKRA 3WPIA 2DNRA 4TU9A 4Y61B 5AWCA 1IQTA 1WI6A 2DH8A 5H1SV 2XNQA 4Y00A 2PE8A 3J7YU 4UQTA 2MQMA 2MZ1A 3TO8A 3DXBA 2AD9A 3THPA 4TU8A 5B0TA 4AY9X 5LJ3Y 4Z94G 2RR6A 2EK1A 4V2CA 2Z62A 3GOZA 2UZXA 2DK2A 2A0ZA 3CCJS 5EN1A 3BO2A 1P9AG 5D77A 3G3BA 4R6AA 1SJQA 2DNGA 4M7EC 3G6ES 3MUTP 2X1FA 1VQ4S 3CIGA 1ZZNA 1Z7XW 1M9SA 1HL6A 3MUVP 2WFHA 2WQXA 2Z63A 2CPJA 3NS5A 1VQ6S 2MQLA 1YIJS 4LI1A 1WWHA 5CYJA 2L41A 4EGLA 3ZYOA 2VOOA 2DNKA 3G8SA 4R5CA 2GO9A 2DH7A 1DBDA 1QVFR 4MN8B 1H2VZ 2CQBA 2WBRA 1WTBA 4Z79A 2DGVA 1XECA 2KH9A 4WFNQ 1WWLA 2M8DB 3SDEA 2CPFA 3OGLB 3NNCA 1PGVA 4L3FA 4C2AB 1HD0A 2D9PA 1VQ7S 4P8SA 2KRBA 1O0PA 5D3IA 4NKHA 3UWTA 3MI7X 3S01A 3UD4P 2VONA 2K8GA 2CQGA 2OJ3A 3RGZA 1WF2A 1U1MA 1WELA 1U1RA 2DB1A 2LMIA 4YEBB 4KNGA 3RFEA 3VQ2A 1AUDA 2N7CA 3EX7B 1M5OC 4R09A 2XS7A 5D78A 2E44A 4Q3IA 2HZCA 3O6NA 1YWXA 1VQKS 3RIZA 1WHXA 1U6FA 5CMNA 4ECNA 1DS9A 2A3JA 3NMRA 1H6KX 2X1GA 2ZJPQ 1SJ4P 4R07A 1QYYA 4WIIA 3MD1A 4WFBQ 5FJ4A 4EZGA 4IO9Q 1VQ9S 4TU7A 2FHOB 1FXLA 3A79B 2OMZA 3PMHG 2U1AA 1OIAA 2RQ4A 2DNOA 2MKIA 3Q2TC 1XEUA 1VBXA 2RA8A 2HGNA 3VAMA 3E3ZA 2ELLA 4MQWX 1KC8T 3E2JA 2KXHA 1K5DC 4U7LA 3C6OB 1WEZA 4WF9Q 1H2UX 2OMXA 1OOKG 2B0GA 4PKIG 2JX2A 3CCQS 1N52B 2CQCA 4NKGA 5B0NA 3MURP 1O6TA 2DIUA 2CPIA 1KQSR 1W2BR 3OJAB 3VQ1A 1K5GC 2RNEA 3CMAS 4U08A 1DFJI 2DGOA 4PRFA 2Z81A 4U06A 2Z65A 2LXIA 2KG1A 1WG1A 2DO4A 1SJFA 1VQLS 1GWBA 4XOSA 2E5JA 1S72S 4UY8T 1IO0A
chains in the Genus database with same CATH superfamily
4L75A 3R5BA 3I5CA 1PG5B 2AJFE 3V81A 4PUOB 4ZN1A 4OYBA 3MMAA 1IBCB 4DCPB 3H0PA 2ROEA 2OMUA 5B08A 4JI6F 2NZCA 5AJ3J 1AT1B 2Z7XA 5HATA 3WX8A 3TJ8A 1L3KA 3L09A 2W9CB 1BE4A 3MOZA 4DFKA 2LEAA 1EB0A 4EMDA 5EWGA 2Y5QA 1NZAA 1V3RA 3PX6A 1WC4A 2HQCA 2LXUA 2MQQA 4DX6A 2OPSB 2R7XA 2OFGX 4KTQA 5KG0A 2CNLB 4HI2A 4O4GB 1GXUA 4YDXA 1TV6B 3AODA 3VAGA 3HZEA 3KK2B 2F9JA 3M8QB 3RW6A 3Q8QB 1K1SA 3KJ4A 3JSRA 4ZKAA 2VG5A 4B3TJ 1R43A 4QW8A 4DUYJ 1HYSB 2B5JA 4CT9A 5ETSA 4DUZJ 2UXBF 4ZITA 1FDDA 1QSYA 2AKWB 2YKOA 3JYTB 5HROB 4BSSA 3ZYJA 2KT2A 3OBIA 3GWCA 3TANA 4KYZA 2R2SA 1XJWB 4OX9F 1FKPA 2AQ4A 1PJ5A 1KOOA 4GT6A 2PGCA 2MLZA 3P72A 3HZGA 1WKKA 1CJVB 2V63A 5J1NA 4DR3J 3JQJA 4AD6A 5ETKA 4R8UA 5GAEU 4FYWB 3DI6A 4FNHA 3CIMA 4P73A 5A6PA 2NPIA 3MCNA 3H5YA 5DGBA 2JZ5A 3CW2C 3GIIA 2CUYA 4BWJA 1YZ7A 1VC6A 3HHEA 4QYRA 4WKYA 3QLHA 2E1MC 3TW0A 1R89A 2FC9A 4DR5F 5KOXA 2AZ3A 2G4BA 5D0GA 2WW4A 4IYQA 4PCQA 2WHOA 1LTXA 4F4YA 2HIYA 1VRTB 1PSDA 3KLGA 5A8RA 3FVYA 4OJGA 3UDCA 3ILJA 1S79A 3BKTA 5GAEI 2ZH6A 2BJ1A 3A1YG 4IFVA 4ECQA 2AYMA 4KV8B 3A3PB 1Q1KA 3FBEA 1HHQA 5IJBA 3FC9A 1S1VB 2HEKA 3HJVA 2RHQB 3N9UC 2ROGA 4NASA 4YR0A 2DH9A 2RT3A 3O8WA 4I7FA 2JC0A 4RBUA 1JJHA 4MJKA 1VQMS 4WXWA 2R7UA 3AJ2A 1M5PC 5I4MA 1UCNA 3FSIA 3ENVA 1NJYA 3GLJA 3H8YA 2J9CA 3ULUA 5C42B 2NREA 5HLFA 3QJLA 2IM0A 2WOMB 2FGCA 4YY3J 2XO6A 2XYHB 2XG8A 2ATLA 3IR7B 5KTQA 2DR8A 4X4QA 3CULA 5E0OA 4R5DA 4B3RJ 3RGIA 1RLDA 3B6BA 3PKMA 5DQGA 3ZTOA 3R7SB 2E5IA 1FWLA 3MEEB 2BKPA 3CC7S 2YQ3A 1CULA 2OKQA 1TK5A 5B0EA 3N01A 4ZPDA 2K1RA 1IKVA 5KG2A 1TUVA 3DYAB 3UL9A 2GVZB 4CT8A 2DT9A 2YNHB 1TK0A 2W4PA 3WPIA 2AJ4A 3MCMA 2WVFA 2KHDA 4PXBA 2QA4G 1CLFA 5J1EB 1Q0NA 1S1WA 3SFGA 1RKIA 5EWEA 4DR6J 1TVRB 1E6VB 1RABB 1S49A 4LREA 1EKSA 4JI5F 3DMJB 1WSRA 1JLCA 4HHJA 2DGVA 4H4KA 1YSJA 3HCXA 4X4NA 3NNCA 3E01B 4TLRA 3UQSA 1O0PA 3DLEB 3MI7X 4FKYA 1UTAA 2CQGA 2NYIA 2RB7A 4DSJA 1NDCA 4DSFA 3GFYA 2N7CA 5KFEA 2HZCA 3DRSB 4QPXA 1RBOB 3QMQA 4JOUA 2HNYA 2RQ4A 2E1RA 4CH7A 2V0NA 3RB3A 3IMQJ 2Z8QA 2JX2A 4DWIA 3D3BJ 2DGOA 3M8RA 1UPPA 2GGPB 4P75A 1YBAA 4UY8T 2PDAA 4QR2A 4NZRM 4JYAJ 2RQMA 2R8HA 4WK1A 3S6EA 3QSYB 4JUZA 3M8PA 2IRYA 4LSNA 3KUHA 3H42A 2N3LA 4LF6J 3PRVA 3SSSA 1YBUA 1N0VC 1FA0A 2P1PB 1HPZB 2CNKB 3W9IA 3CDAA 1TL7B 3K8WA 1HNZF 4IG0A 2X1BA 3AY0A 3IR5B 2M3DA 2IY5B 4F0KA 2QC3A 2HS0A 1GNKA 1SKUB 2RRBA 1MROB 4LXSA 3PNIA 1SVDA 1DY3A 1RT2B 1F2HA 1BGXT 1WF0A 3KLIA 4LT6A 1RTJA 2PC6A 3MGJA 3J7ZT 4AQYF 1RT5B 1NAQA 3VGUA 4DV2F 1BQNB 4O0IA 2PA8D 4O0NA 4XDDA 4B3OB 3SSRA 2RDIA 1O5JA 3CJ3A 2M4MA 4MIBA 2IM1A 3FMBA 3UNYA 4B9NA 4B08A 5AWDA 2PA3A 2XCPA 4OHZA 1RA7A 1HA1A 3BB5A 1C0TB 4LMZA 4M63A 5GMEA 4EWTA 1N5QA 1HLWA 3BYRA 1WEYA 2UUAJ 5A5CA 5KFJA 4RWTC 5DZ7A 1VHIA 2RS2A 1S5ZA 3BZ5A 4C98A 3W3MA 2ADCA 3KLFB 1OY6A 1R8AA 2VG7B 3W65A 3DU6A 2YH1A 1NNDA 1KEKA 3BSNA 3NBPA 2DNZA 4N56A 1FRKA 4ZCIA 3EJMA 3EM1A 3HHLA 3GCXP 1KBRA 5L1JA 2YNGA 4RNHA 3EXCX 1Y0HA 3BGFA 2HNZA 3V6KA 1UZHA 1Y5LB 2IHR1 5M2RA 4RCAB 2MJUA 2BQ3A 2A0FB 3M8SA 4JI0J 2VV5A 1ZETA 2XY7A 2DGTA 4ZLJA 1SKWA 1CVJA 4UY85 2JNJA 1U49A 3EDQB 3ITHA 2MSTA 1VRUA 2EC0A 2P1QB 5DDRC 3HVRA 1EX8A 4USTA 3QO9B 2MGZA 3ZTSA 2CXEA 1U48A 3VV2B 4UOFA 2MJNA 1T7PA 1JJCB 5DETA 3M6XA 3W3GA 3CPWR 1N4LA 2V70A 2DTJA 5IC6B 4K2JA 1NXIA 3WC2A 4H4OB 2P1OB 2ZE2B 2HGLA 2ZEJA 2ZNYA 1S4EA 5E3CA 5LL6d 2XGQA 3KLHB 5KFSA 1CSJA 2JE0A 4KHRA 2CQ2A 3OGKB 2C3MA 5GVQA 2LQ8A 4CP5A 2NYHA 2RDJA 1RWUA 4N8OA 3C6TB 3O1LA 3J7Z5 4LVOP 5ETQA 1I94J 4EEYA 3OGMB 3NOGA 3HHKA 3MMCB 2YTCA 1RT3B 1F5AA 3ONQA 3D67A 5I3PA 2O6QA 4AL6A 1FCAA 3AA9A 4IFYB 5C25A 2ZBCA 3NGSA 2XMTA 2NXCA 4AFFA 4FYDA 2Y9HA 4JV1A 1I3OB 4NLWA 2MLYA 2B43A 5B09A 3G3BA 2GFFA 3KHHA 4AE5A 3JTOA 2HQGA 4C0BA 3W2VB 1R8CA 1XECA 3Q8UA 3MAAA 4NKHA 4PXDA 3ETMA 3UN2A 4K4YA 1KWMA 2HW3A 3T5JA 2DR9A 5H9FK 2J6SA 2GIFA 4I6WA 1T3NA 3TQ1A 4YB6A 3FJ2A 3PFOA 2XS7A 1YWXA 3M6UA 1DS9A 3BBFA 1YLXA 5DQHA 5H9EK 2YQ0A 3PKYA 2XMWA 4GO7X 1H98A 1RWXB 2KVQE 2PT0A 3SSQA 3JAMY 5KFOA 4HACA 2RQKA 3BSCA 1L3SA 4MQWX 2OEMA 4PKIG 4CWBA 1HI1A 1RXOB 2DIUA 4PQAA 4OYAA 3W3SA 2LXIA 3RR7A 4X4PA 2QSWA 1VQLS 1GWBA 3UN9A 3SXLA 2YNFA 3C66A 4FMZA 3AAWB 3ZZUA 3MAQA 1IVZA 4C2MA 1RBLA 4UFRA 4V1Ak 1S1XB 4JP8A 1WOSA 3DLGA 2CJBA 2KFYA 3CCTA 3OLAA 2YWHA 3R8YA 1P9QC 2VICA 2CG4A 5DLGA 1TFWA 4L6V3 3VWSA 3JB9j 2ZH4A 4Y34A 2ADBA 3BH6B 3ZYNA 2CYYA 1X31C 4BV4R 2Z66A 3GIKA 3T1AA 1GAOA 4FVMA 1GQEA 3DDIA 2GQ2A 3WBZA 2JLGA 1RWNB 2WONA 3QZ8A 2HMIA 4URQU 1MWZA 3MWBA 3NP5A 4F26A 2FVSA 4F0HA 5JXSA 3GILA 3E51A 4DG1B 3W8PA 3DDKA 2E5GA 4BBYA 5K8NA 5I3UA 4DDFA 1YK9A 2XMAA 4R08A 1JMTA 3M30B 1QLNA 2MXYA 4DF4A 2H4WB 4W4MA 3CMES 2B4UA 2LQ9A 3D0IE 3D6TB 2F4FA 4C6AA 1OTOA 2G0CA 3D4JA 2BOPA 1NBEB 4OZ1A 1HIYA 1S48A 1W8AA 1W25A 3W2WB 3OTBA 3PW4A 4LFCJ 2Z4PA 3DN9A 4B02A 1XNRF 1YQHA 1J5EJ 1IKXA 5A76A 3RFJA 4YR3A 4ED0A 2V6AA 1XK8A 4K5RA 3D1OA 3H4BA 2QYGA 1F6TA 3AB2B 3KK3A 5F8NA 4ZVHA 5L9NA 4Z2XA 2KI2A 3TUJC 1N32J 3RBZA 2B4VA 3KJNB 4B9UA 4A8SA 1U1PA 4K2XA 4ID8A 3LOUA 4CYUB 5HVGA 2JEGA 2VDHA 1FD8A 1FNMA 2AEFA 2BVZA 4OHXA 4ELVA 2MHNA 3AH6A 4LF8J 3C6UA 3OFGA 2R2UA 1VJWA 4ECYA 2QMXA 3W63A 1RSCA 3M2RB 3KMSA 3EYZA 4C8LA 4ZP9A 1KONA 4K4ZA 1HNXJ 5FD1A 5HQMA 2IBOA 2F4VJ 4TNOA 2LA6A 1ZH5A 3CCSS 4YDDB 4I2PB 4KT1A 3US5A 3ZTQA 1MSWD 2BJ8A 3R5CA 3TYTA 1OSCA 4ECTA 5B0CA 4OYPA 3VGTA 2CIMA 3K8VA 5A0YB 1OPIA 3LP0A 3U02A 2FJBB 5C24B 1B70B 2DNHA 1RCXB 2MDAA 1JJ4A 3W3NA 5KFDA 4NLUA 4GC6A 5EWFA 4WE1A 3H59A 4K59A 3C6PB 3NS6A 2UVWA 3OTCA 1CPZA 1KRPA 1YJVA 3V4MA 3WC0A 3CIYA 2KJVA 4ILLA 4NLXA 2WQWA 1Q4RA 2XS2A 1BLUA 2A2CA 2R4FA 2HVZA 4P52A 3C15B 2J0XA 3NGDA 3IA0A 3PIOQ 4E98A 2PIIA 3I56S 1QE1B 5HZLB 2NR0A 2D9OA 3CXCR 2ZDOA 3PRDA 4CLLA 4UF4A 2IA6A 4RNMA 5CAAA 4Z94G 2A0ZA 5B0FA 3IBFB 1S4FA 5FLXU 4CO3A 2HBQB 4LI1A 4EGLA 3OXFA 1H2VZ 5KFWA 5GADI 1E6YB 1RT6B 1BWVA 2OJ3A 3RUBL 3DGPA 3LA0A 4J9RA 4NLGA 2AGOA 1KTQA 1HHTP 5A8WA 4AT1B 5K8OA 2C22A 3E3ZA 1VQYA 2VBWA 2Z2MA 1UVJA 1J5OB 2GVDB 4OZJA 3PRBA 4B9VA 5KT2A 1T3OA 1JLFB 3T1HJ 2XMKA 1PKUA 1ZBTA 3Q89A 4KBIA 4DF8A 1SJFA 2W4DA 2A10A 2ZKTA 1UP1A 4OZ2A 1T05A 3O53A 2OAUA 2PD1A 2KZMA 3CC2S 2C42A 4OV1A 1Q8BA 1YJTA 4JV0A 3D66A 1RDRA 2IAJA 3DOLB 3EDRB 4J9NA 1HWJA 4OJ3A 2Z2YB 1S10A 2GAHC 4OI3A 3ULHA 5KFRA 1HQEB 4QIGA 4G1IA 5B4PA 2DGUA 4UQGA 1UW4A 5GQRK 2H5EA 4DL6A 3JSMA 3SCIE 2BQRA 4UW2A 2NUUG 1TELA 2F8EX 3QNWB 5GAGI 2EFNA 2X1AA 4QIVA 1F5CA 4LF7F 2I5JB 5AXLA 4WCEQ 1D8YA 3QT8A 2UUWA 1FJCA 2JVOA 2AT1B 4LF5F 5DG8A 4PXEA 3JS9A 3HX9A 2RAQA 2I2YA 3QGIA 3ZNJ1 4GVLA 4LQ3A 5U47A 3DXSX 2M8HA 4M95A 4HDHA 4CP6A 3GJTB 1YI2S 3QRQA 4K17A 1JLEA 2OMYA 2ZDPA 3DFEA 3G87A 2VFRA 4HR2A 2HFOA 2L9NA 2MZRA 2DD8S 3D0GE 2IVYA 3CIZA 1XEZA 3N79A 5C5JA 1QVGR 3P49B 1SQ0B 3AD7C 1XR7A 1WEXA 2MKJA 4DV5F 3KHLA 4KHPJ 2UXCJ 3BV8A 1U8WA 3M4XA 1CG2A 1REVB 3VF0B 2P6TA 4DI6A 2VQFF 1SC4B 1OMSA 5HP1B 4DL3A 3PJWA 4PR6A 5F9NA 2QIFA 1XTZA 3W7BA 4EZ9A 3RB0A 1GX5A 1LW0B 3H5SA 1X4DA 4RW6B 3ZYIA 1AW0A 1A6LA 2BW2A 2H5IB 2EBGA 5LMUJ 4QQBA 2XZWA 3QGHA 5IM0A 1O8BA 5CMPA 1KS2A 2UU9F 1K0VA 1GMVA 4V2EA 2ZM6F 2IBKA 1BQXA 4P74A 1DQAA 5KAKA 4OHWA 4ZHRA 1N0UA 1AA1B 4F2SA 2J9DE 1PILA 5G0RA 4OI0A 5HDHA 2OHDA 3PX4A 2GA7A 4HEA9 4C0HA 1SQGA 3BDEA 3BQ2A 3TA2A 3A8JA 4H09A 4MIWA 5D0EA 3R6GB 3Q83A 4NI2A 2CQ4A 1ZS6A 2B9YA 2LU1A 3POTA 1H72C 3TARA 2JHEA 1S0MA 1PC5A 3DKDA 4PWDA 2CZ4A 2IYGA 2LA4A 4LSLA 3C19A 4OQTA 5EX3A 2VU5A 4QW9A 4OI2A 2DHHA 1HBUA 2V9KA 3M6VA 4J9KA 1QDUB 1NK0A 2CPEA 3HFVA 4WFAQ 5HBMA 2HHPA 4P7VA 2OUGA 4C3LA 2K7JA 5E3QA 2XBPA 2J0QD 2OELA 3MFHA 5KFNA 2OMWA 2OTLS 4B3SJ 1CJUB 3AD8C 4BS2A 2YQ1A 1P9YA 3DM2B 4DV3F 2ZH8A 4OI1A 4FXDA 5BXIA 3H4DA 2LXFA 4KHMA 2RHSB 2DNRA 1Z2ZA 3HVTA 3HHLD 2DR6A 1S1TA 4B9MA 2J9DA 4DMZA 1REGX 2CFXA 2I8EA 1Y10A 4L74A 1SB6A 2DNGA 4U8VA 1JLAB 3HULA 3QWUA 1UA0A 3MUVP 5KFLA 4JI2J 7FDRA 1N33J 1N5YA 2L41A 2HRUA 4L3NA 2VKRA 4J9QA 1S0VA 3RZAA 4Z79A 4WFNQ 1IBMJ 4ECUA 2J0WA 4WBFA 2KRBA 3S01A 1CS4A 2VH7A 4X62J 3WIVA 1NKCA 3T5LA 1V9OA 4YEBB 1TUWA 2BYCA 1S9GB 3CB4A 3W5ZA 5IZHA 3ZZRA 5CYMA 2MHEA 5E3RA 6FDRA 4DX5A 3HJFA 4C3KA 7FD1A 2BANB 2IC3B 2QN6B 3C6OB 1C1CB 3J81U 1U0HB 3BGLA 2CPIA 2L9DA 3CMAS 2Z81A 4U06A 1LQ9A 4K50A 4Q43A 3FMWA 3H5UA 3EUNA 3GYGA 2H5JB 4ZVEA 4XOSA 2E5JA 1NB7A 3KDOA 4F3MA 1X5OA 2LP4A 3IWLA 5LT5A 1URRA 3R1LA 2R42A 1CJVA 2D74B 3LH2S 4PQ8A 2ZH2A 1NM2A 2HIQA 1JNZB 3I82A 4FBUA 2HHVA 3ZFVA 3R7BB 4R0JA 5JMNA 4QR0A 1NK4A 3I0RB 4MAKA 1I6JA 3I87A 1SKRA 2XLKA 2E66A 4F8RA 1V5IB 4NWBA 1T9VA 3U1LA 2N3OA 5CXTA 3AA8A 2MQ8A 3MEDB 1OYEA 1SUQA 2MKHA 3WPDA 3G82B 4Q5VA 3K5PA 5KT5A 3AXMA 2WQUA 4F3QA 4Q45A 4CM2A 3NAHA 4AXJA 3KNGA 3MFIA 4KFBB 3NGTA 1CQMA 3DLKB 3BJYA 4MKYA 3K5LA 4ZJOA 1M0ZA 1AUSL 4Q0BA 5KG5A 2XB2D 1S9FA 4P10A 2E29A 2BA9A 4JV5J 2RILA 3KOAA 1SBRA 3DOMA 1ZM2A 3OR2A 5IQ6A 2AEJA 1S6UA 2QFJA 3Q8YA 1X0FA 1Q78A 4LBHA 2PN6A 2ZH3A 4ZVFA 1LW2A 4IOCQ 1LWFA 3AJDA 2M7SA 4MIAA 2W2NP 2DHSA 2YWFA 3V6DB 3UN3A 3Q8PB 1SC6A 1WC6A 3MR3A 3MEGB 2F3JA 1X4EA 5K8MA 2DGXA 3CJRA 2HVDA 1K9MT 4CLSA 2VPYB 4ZIWA 4FPRA 4M5IA 2OPQB 4ECOA 3QFHA 1RTIB 2MY7A 3WPFA 4WK3A 1KP6A 2Y1LB 2V2KA 4M5DB 2BEFA 4RW4B 1X4BA 3H7HB 2YKNA 2LECA 4KO0B 4H4MB 4X65F 3UO0A 1M1GA 5G4DA 1Q86T 4LF4J 1YGYA 1HNWJ 4QBUA 1TFYA 3D1HA 3MEEA 4HI1A 4G1QA 1WDTA 2E7XA 4OYIA 1RACB 1XMBA 5KG7A 3T3FA 4RPFA 4R6JA 2C3PA 2HFUA 1M10B 4X2BA 2EFOA 2Y0BB 3SBMA 1N8RT 2AZ1A 4RW7A 2H54B 3V6JA 2UUCF 1NO8A 1H73A 3RRGA 3BSOA 1HWIA 3WPCA 2ZH9A 5ETRA 4ZVOB 1PAEX 4O44B 2N4CA 3OR1B 4Z61C 2JFKA 1RAGB 1TL3B 4LRBA 2WB4A 3KUGA 4HH0A 3V5RA 4WJBA 3EZUA 3CCMS 1NLKL 2B4OA 3UE2A 1A0OB 3TA0A 1QTNB 4FS2A 3GSIA 1NKBA 3FEXB 2GHPA 3D6FB 2AYEA 3CWJA 5KFGA 3FZBA 3HD2A 1OQ3A 5IOLA 4X4TA 3M9MB 1QUPA 4ZPVR 4DV0J 2Z30B 4O3QA 1Y11A 1JLQA 3GZ7A 1FVQA 1Y5IB 4BSRA 3SQGA 4ERDA 5AT1B 3PYDA 3G39A 2W4CA 2UZYA 1I51B 2V8GA 4G65A 3P96A 4HVZA 3CD7A 2H65B 3J7AN 1XQIA 4LRCA 4C11A 4DPTA 3F41A 5F8JA 2RJZA 4IM6A 3G2XA 2C2MB 4KKOB 3J7YU 2H4YB 5IV4A 5LJ3Y 1IR1A 4GC7A 3MAHA 3I9V9 1FFGB 1RLCL 4X4RA 3KNAA 1F1BB 2HHWA 1M9SA 2GQCA 4MKAA 4FF4A 5BR8J 1QVFR 1SV5B 2CQBA 2FVQA 1WNEA 2CPFA 2FLOA 2AWZA 3IP0A 1NH7A 1RTHB 4DR3F 2VQEF 3HK2A 5B7WA 2DPJA 4NE9C 2F8MA 1U1MA 3LUYA 3RB6A 4ZOSA 1HFEL 4R09A 2B3TB 4LF9F 2X7IA 1WHXA 4NLVA 4DX7A 4R07A 5FJ4A 3SIPB 2XMMA 4TU7A 5LMNF 2XSJA 4K0KF 1Y7PA 2MKIA 1NEEA 3KXDA 1KC8T 1K5DC 3V2UC 3C14B 2WVBA 3OVAA 1BQNA 1IJEB 2PEBA 5KT3A 3OJAB 2HS4A 3DRXA 4LF2A 3IO1A 3OSPA 2YNIB 3OLBA 5KFBA 1S72S 3PHTA 4EBCA 3T5KA 4W90B 5A2QU 2OSQA 3MCSA 1WC5A 3KK1A 4ZJLA 1N34J 2DHAA 1D3WA 2RKIA 4OX9J 1FS2A 3PVXA 2RSQA 3OT9A 3PXGa 1TMJA 4ZVRB 4N41A 2EFVA 3FDSA 2DR5A 3RTVA 1W2IA 3ADAC 5F0WA 3DOKA 4USJC 2WVEA 1N54B 2GMJA 4RWWA 1FO1A 1APSA 2LVWA 4F4XA 1CC8A 1WG5A 2OMLA 3BPDA 3MM6A 1VQOS 3ZZZA 3HVAA 5HVHA 5K9FA 3TX0A 1XWDC 3N6MA 2NLWA 3C8YA 1H2TZ 4LSZB 2HQFA 3U1NA 4DR5J 1Q79A 1NCLA 4RKUC 4U67Q 1OTNA 1HQUA 3H40A 1V6HA 4I67A 1H6UA 2WBMA 2DEIA 3BS9A 3PW7A 1XMQF 5SZTA 1N5SA 4RNFA 1HW9A 3BPSP 3EMTA 2A6OA 2ZFHA 4OMFG 4ZJQA 4X4OA 1NRKA 4DPOA 4TY8A 3ENAA 3A12A 1D8ZA 2GMLA 4DL7A 4P7TA 2NUHA 3TNVA 4ECRA 2XM3A 1VISA 2OTJS 4J9VA 4CO0A 1RTDA 2W9AA 2FY1A 2DJWA 5IYXC 5GAHU 3A4TA 3GJSB 4ED2A 2MQPA 4BDPA 2L3MA 3DRYA 1K73T 3V4IA 2K2PA 1VK3A 5DO2A 1VLOA 1QTMA 1SPBP 3ZZOA 3ILIA 4K4UA 5ITHA 1IKYA 2CQ0A 2GZOA 1K1QA 1XNQF 4ELTA 4KXFB 3O6QA 2ZNZA 4IDKB 1LV5A 1UWBA 5KFQA 4ATNA 1IKWB 5GMFA 1AZSB 2XCAA 3C6TA 3FRYA 4FBTA 5KFUA 1DARA 3Q8RB 2OPRB 5KT4A 4AW4A 1UVLA 4DHVA 3QGPA 4ZCMA 4V19X 3CE8A 1Q5YA 1Z2LA 2HBRB 4YOEA 2JLFA 3MM5A 2J76E 5LSOA 1HMVA 4OZLA 3O44A 4DS5A 3DC2A 5A8KA 4IQXA 3RBEA 3MUMP 2VHGA 3ZZ0A 1UEVA 3M05A 1Y3JA 4OX7A 4DLEA 2CQHA 2ZZNA 2G13A 1SQFA 2ZZMA 4R0EA 4Y2CA 5C7PA 1NU4A 1VK8A 2Q79A 5KFIA 2J5AA 4RBTA 4CDIA 5L1KA 3EXYA 1DQ9A 1TL1A 4DV6F 1T8EA 1VOMA 3BGRB 3TAPA 2YVSA 1S6PA 2ALZA 2K3IA 2BNHA 2I38A 2DHGA 4ZVUB 1TKDA 3C6NB 1RI7A 3NG8A 1Q53A 4RW8A 4WTOB 3OSNA 3V81B 4JI5J 1T11A 3TP2A 2ZVSA 2HKEA 1U26A 4ECZA 3MMAB 2PI5A 1FE4A 3CCES 1U1OA 1U1LA 3G86A 1X5PA 4OYMA 3DNCA 1ZOTA 1CEZA 2DRDA 3WHIA 2Z7XB 3TQEA 4YB7A 2EFQA 1LXJA 4NEYA 4KGVB 2OMTA 2D3UA 2YBVA 3A3NB 3P5BP 2DRBA 3G8TA 4B9SA 2EVZA 1U47A 1NUEA 5KG6A 4XIUA 4U6PA 2EKYA 3KWMA 5DS7A 3UR3C 3UR0A 4JI1F 1IJFB 2QA4S 1FFSB 5KFMA 3IG1A 4MFBA 2DH8A 5H1SV 2VG5B 3RU0A 4URGA 3LWMA 2W8LA 2JJ4D 3TO8A 2B5JB 3THPA 2GV1A 3I4PA 1S7IA 3RJMB 5EN1A 3G6ES 3MUTP 3SI8A 1VQ4S 3LAKA 2JDJA 4C48A 4I6AA 4EUVA 4WP9A 4WYWA 1SL0A 2GO9A 1DBDA 1KNZA 1PC4A 5D6GA 3KJVA 1FKPB 1SJ1A 1QAYA 1WWLA 5J2NA 3SV4A 1PGVA 4L3FA 2K06A 4C2AB 2D9PA 1HNZJ 5F8IA 4NZ6A 1EETA 3G8QA 1H3DA 5C2GA 2DY1A 4R8UB 2K8GA 2CAJA 4C97A 2P6SA 4KNGA 3MPYA 3VQ2A 3DI6B 4DN9A 4P71A 2FJVA 1IR0A 4XTTA 1UL3A 1S6QA 1SJ4P 3A79B 3PMHG 6FD1A 3D6MB 4O3PA 1D9FA 3VAMA 4AQYJ 3MPDA 4WF9Q 4DV2J 4DS4A 1T9TA 2ZH1A 2B56A 4R5PA 2KG1A 2DO4A 3G6XA 4WU2A 3D6HB 1KQGB 1TU0B 3KLGB 4PG8A 2W01A 3EZOA 1HQ2A 3GIMA 3SCJE 4ID5A 1O6SA 2B9EA 4IFVB 1S9EA 5E3PA 4YFUA 1KVJA 1C4AA 2C2KB 2DGSA 4OI4A 2UV8A 2ZWPA 4M5GA 1DRZA 4C0OC 1VC0A 5K14A 3MM9A 5IS2A 4EO6A 1TK8A 4UT4A 5DQIA 4DQPA 1HD1A 5L39A 1U1NA 4I7FB 1WOOA 2QV6A 4ETZA 4H4KC 2RMLA 2FT3A 3UCGA 4KGXB 2BE7D 1Q8IA 4CO4A 3L7UA 1ZPVA 1RJJA 4F2RA 3M2VA 1Z1ZA 3CD0A 3DHXA 3I32A 2Q1LA 3H90A 2ID5A 4LBIA 4KGKA 4CLTA 2B9WA 5HSPA 3BR8A 1OZNA 5HLFB 1RHJB 5D3GA 1U2CA 1HBNA 3BZQA 1BQMB 3RJ0A 1A7GE 5L1IA 1YJRA 2YX7A 1K44A 1C4CA 3D2WA 1S1UA 3CJ4A 3UW1A 2WQVA 2BJ9A 1UFKA 1FNXH 2F1FA 4RR5A 4Y2MA 1JLGA 3TAMB 2AF6A 4JI3F 1PYTA 2IJNA 1CULB 1TP7A 2HQ3A 2K1RB 1IKVB 1VS3A 5ETVA 1RT4A 1NJWA 3GV8B 3CNQP 1L3TA 3R7NB 1G2EA 4O3OA 2DXDA 1S1WB 3BO4A 2FIUA 3HO1A 2DRAA 4PWWA 2WK4A 4PYAA 2QGFB 2JVRA 1JLCB 5ETMA 3BKFA 4MT1A 1C0UA 4QXEA 2MSSA 3HI9A 2MKSA 2OH2A 2BM1A 2CQPA 1U8SA 1WHWA 1HWLA 2QEXS 4A47A 3DDNA 3E3XA 4DZ6A 4DL2A 2XMVA 5HMYA 5L38A 5HL7Q 3R97A 4DQSA 3SEOA 3MR2A 2KXNB 3NCRA 2XO7A 3MM8A 4CNZA 1VJQA 1URNA 4OQJA 1BXNA 2JE1A 5B0AA 2MYFA 3MECA 2EFGA 2YX1A 1VQSA 2W2PP 2VPXB 2Z58B 1UVMA 1WSVA 4H54A 4FNIA 3ILOA 3MR7A 2M0GB 1ELOA 3CEDA 2PEHA 2MY8A 5IT4A 4QYZK 2DNQA 3R27A 3BO3A 5IWAF 2OPPA 4TYAA 4DL0C 4CNCA 3M8PB 5LJ5Y 5J2QA 2XOTA 2IJRA 2M2BA 1FRXA 1FKOA 2VZ9A 4Y65A 3HKZD 1TL4A 2MB0B 4CNYA 2HVHA 1M5VC 4ARNA 4L76A 2HRYA 4QYZJ 3HHLC 3JQKA 4NXMF 4NCBA 2HLTA 4IG0B 3IS9A 3K59A 4HL9A 1SH0A 1KQFB 4C8YA 2WVDA 3EGVA 4ANCA 3OTOF 4I1TA 4QWCA 1JL5A 2YY3A 4A8YA 2IVMA 3A8KA 1IUJA 4USWA 1LWCA 3KLIB 9ATCB 1RTJB 3D54A 4M5NA 2P2CB 2ZUGA 4E8UA 5AWCA 2E7VA 2JLEA 4U8YA 3DXBA 2IRXA 3K2YA 4NRTA 3ZTRA 4V2CA 2Z62A 2ZBIA 3CCJS 2OEKA 2KZZA 5HMZA 4R6AA 2HFVA 3K58A 4UOHA 3CIGA 1UKUA 1HL6A 4X64J 2I9SA 3OUYA 5KFAA 3G8SA 3KUEA 4X4SA 2HFZA 4MN8B 1WTBA 3CJTA 1EP4A 3IWXA 1NPPA 1AFJA 3AXKA 4DSKA 4ZPTR 4HTJA 4NLSA 3GV5B 2W7PA 3JXOA 1WORA 3HF5A 3UWTA 1YBTA 2XEXA 3KMQA 5FIIA 4U7UK 1Q95G 2LMIA 1MWYA 2H9ZA 4WZMA 1IBLF 2V4RA 1ZYQA 4C8ZA 4HHHA 2BV3A 4TXSA 1VBXA 2R7TA 1ZM9A 2I1RA 4PYDA 4PQUA 2OMXA 3HHLB 1FKAF 2YNGB 4DV7F 4U08A 2P8IA 4QWBA 2Z0GA 2HNZB 3OFHA 3OQ2A 3GQCA 2UV8G 4DBQA 2GHVC 4I0WA 1MG7A 3ZTPA 3GTYX 3LF0A 2KM8C 3W9HA 1MMNA 3ITHB 3TUIC 3ZZPA 1VRUB 4F4AA 1XNRJ 1Q7LB 3PM9A 4QIEA 4FYYB 3W8GA 1RT1A 2IDEA 2MGZB 3UD5A 4KGMA 1WHVA 2PO4A 4IG3A 1D0BA 4A8KA 4CLFA 1NDLA 1F3FA 1U24A 3N5FA 4P2XA 4AXIA 3THTA 3UCUP 4L3KA 4IR9A 1NH8A 3IGNA 3WPEA 3FQKA 4TN2A 1ZA1B 4ES3A 3M6WA 4IOBA 3KKFA 4AL5A 4B17A 2ZBPA 4DPUA 2PMWA 2C2OB 4EYHB 3REZA 4GKKF 3L7OA 3CDBA 4AUKA 1HBOB 1PAUB 5CZXA 3P6YC 5KFKA 4P91A 1NJIT 3KLEA 4IUFA 1T9XA 1RYSA 1FK9A 4ED4A 3K7RA 2HNDA 2G0IA 4HKQA 5AWAA 4ZIVA 1RHUB 2HPUA 3QJJA 2P9EA 1XN9A 3VR1A 5C25B 1TKZB 1WF1A 1IBKF 2AMCB 5IT9U 3JTPA 4LR9A 4K4XA 1TKXA 2KM8B 3B4DA 3VGVA 4CH0S 2KL8A 4NA1A 5F8LA 4O4RA 3KLVA 5L9XA 3CJQA 3KFWX 4ZCLA 2K3KA 3MD3A 3ETOA 2D7SA 2IJFA 3MDFA 5DGAA 4M5JA 3M32A 4ED3A 1R0CB 2V4QA 3PJXA 3K17A 4WP6A 4OHVA 3MAAB 3G71S 2RIJA 1M5HA 5F41A 2U2FA 3BF4A 2QMWA 1LWEA 1NK8A 2ZJRQ 2CQ1A 3U1MA 5DDQC 1N6QA 2V8HA 2OI2A 4DR4F 4WYKA 5D8HB 3WPHA 1VQNS 4CO5A 2E5LF 1YRGA 2DXEA 3M8YA 1T0TV 5F0UA 1VRQC 2ZWOA 4HACB 3UFCX 3PW0A 3GFHA 4KR0B 2KVIA 3DRRA 4WWSA 2Y1IA 3B82A 3DRPA 5K8PA 1U1QA 2F5GA 1HR0F 3QIDA 3IRXA 4DFPA 4Q62A 3SZ2A 2E7WA 1N5TA 3K57A 3PYFA 3DLGB 3H25A 4MK9A 1JB0C 4LRDA 2X3DA 2KT3A 1HKAA 3W64A 2MZSA 3PYEA 2MKCA 4ANDA 4F04B 2V2QA 4KB7A 4OHYA 4W98A 4PAAA 2LQJA 4Q3GA 1FX2A 2I0XA 2MZQA 4TQRA 3FGVA 4U7CA 1DURA 1LK5A 1YHQS 4XK8C 4DCOB 2WONB 4MK8A 2R8KA 3AT1B 1U0ND 2HMIB 2KN4A 3Q8SB 2AYGA 2YH0A 2CKWA 2FD2A 4JI4F 2XMUA 1IQTA 1RTZA 4UQTA 4OZ5A 3HLUA 5I3UB 5JJBA 1ZA2B 2DK2A 3QSIA 3BO2A 7AT1B 4M5HA 1B7YB 4S0MA 1D0EA 1HBMA 1R3NA 2DH7A 1WKLA 1TTHB 2BXJA 3VZHA 5BYQA 3UDVA 3KHGA 2DXFA 1HD0A 2R7RA 2XHCA 3HHDA 4OYOA 1S7HA 3J81Y 2BRKA 1MU2A 1IKXB 3PW5A 2CJQA 2YPYA 4LF7J 3X1LB 4U96A 3R5GA 3KK3B 2AW0A 4N47A 2R7WA 4BC9A 3EGWB 3PTWA 4Q8FA 4LF5J 4DQQA 4DSLA 4U7LA 5DRKA 2FB0A 2BMBA 2O01C 1KQSR 3VQ1A 2ZKUA 4UZCA 1OY9A 4CTAA 1BD6A 3TVZA 2QE5A 4ED6A 2VUGA 2XZTB 2WSCC 3C6UB 4HH1A 4TKTA 3GIJA 1F5BA 4ZCKA 4WFZA 3K0JA 1DLOA 4ZS6A 2AU0A 2NXNA 3AJ1A 4PABA 1K8AT 4IOAQ 5HQLA 4DV5J 3TUPA 2BDPA 2WSEC 3WPBA 1CQNA 3LTOA 2KRRA 4F3OA 2DVIA 2VQFJ 3IRWP 1X8DA 2HHUA 2OMOA 5HK4A 5D0RA 1EZZB 2HFNA 3CJSA 4QWAA 1U2RA 2JWNA 4B9LA 2LFVA 4FD0A 1P8GA 3LP0B 4I64A 2CRLA 3AOBA 2VBYA 4ECSA 4ECWA 3L9ZA 1IWAA 4C8NA 3FFIA 3D3CJ 4NZ7A 3HSJA 4WE1B 4IH6A 3CCVS 3VAJA 3SCKE 2UU9J 3QFWA 2ASDA 3B8HA 2ZM6J 4RU2A 2LDYA 1RT7A 4PERA 2FTRA 4I2QA 3K5NA 1RAIB 3MF5A 4DZDA 2QX0A 1T9YA 4Q2MA 3H20A 2FDNA 1T9WA 5LSLA 1BMQB 2B4PA 4G3IA 2JOQA 5CABA 3PZPA 2AV5A 4LSXA 2AGPA 2MPUA 2VBXA 4B3MF 1PO6A 2AJQA 1S76D 1BHNA 1UA1A 4NLDA 1KLMA 3M2UA 4BLGA 1TQLA 3PACA 3RW7A 2KJWA 1EJ7L 1R8PA 1VIXA 4NLYA 3SMZA 1FEEA 3M1VA 5T14A 1S57A 2BEXA 3NNHA 3N0VA 1Q8LA 4J91A 1KVKA 2MZJA 2BE2A 3G9CA 3P5TL 2J8AA 2WB1D 2B6AA 3DGPB 1VBYA 1OWXA 2JQDA 2ACYA 1A9NA 1D09B 2GHWA 3NGUA 3ZZTA 4DV3J 5A8WB 4DLGA 2G9OA 1J27A 2V4JA 4IRDA 1R7IA 2VKZG 2QLWA 3UNGC 4P6QA 2M9KA 4L73A 3LQVA 1UFWA 2V94A 1CJKA 2FYXA 1NSQA 1UVKA 2QSFA 2V8PA 2HHSA 3QAEA 1X4HA 3WZ0A 1TZ0A 4IKAA 1T05B 3GSDA 4PSJA 3SFUA 5J1PA 4U7UD 2VIHA 4ENOA 1JXEA 3EVMA 2F63A 2IAJB 4P9SA 2XNRA 3QT5A 3M8ZA 1Y5NB 4OLPA 3EGNA 3ENQA 2DNLA 1RU2A 2HAIA 2QTWA 3UVJA 1KFSA 2RF2A 2A2DA 1TKTA 2Z82A 4HQ1A 3JSMB 1BUXA 1RISA 1RWKB 4C7QA 1Y3KA 2ZC3A 3OL6A 1OO0B 2ZC4A 2EKNA 2FJEB 2FVCA 2G1HA 2XMJA 1T9UA 1WI6A 3MM7A 1U45A 3GCWP 2EK1A 3QATA 4YN3B 1SJQA 1WOPA 4DV1F 2X1FA 1Z7XW 2VFVA 3J80U 4PXCA 4DFJA 2WFHA 2CPJA 1VQ6S 1YIJS 1WWHA 4FF2A 2DNKA 2GAGC 3THVA 4ZK7M 3CJKA 1VQ7S 3K89A 3JQMA 4J9PA 1GMWA 5D3IA 3EVOA 2DR7A 4QJVA 4P2SA 3T6JA 1IM4A 2EFPA 1Q5VA 3W60A 5KG3A 2E44A 3O6NA 1YRUA 3NMRA 3W1YC 3W9JA 2C3UA 1KDNA 1VQ9S 2FHOB 1DTQA 1R0AA 3VZIA 1R8BA 2DEJA 2V69A 3VQSA 1SIZA 1KLNA 2CQCA 1EARA 5B0NA 2HHHF 3TWZA 3UPFA 5T7LA 2Z65A 1JKHA 2Y1JA 1IO0A 2IYIA 5IM0B 3QBCA 3AQOA 2ZJQQ 3CJ0A 3RBXA 4ICLA 2ZD1A 4CH1A 4C3MA 4ZPBA 3RR8A 1M5SA 2B8QA 3ICLA 3NGRA 5AE2A 4Y28C 2KFZA 2XLIA 1ZIWA 1YJWS 1VGYA 2C2NA 1P1LA 5EGYA 3OXGA 4UUWA 1RUSA 3IAS9 2CPZA 4ZHRB 2RQCA 3KYLA 5G0RB 1KTVA 1P8VA 1DZ5A 5KFVA 3M9NB 4D3GA 2BX6A 4RU9A 1OY8A 3VAHA 3G3AA 4TZHA 2HGMA 4P2MA 4QOTA 4KQZA 2LEBA 1MNEA 2Q6CA 4NI2B 5F8MA 3POTB 4EO8A 2A6MA 3NEKA 4PG5A 2BUNA 1ZPWX 2DGQA 4PWDB 2Q4GW 5GMGA 4DR7J 4ES1A 3CJ2A 4ZLPA 4X65J 3T1YF 1QUVA 2C1EB 3T6BA 4LSLB 2APOA 4ZVPB 2XGPA 3UD3P 2AIRB 4KPCA 2H1YA 2Z56B 1HBUB 2VB6A 5AE1A 4EFAC 2W25A 4DV0F 3CCUS 2QFIA 5D4NA 2B7BB 1R6YA 1D9AA 5HBMB 4CLUA 2G2OA 5E5NA 3H2VE 2BJ3A 1T03A 2M88A 3I96A 4Q8EA 1S6OA 3IGVA 2UUCJ 2HWTA 1GT8A 2COLA 1NKEA 4DPYA 3LGNA 4ZVTB 4GKJF 2IVFB 1G1XA 4NLRA 4DR2F 4GRSA 2DITA 5FDLA 1RAJA 5IJCA 4USHA 3HVTB 1B3TA 1YJ7A 4LFAF 4IR1A 1S1TB 1DHMA 4B8CD 4I56A 4Z37A 3MPUB 3N6LA 3MMBA 2YKPA 4USKA 2NXJA 1N5YB 3C16A 2ZUAA 3QQCD 5BR8F 1DTTA 2UVVA 3W3LA 4N76A 2HSEB 3PEHA 4NCGA 1XKUA 5GS2B 4C8OA 1CS4B 3NMAA 3PFEA 4DR1F 4FCGA 4RX6A 3OL9A 4NYZA 1P6TA 4CO1A 4V19J 1PJ7A 5CYMB 1X5TA 4M94A 2XS5A 3BN7A 3F0NA 3ISND 3LP1A 3T19A 3M19A 2CG8A 3C3LA 3MOJB 1YITS 3EWGA 3KG0A 3W3KA 2IMOA 4ER8A 1VHFA 1OS5A 4LI2A 2M52A 5B0BA 3HT0A 1NZ8A 4Y0FA 2R2RA 3P4UB 2WTFA 1HNVA 1FVSA 2XI2A 1N34F 2PI4A 5J2PA 1FJGF 1CJTA 1RWOB 1G7CB 4PG4A 3N6NA 4ES2A 4FDFA 4JB8B 2VQEJ 3D28A 1SJRA 2LKZA 1QSSA 4USIA 3VVUA 3KG1A 4OYZA 2AHOB 2RU3A 4J9SA 4LF9J 2G1DA 3DU5A 2D41A 1VBZA 4KT0C 4PZVA 1VYAA 5LMNJ 1FHTA 4K0KJ 4K4TA 5CYQB 4L3AA 3TRGA 5D4LA 3FRZA 3A8EA 2FZCB 4ZP8A 1X0PA 5I42A 4OV6A 2FUG9 3P3DA 2F7VA 3NCQA 3CCZA 1SUQB 3I0SA 4NXNF 2HHXA 2CQIA 4CM0A 4DXLA 1AROP 2XYGB 8RUCA 4NA3A 3DLJA 4RBVA 3GMGA 3SQOP 2GW8A 5CD4H 4EBEA 3KHRA 1UVIA 1Y00A 4Q0BB 1YRXA 2HURA 3IN5A 1RA6A 4PG6A 1F3VA 5L46A 2O1PA 2W9BA 4OL8A 1RE1B 4N5SA 4FPIA 2MQLA 5CYJA 4GO5X 3GYXB 1VI7A 4K5SA 3DOMB 1RWWB 2M8DB 2FJXA 3OR2B 3TOQA 4NZTM 2BOAA 2BM0A 4OYWA 4ZVSB 1X60A 5K5MA 4CLZA 2B7CB 1LW2B 2DB1A 1L3UA 4ALZA 1LWFB 4ILRA 2A18A 1AUDA 3CD5A 5D78A 4X4VA 1VQKS 5CMNA 1SI9A 1XR6A 4XPEA 2ZHBA 3Q2TC 4LFBF 1XMQJ 5HANA 3E2JA 1IR2A 3CCQS 4AL7A 5F3ZA 2XYPB 1W2BR 3RAMA 2YKNB 1BQMA 2UVUA 4TQSA 1VQ8S 4RW9A 2HWHA 3HFKA 4OYXA 3TAMA 5GS0A 4G1QB 3BBCA 1FDAA 3ET6A 3NCPA 2F65A 2R7OA 2IFGA 4C9DA 4NPOA 4Q7AA 4CIOA 3GR0A 3TZYA 3FBCA 4CC4A 4RW7B 1PIEA 2YKMA 3BKUA 1JLBB 4URSA 1XCDA 3BN4A 3CVRA 1XNQJ 4FDWA 3KTQA 2Y1RI 5KG4A 2EEYA 2ASSB 3W3JA 2ZVIA 5HAOA 4GVBA 2XWYA 3P8BB 1WD6A 1NPKA 3T9ZA 2RD5C 4FXWA 3AQPA 2GX8A 1QY7A 1LNQA 4M5KA 1HWUA 3UDLA 2YKQA 4YHHF 1S97A 2FLLA 3G4SS 1HARA 2OO4A 2W2MP 2ERRA 1HI8A 1JLQB 2VG6A 2XULA 5J2MA 2EBEA 3SQGB 2GCFA 5CH7B 2C3YA 2IDLA 1R31A 1AXQA 4FZVA 4LF1A 5HQ8A 4YUDA 3G6YA 3Q22A 1N36F 4DV6J 3DGVA 2O5DA 2D3O1 3QIPA 1FRLA 4C11B 1ULRA 1SXLA 4PEQB 3Q8VA 3GYNA 2F9DA 1GEHA 2BACA 3VGSA 2ASTB 4QPTA 3LP2A 2VC0A 3FCVA 4BWMA 4DSIA 3ULAA 5IT0A 1WHYA 3BDPA 1N88A 1T02A 1H7XA 1C1BB 4OI6A 4PUOA 3CF5Q 4MKBA 2XWXA 2ZOMA 4JI1J 2CVEA 3PDNA 1UETA 5M2UA 4CILA 1F0XA 3A8IA 5M2PA 4R6GA 1P27B 2XSJB 3FQLA 3OJUA 5AXMA 2Z64A 4K4VA 2QT7A 4JI7F 4USMA 4QWEA 2W9CA 2HHTA 4FYVB 4M7EA 3BYPA 3G06A 2LLZA 3FCHA 4A8QA 4NLOA 2DNMA 2XWTC 3UN5A 2OPSA 2YX4A 3KK1B 5IFMA 4J90A 3OFEA 2RKIB 2AJ2A 4O4GA 4J0MA 2HLUA 2IFXA 4RUBA 5HVFA 2E1CA 2R9UA 1TV6A 4F36A 2J6UA 2B51A 3KK2A 2DBBA 4XO0A 5JUMA 4UZBA 3M8QA 1H6TA 3GFXA 4ELUA 3VQTA 4ILMA 2J7KA 3DOKB 1ZZFA 1HYSA 2B8PA 2E9ZA 3EPGA 3EVWA 3W5XA 4J9LA 3MM6B 2C2EA 3CJ5A 1FNOA 4HYKA 3JYTA 5HROA 5LM7E 3QZ7A 4DFMA 2UXDF 1G6BA 2H3EB 3BEGB 4PEOA 3TAQA 2BKOA 4LR8A 1GX6A 2SXLA 1RAHB 1HQUB 2UP1A 3TVKA 3CDUA 2PSZA 5EX0A 4JV2A 2P1MB 5MLCV 3R6LB 2KU7A 1RK8A 3NL0A 3GE9A 2R9LA 1XMOF 1FD2A 1ZAWA 2MZ1A 1HNIB 1Q8KA 4DV4F 3PR5B 3FSYA 4UUXA 3DLBA 2UZXA 3MMJA 2QL9B 4UTGA 1P9AG 1B0VA 4PPDA 4TY8B 4DL5A 1MN7A 3ZYOA 2VOOA 1YRTA 2AX1A 2B9XA 3BQ1A 1DFDA 3I31A 3OGLB 4X66F 1RTDB 1VRTA 1LEOA 4A8WA 4USUA 2D69A 4KIAA 2BABA 3RFEA 3EX7B 3V4IB 4Q3IA 4KV8A 1U6FA 3NKYA 4WFBQ 3PCOB 4EZGA 1UJ5A 1WTFA 1IKYB 2ZITA 1S1VA 2ASYA 1UWBB 3HT3A 1HBOA 4NLTA 2Q6BA 1N52B 1D9DA 3Q86A 5MAOA 3TUZC 1DFJI 1QAIA 4RUCA 1F9EB 3HKWA 4RZRA 2QLXA 2DY9A 1DAXA 2N4DA 4JI8F 3MHYA 1YJUA 2EW9A 2VPWB 4JI3J 3MM5B 3TI0A 1UMJA 4M1KA 1UFLA 1HMVB 5A8KB 1TKZA 3OW2R 1PJ6A 5C42A 1Q7YT 4CRJA 1H7WA 4GLPA 1FXDA 4KH0B 2UUBF 2RVJA 4BHQA 2WOMA 1R0BG 3W61A 3RAQA 1NDPA 1VQ5S 3KJQB 5CD4A 3CO9A 4R58A 1TL1B 3SDEB 2BR0A 4LSAA 1LXNA 2ATCB 1TAUA 1S6PB 4NEZA 3OL7A 2AJ1A 3RAXA 5DDPC 4RW8B 2HYIB 1G9UA 2YKAA 3LAMA 5E41A 3PX0A 1UJ4A 5ETLA 1X4CA 1FESA 3DYAA 2GVZA 2WRMA 3R2CJ 5I3QA 2YNHA 1T95A 1TUGB 4LRAA 4F50A 4F67A 2I6WA 3AOCA 3FBFA 2E1PA 5J1EA 5IT9Y 1MMLA 3PO4A 2EI5A 2GS8A 1GMWD 2C2DA 5KFXA 3OPKA 4NYOA 4G6VB 1TVRA 2KYXA 1U2FA 5RUBA 3L95X 4QR1A 1E6VA 5E7OB 4TYBA 2GMHA 2OIHA 2RS8A 4I6YA 2NQPA 3DMJA 2LQBA 3ISZA 4M8LA 2W2OP 1F9HA 3E01A 2RUGA 3M7VA 1ITPA 5H9FJ 3DLEA 3C46A 3AD9C 5AJ3F 5IWAJ 3IG1B 3GU0A 4MFBB 4KAIA 5H9EJ 2IPOB 1MW7A 1FT8A 3GJRB 2O67A 2AP6A 3DRSA 4ZLLA 1HW8A 3P45B 3EPIA 2J7UA 3I6PA 4X64F 2QRRA 1FQVA 3GONA 4IH5A 3TZZA 1UW9A 3GIRA 3M8WA 3KJVB 4K4SA 4F02A 5J2NB 5D0HA 3PIPQ 4NXMJ 2GGPA 5AXNA 3GP9A 1Q82T 4EU0A 1EETB 2DO0A 4FS1A 4B3TF 4DUYF 3OTOJ 4N7TA 1FWKA 1Q81T 1NSAA 3ILLA 3QRPA 4DUZF 3Q0AA 2CNOB 1S6QB 2GQQA 2V8VA 4CZCA 4YR2A 3GB0A 4JI6J 5KFTA 4RNOA 2DCUB 3BREA 1HPZA 4M5MA 3A3OB 2R3VA 5T41A 5GMKa 1TL7A 4R5PB 1FFWB 3VAIA 3DHWC 4YEAA 4QZVB 4IO1A 3J7YI 3HD1A 1M0SA 1FJ7A 1ZTWA 4ID5B 1MROA 2XSFA 1RT2A 1S9EB 2KHCA 2HBYB 2LCWA 1U6ZA 1OJ4A 4RNNA 5AZ5A 3QRRA 1Y9OA 1RT5A 4OZ0A 5K14B 3MM9B 1IBLJ 2D1CA 4O3SA 4C8KA 2DNYA 2UXBJ 2MQOA 2FC8A 1N48A 1I5OB 4B3OA 3D68A 3PY8A 1X7VA 3NRBA 3PR4A 2ZH7A 5DG7A 4CCHA 2QLFB 3VCDA 2VD3A 3UL7A 4XGOA 3H5XA 4QWDA 3M2VB 1O6XA 2BJEA 1G4CA 4DV7J 4WZQA 1HHSA 3QJPA 1C0TA 2CNNB 1U4BA 5JVHQ 3NNAA 4Y61B 3NWGA 4LVNP 2XNQA 5DG9A 1VMBA 4FKXA 5D3GB 3TX8A 4TU8A 1F2GA 1BWEA 3KLFA 3GOZA 2VG7A 1HBNB 2BW7A 2R8IA 1V3ZA 1PCAA 1S1UB 4R5CA 1JLGB 4A8OA 2EG1A 1K0TA 1NMEB 3ZO7A 3HP6A 2ZOGA 1RT4B 2FVPA 2CVIA 1WELA 4YY3F 3Q23A 1RAOA 5F3TA 4ECNA 3R5JB 2A3JA 1QYYA 4Y2IA 4WIIA 1IWGA 1FXLA 3QO9A 4GKKJ 1PBAA 2DNOA 1XEUA 2HBZB 2HGNA 4B3RF 3MEKA 1VFJA 2ZHAA 5THWA 1DJ0A 2V34A 5HJXA 1RU1A 2FZGB 3MCOA 2W24A 2PFDA 1C0UB 3K5OA 2CADA 2WCXA 2KXFA 4DJBA 4H4OA 4E2FB 4AYBD 2ZE2A 2IM2A 2FJDB 4A8FA 1NK6A 3KLHA 1SH2A 5GADU 4J9OA 5CCMA 3CO0P 2C3OA 3QWPA 3MM8B 1IBKJ 3IXQA 5KOWA 4DR6F 1AB8A 2VOPA 2VC1A 3CVKA 2ZHOA 3FCWA 3OHBA 1RAAB 3DZEA 2J0SD 4NOHA 3MECB 4WP8A 3OFFA 2QL7B 4J5OA 1KFDA 2DHXA 5GAHI 1FF2A 3M9OB 1O6VA 2BKNA 3MMCA 1RT3A 3AB4B 3PJ9A 2AJ0A 2HG4A 2OPPB 1GTHA 2G2ZA 4IFYA 4CLKA 6AT1B 5J2QB 4Q44A 1FI4A 2F8HA 5KT7A 1GXTA 4LIWA 1VC5A 4RLEA 1JK9B 3OTDA 2RDDA 1FKOB 4DR4J 1JIHA 2GIRA 2OSRA 4FVCA 3HHNB 2Y0SD 2E5LJ 2MMYA 4ZVGA 4R0AA 1PYSB 4ZPWR 1RAFB 3IS9B 1JXVA 3TJ9A 4IH7A 3W2VA 3FK4A 3EGZA 4V2DA 4KPYA 4JYAF 2QA2A 2W8KA 5DLFA 5DZ6A 1LOUA 4RJVA 2D3OR 2WSFC 9RUBA 3HDSA 4E0DA 4LF6F 2Z2LA 1LWCB 1HR0J 2HS3A 2IMWP 1P8TA 3JTNA 1I1GA 5GAGU 2V9SA 4KGZB 4QIWD 4K8RA 1EIYB 4Y2AA 3CC4S 4ZN3A 4XSQA 2V2VA 4ZVQB 3W66A 1OYDA 2KFNA 4TLQA 2HZAA 1YJ9S 4JBCA 3OUYB 4QU6A 1EP4B 2IA0A 4NMLA 4KH1B 4R6FA 3ISNC 1J2VA 3WDOA 3RB4A 4QBZA 5KFYA 2P1NB 3L3CA 2ZH5A 4W92B 2EG2A 4F7VA 1SJ3P 4XAKA 2JSXA 1S1XA 1NDKA 1UEKA 2CWKA 2O3DA 1NSPA 3D9BA 4B9TA 3G04C 2MLXA 2QMUB 4I6JB 1TMMA 3LPEA 4JI4J 1UPMB 2VL1A 1SCJB 4PQUB 4QU7A 3LALA 2L9WA 1XERA 3MPVA 3E6JA 2GNKA 2UZAA 2P9CA 3N28A 3O5TB 4MK7A 1X9WA 3IFEA 2UUAF 3EICA 4ECVA 1ZM3A 3FSXA 1QSLA 2NSBA 2V9TB 4J7CA 1FJEB 2OGUA 2C28A 5HI7A 3V6HA 3DLHA 3VVTA 4DG1A 4DX8H 4LR7A 3QLHB 4HLBA 1RT1B 2XZDB 5DM7Q 4J4LA 3GJQB 4FS7A 1TAQA 1IXKA 2E9TA 1FDNA 3CDEA 4IG3B 3M30A 1ZM4A 2ZBQA 4NLPA 3GG0A 2JEIA 5A8RB 2ZBRA 3CD6S 2EC2A 4JI0F 4WU3A 3W2WA 3VTIA 3J80Y 2ALYB 2OLWA 2ILYA 4KSEB 4NRUA 4BCAA 4O3RA 4X84A 1K47A 3WPGA 2VJUA 3QGGA 4YB5A 3NAIA 4TU9A 1RAEB 2FHJA 1FXRA 1KHWA 2QA1A 5B0TA 4AY9X 5KT6A 1RHQB 4J9UE 2R2TA 1NHKL 5D77A 1NJZA 3KLEB 3CJ8A 1FK9B 2POKA 2V68A 1Y4ZB 2WQXA 1KN6A 2HNDB 1UJ6A 3NS5A 3FKBA 4RUAA 2WBRA 1NK9A 1EQ0A 1RCOB 3LO3A 1QAJA 4CYUA 2ACMA 4P8SA 4F4KA 1UEUA 1G3OA 5ETNA 2VONA 3BBBA 3RGZA 4ZLNA 4HDGA 1TKXB 1ZTTA 2W2QP 3M2RA 3OHAA 1MMDA 1WDDA 3WX4A 4IO9Q 4DQIA 1I94F 1S99A 2X3GA 4XPCA 1IN0A 3HMJG 1OIAA 2V67A 3T9NA 4Z7CA 3M32B 1H2UX 2G0JA 1U02A 1S77D 1O6TA 1MN9A 4I2PA 1LFWA 1K5GC 2RNEA 4A8MP 2OFHX 3D1QA 2AGQA 5D15A 1GFWB 1LWEB 3SB4A 2N7YA 1F9FA 2H48B 3UDEA 2DIVA 5A0YA 1NB2A 2KKHA 4USVA 1N6QB 1R6VA 3S7RA 5C24A 3FEYB 4A4JA 2P9GA 3X3UA 2JFDA 2BBEA 4Z64C 2FJAB 1SC3B 2LEPA 2LYVA 2JH3A 2L48A 2FJWA 5LXYA 1WC3A 3CGIA 1H38A 3EZ5A 4B3MJ 2JRSA 3F73A 1M1KT 3DRRB 1O51A 4U95A 2Q43A 3NY0A 4Y3CA 3TSRE 3DRPB 4FF3A 4C2BB 3VAKA 3IRXB 3FNNA 4I68A 3C15A 4J9MA 4P2FA 2CZ9A 2WVCA 1QE1A 1FRHA 3MZIA 4ANEA 2C2ZB 1S0OA 2HNYB 4DL4A 5ETOA 4K7QA 4BC7A 5E3AA 5HO4A 5FTTB 2NPFA 2EWHA 4QIFA 4OZ3A 2MKKA 4QC0A 3RRHA 3Q2SC 4XDCA 4NZ0A 4FXVA 4BSUA 4LQ9A 2WAQD 2DCLA 1E6YA 1RT6A 4LSNB 4YQWA 1RB0A 4CO2A 2N82B 1OGQA 2VFTA 2EXUA 3OV7A 4I69A 3QYYA 1LK7A 4LXRA 4MYTA 2O6SA 4TVAB 3W62A 1RKJA 2VA3A 3OD2A 4CLYA 4J37A 3R9LA 2GC8A 4X4UA 3UCZP 1N5VA 1J5OA 5FLXY 2GVDA 4UOGA 1HBMB 3AFGA 1JLFA 1GXLA 3JSBA 2YWEA 1YJNS 4ZP6A 2XC9A 5BYSA 2V9WA 3CMQA 3NXZA 2QG9B 4CLPA 4I4BA 5CYQA 1MWQA 2FHMA 1MU2B 3D0HE 4DQRA 1M9LA 2GJ2A 1UWAA 5L1LA 1PBUA 3LGMA 4GMKA 3GV7B 3HSZA 2BQUA 1YX2A 3H2UB 3DOLA 3PO5A 4RO0A 1QM9A 1C2PA 5BJRA 2EPIA 1HQEA 2CPYA 1V3SA 2KT5A 2HK2A 4LFCF 1RZMA 3OL8A 2RRAA 4N77A 4DV1J 1YDLA 2E1AA 4CTAB 4WP3A 1J5EF 1ROFA 4RWXA 5KFHA 5A6WA 2R7VA 2R8GA 5LSRA 4F25A 3FXIA 3SV3A 4LSXC 4Z8GA 1D1UA 4DU7A 2I5JA 4PKDB 4Q2LA 3IC1A 1XR5A 3WIUA 1OSDA 1DLOB 1B99A 2MEWA 1N32F 5D4PA 4O3NA 2HQDA 3NBPB 4DPWA 1NK5A 3J7A1 1CBKA 1WACA 5K20B 4HT5A 3ZZYA 1WI8A 1EAYC 3IBCB 2CPXA 4EBDA 1U6BA 2KG0A 1YVFA 3TEHB 1AFIA 4LF8F 1JNRB 1JWWA 3ZC4A 2M70A 2Q66A 2HHHJ 3PW2A 5CA5A 1X4GA 3B4MA 1W26A 4DR7F 5E33A 1U1KA 1VLYA 1GH8A 3TA1A 3FFIB 1HNXF 1GK8A 4DCJB 4Y00A 3TJAA 2MQMA 2F4VF 2FY8A 4WFYA 1REVA 2XY6A 2OD6A 3MR5A 2X51A 2RE1A 5HP1A 2W7AA 4IRKA 3ELHA 2C2RA 1RT7B 4I2QB 3OVSA 1KSPA 1LW0A 4RW6A 2P5VA 1L3VA 1JLBA 1IM6A 3HSDA 1BC6A 2NS1B 4EI2A 2BJ7A 1YG0A 2YPZA 2KO1A 2GJFA 3RYLA 1RYRA 1WF2A 5KFPA 1T94A 1U25A 3E2EA 2W1BA 1H6KX 2X1GA 1RWVB 1RP5A 1YZ6A 1KLMB 2DKOB 3T1YJ 3M2UB 1SKSA 4Y6IA 5F8HA 2ELLA 1WUUA 2VJVA 2KXHA 1WEZA 1OOKG 2JL9A 3M1VB 3OTEA 4M5LA 4NKGA 4NX9A 5AE3A 4PRFA 2JEFA 4ZPCA 4FN5A 2BE2B 4WFXA 2J6TA 2FPHX 2M5YA 2VASA 1B4SA 2CJKA 1RHMB 2B6AB 2R8JA 3JAMU 2UUTA 1A9NB 3R5AA 4GKJJ 4FP9A 2MQNA 4OJHA 2DNNA 1NSKL 5CQGA 2NCKL 4CI0B 4DR2J 1F60B 2V4JB 4UOCA 1SIWB 4N8NA 4LFAJ 2J9EA 1CJKB 1B0TA 4CNMA 3NS7B 3R1HA 2CQDA 3BGOP 2HAFA 1XWLA 1FWPA 1FERA 1WG4A 3E8OA 4U09A 2O6RA 1CJUA 2DPIA 1TL5A 3I55S 1NK7A 1ACMB 3OVBA 3DM2A 1XBWA 1GMUA 1R8HA 1BY9A 3NOCA 3I4HX 1S0NA 1C1BA 3RFSA 3BM7A 3F44A 3GR1A 4DR1J 3N4WA 2HRTA 1FTRA 1YKWA 3T1HF 4MTPA 3CUNA 3UVJB 1FRIA 2CJ9A 1JLAA 2RF2B 3PHEA 1XC9A 1SC1B 5IV3A 3M18A 1KR4A 2BJDA 1TKTB 2YNFB 2FQQB 1SL2A 1FEHA 2AYBA 2BE9B 3G6VA 4ZPAA 2QLJB 2YWGA 2CA6A 2FLNA 3WN4A 4YMEA 4LBPA 1S9GA 3D5MA 1FJGJ 4G8AA 5ETPA 1PGZA 3MM7B 2A1BA 4ARRA 2FLPA 3QT6A 1VDHA 2HHQA 2AX0A 1RGVA 2BANA 4OFZA 4DN0A 2CPDA 2IC3A 4LIRA 5ADZA 1X4FA 2L08A 3KG4A 1C1CA 1GTEA 2HVEA 1U0HA 1JQGA 2OD4A 3CJKB 2MKYA 3G96A 4C4WA 4CQ1A 1X4AA 4L72B 1FX4A 1VIOA 2NZ4A 4KY3A 2OMVA 3Q24A 5IQQA 2XQCA 4ED1A 1RQ0A 4KE5A 1LFPA 3PEJA 3KJFB 2LDIA 2CWXA 1X9MA 4YB1P 4NXNJ 1OQ6A 3CDWA 1JJ2R 1WKJA 2VFUA 1JXLA 4LRFA 4A48A 1DTQB 3FEZA 4A8XA 2ILZA 1R0AB 2VDIA 1LKZA 4ZMMA 1HNIA 1S59A 3I0RA 2V5HG 2OP5A 5T7LB 2W7OA 1WJ9A 5IXUA 1JKHB 2PMZD 2CPHA 4ETXA 3QT7A 3FUYA 5KFCA 1N56A 1KVIA 4ICLB 3MEDA 2ZD1B 4KHPF 3HFZB 2UXCF 3G82A 2V8DA 3HXMA 1FRJA 2K7KA 5B0DA 3B78A 3OXLA 4RUHA 2O66A 3TZWA 4LJMA 4Y2KA 4RCWA 4KFBA 3E4GA 4ZA1A 3DLKA 1B7FA 5JVGQ 3TEGA 3VALA 3R2DJ 1KD1T 2VF3A 1P1TA 4NMXA 2QO3A 3UL8A 5LMUF 2Y3YA 1JX4A 4LFBJ 1ICEB 2CQ3A 3I9ZA 2UVRA 1U7LA 5SUHA 4EZ6A 3ZXWA 3SYZA 2XI3A 4TY9A 3B54A 3PYGA 1RHRB 2HQIA 3HPOA 1MLAA 5EUHA 2HVIA 4ITSA 3H98A 2R7QA 3N5BA 4F0MA 2PE8A 1SH3A 3V6DA 2ZZTA 3GPAA 3U7JA 2RR6A 3MEGA 1SQEA 3L7PA 1ZZNA 3RBDA 2KDOA 2Z2ZA 1T03B 2OPQA 2JC1A 1RTIA 4NA2A 3ZNUA 3TZXA 1NJXA 4ZDNA 5IC4B 2KH9A 4M5DA 3JSYA 3I5BA 4RW4A 3SDEA 3QAUA 4KO0A 2CDQA 4H4MA 1KQKA 1FTCA 1FE0A 3LANA 4CLWA 3UD4P 3T41A 3BR9A 5E2QA 2QZ8A 5FDLB 2CZVC 1U1RA 2KB2A 4A46A 4HTIA 3MTJA 1M5OC 2Y8WA 2HK3A 2ZJPQ 1H0HB 3MD1A 3OJSA 4F4ZA 2VPZB 3MMBB 2U1AA 4YS2A 5LOQA 4B3SF 4YHHJ 4DEZA 3C16B 5KG1A 1DTTB 1H74A 1NHUA 3MURP 2V2ZA 3C2PA 1VR6A 8ATCB 8AT1B 2ABYA 5CCLA 2PFFB 2J7WA 1QAXA 4F4WA 4NCGB 2Y8YA 1RWMB 5EHHA 5CZVA 4DU8A 3MR6A 4ED8A 4O44A 3OR1A 2ZOFA 3TVYA 1N36J 3DLLQ 3IR6B 1TL3A 1KKHA 3IM9A 2EK6A 4NYPA 4ED7A 5GMDA 1QJHA 4MKVA 3A13A 3CTRA 2YWKA 4JI2F 3JB9k 2XY5A 1N33F 1S12A 3LP1B 3NLCA 5HMWA 4LUBA 1EQMA 3CSKA 1RADB 1HWKA 2VFSA 1M1HA 2DNPA 1IBMF 5LFNA 2XLJA 3MXHP 2V50A 1A4YA 1SL1A 1NPRA 1EHWA 1ZAXA 1EKRA 4X62F 2FHJD 2OEJA 1HNVB 4ZP7A 4QCLA 2XTJP 3CT9A 2FZKB 3LGHA 4OX6A 5J2PB 1CJTB 4U9RA 4K4WA 4WYLA 2XHWA 1LWXA 2BZ2A 3TR5A 3ENWA 2RU9A 2WW8A 2Q3PA 4DUTA 4ECXA 1VQPS 3R3TA 4KKOA 5DDOC 1B0PA 1VCTA 1WC1A 5KFFA 3NWRA 4WXOA 5DM6Q 2R7SA 2CJXB 4O23A 2RRNA 1B64A 1YTYA 2VODA 3J81j 3I5AA 1SV5A 4JI7J 2VA2A 2MTLA 5AXKA 2GJIA 2DYAA 4EK2A 3S1TA 2E9RX 2HFSA 5I42B 3FZ2A 4OIXA 5KFZA 5D4OA 2Z57B 3L4BC 3T5HA 3I0SB 4LSCA 2HZVA 1Q16B 1FDBA 5LXRA 1RTHA 2F40A 5BYRA 5EDWA 1PYOB 4PPZA 2AEMA 2HWIA 2CDRB 3IWNC 3HM9A 1X9SA 4KJIA 4NL5A 2JEJA 5IJDA 3ULVA 1U0SA 3DCAA 4PG7A 2LQ5A 2D3ZA 4CC4C 2MZTA 3S8SA 1DCEA 3LPYA 1ZAVA 4MMOA 5HN0A 2H51B 2IM3A 2FGOA 2W9BB 2GO8A 2WZ1A 3CCRS 3HSGA 3C14A 4DPXA 4G1PA 4DSEA 5C2CA 3OJAA 4D3HA 2DGWA 3PG9A 4OX8A 1KHVA 2YNIA 1AYEA 4HHUA 1Z4UA 2UXDJ 5B0GA 3VAFA 4IQMA 1TR0A 3KDNA 4WPAA 5L8RC 3WQPA 2LU2A 3RRKA 5GMHA 5AWBA 3RG6A 2YXLA 3VHQA 3D7SB 4WIQA 5HJYA 2RUSA 1JLEB 4PWUA 3MPWA 1M5KC 4JV5F 4OZNA 1XMOJ 3AOAA 3H2LA 4DV4J 3SCLE 1UAWA 2YWWA 3IBWA 3W5YA 3CCLS 1V5VA 4KRWA 5F8GA 4RW9B 3PV8A 1L5UA 1UZDA 1WC0A 3U27A 1M90T 4IRCA 2VBZA 5A2QY 2RH3A 4EYIB 3HVWA 3QPIA 3LW5C 4X66J 2QYCA 3MTKA 3ET6B 2ASJA 1X5SA 2ASLA 3R5DA 4ED5A 5CHCB 4HT7A 2PMHA 3UI3A 1QD1A 2YKMB 1W7WA 4R25A 2IIHA 1CC7A 3RGXA 2J8SA 3BSAA 2ROPA 3O3LA 2QJ3A 3IAM9 5HMXA 1OTMA 1XIQA 1RBAA 4LF4F 3GG1A 1HNWF 1KOHA 1IQZA 4GVBB 2E5HA 3F56A 4FHOA 2DISA 5ETTA 3BQ0A 4RL1A 4JI8J 3O2IA 4WKRA 4NCAA 4Z7YA 3BGUA 4NLQA 2AD9A 1UVNA 1R27B 4YP3A 4P72A 2NXEA 4M7EC 2VG6B 4FYXB 5J2MB 2NXUA 2QL5B 3FBBA 3NGKA 1VBKA 4IDKA 2Z63A 1NHVA 2UUBJ 1IKWA 1AZSA 3IM8A 4OJ1A 1RHKB 2KTQA 4FF1A 2IRUA 2OPRA 2FHKA 2KYZA 3AHPA 3QIPB 2QLBB 3LWLA 3K5MA 1U09A 1FRMA 3EE3A 4DOZA 2GIQA 1RWPB 4OLOA 5DJBA 4KC5A 5F9LA 1OPZA 3RIZA 3LP2B 1DQ8A 2OMZA 2NSCA 3GFZA 4C8MA 2G2YA 2RA8A 2CA9A 2CJYB 2CJAA 2B0GA 1HI0P 2FVRA 3BGRA 4MH8A 4MYUA 3CCWA 4WTYA 3BH7B 1WG1A 2BRLA
chains in the Genus database with same CATH topology
2KXFA 3R5BA 3I5CA 4DJBA 2VUGA 2AJFE 4H4OA 4AYBD 2WSCC 3V81A 2ZE2A 2IM2A 3C6UB 4HH1A 1NB7A 4TKTA 4F3MA 1X5OA 3IWLA 3GIJA 4PUOB 2FJDB 4A8FA 1F5BA 4ZCKA 1NK6A 3KLHA 4WFZA 5LT5A 3MMAA 1URRA 1SH2A 5GADU 4J9OA 3R1LA 3K0JA 5CCMA 1DLOA 4ZS6A 2C3OA 3QWPA 2D74B 2ROEA 3LH2S 4PQ8A 3MM8B 2ZH2A 4DQIA 2OMUA 3IXQA 2AU0A 5B08A 5KOWA 4DR6F 2VOPA 4JI6F 2VC1A 2HIQA 3AJ1A 3CVKA 1JNZB 2Z7XA 3I82A 2ZHOA 4FBUA 1K8AT 3OHBA 2HHVA 3ZFVA 3DZEA 2J0SD 4IOAQ 4NOHA 3MECB 4R0JA 1L3KA 3L09A 2WSEC 2W9CB 2BDPA 3WPBA 3MOZA 4QR0A 1CQNA 4DFKA 2LEAA 3OFFA 2KRRA 5EWGA 1NK4A 3I0RB 2Y5QA 4MAKA 4J5OA 1KFDA 2DHXA 4F3OA 5GAHI 1NZAA 1FF2A 1I6JA 2DVIA 1V3RA 3M9OB 3IRWP 3PX6A 3I87A 1O6VA 2LXUA 3MMCA 1X8DA 1RT3A 1SKRA 3AB4B 2HHUA 2MQQA 2OMOA 2XLKA 2E66A 4F8RA 2OPSB 2HFNA 4NWBA 2AJ0A 4QWAA 1U2RA 2R7XA 2OFGX 3U1LA