1FO1A

Crystal structure of the rna-binding domain of the mrna export factor tap
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
240
structure length
215
Chain Sequence
TIPYGRKYDKAWLLSMIQSKCFTPIEFHYENTRAALKAVNYKILDRENRRISIIIELKPEQVEQLKLIMSKRYDGSQQVLDLKGLRSDPDLVAQNIDVVLNRRSCMAATLRIIEENIPELLSLNLSNNRLYRLDDMSSIVQKAPNLKILNLSGNELKSERELDKIKGLKLEELWLDGNSLCDTFRDQSTYISAIRERFPKLLRLDGHELPPPIAF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of the mRNA export factor TAP reveals a cis arrangement of a non-canonical RNP domain and an LRR domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein
molecule keywords NUCLEAR RNA EXPORT FACTOR 1
total genus 67
structure length 215
sequence length 240
chains with identical sequence B
ec nomenclature
pdb deposition date 2000-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09162 Tap-RNA_bind Tap, RNA-binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1fo1A01
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 1fo1A02
1AUDA 2M0GB 4QPTA 3G9CA 3P72A 4J0MA 2X1GA 5GAHU 4KXFB 2RS2A 4PSJA 4CNMA 2L9WA 2X1BA 3JB9k 2J8AA 2XS7A 3SDEB 1D0BA 2Z63A 4M5DB 1X4CA 2Z62A 4PRFA 3WPFA 2CQCA 3ULVA 2AYBA 4R6FA 1VQKS 1X4AA 5DDPC 2RT3A 5DM6Q 3H2UB 3MI7X 3G8TA 2HZCA 3SXLA 4G8AA 5GMFA 2E5IA 2DNQA 1DS9A 2FC9A 2KG1A 1WG5A 2UZXA 3UD3P 1WF1A 1SQ0B 3PMHG 2LKZA 1DCEA 2F3JA 3B4DA 2MJNA 2CPHA 4R0AA 2DK2A 2LA6A 1VQ4S 2KVIA 4EGLA 4Z8GA 1HL6A 3G06A 2OTLS 4R6GA 3MXHP 2FPHX 1X5PA 3I56S 2V9TB 2M4MA 2Z66A 4ERDA 2DH7A 1QVFR 1FXLA 2M70A 5LSOA 2DGTA 4XOSA 1Q82T 5LSLA 1JJ2R 2DGSA 1LTXA 4YOEA 2EVZA 4WFBQ 2L41A 4CNCA 2CPXA 2M88A 4QXEA 1FJ7A 3CCLS 3CCMS 2DHXA 2CQGA 2Z65A 4R5DA 1FT8A 3VAJA 3ULUA 1F9FA 1X5TA 2ASTB 2RA8A 5FTTB 5EN1A 4H09A 4C0OC 2ADBA 3VF0B 2N3OA 1M5OC 1VBYA 3ZYOA 5A5CA 3VAFA 2WFHA 4YB1P 2I38A 3OW2R 2LCWA 5LXYA 2AD9A 1FHTA 3UCUP 3CCSS 4Z79A 2JVRA 2MY8A 2AYEA 4UY8T 1U6FA 3ZZYA 2R9UA 1FS2A 4OZ1A 1M5VC 2DNRA 2DH9A 2KN4A 2QEXS 3MURP 1JL5A 4R09A 4U06A 2KXNB 1U1KA 2CQPA 4C2BB 2E5GA 2KG0A 4CH1A 4NKHA 3P49B 5GQRK 5B0TA 4R08A 5HO4A 3W3GA 4MQWX 2DHAA 1U1NA 3CF5Q 1KD1T 2DNPA 2KM8C 2JQDA 2MQLA 3R1HA 1L3KA 3MUMP 1YJNS 3EGZA 1DRZA 4LSCA 5AWCA 2A3JA 5IM0B 3G3AA 3VAIA 1U0ND 4C7QA 3WPBA 1K9MT 3CULA 1YI2S 3UCZP 1XN9A 2MZRA 5ITHA 2MKKA 4BSRA 1VQOS 2DISA 4TU9A 1WWHA 2D3OR 3C6NB 4Y0FA 5BJRA 1H6UA 1UW4A 3OGKB 4TZHA 3G71S 3MD1A 4LI1A 1SJ4P 4J4LA 3BEGB 1K5GC 4WCEQ 1O6VA 1H2VZ 2V70A 4NKGA 1IQTA 4U09A 1WHVA 3NS5A 1OGQA 3S8SA 2MSSA 2KFYA 1PO6A 4WIIA 4WFAQ 4QBZA 4QU7A 4Z64C 3G8SA 1X4BA 2YTCA 3EX7B 2JE1A 2KI2A 3S6EA 3OJAB 3MUVP 2K3KA 2CQIA 5H1SV 2ZJRQ 1A4YA 3UD4P 4IM6A 4V2EA 1UFWA 4R07A 2RQ4A 2OMZA 2VOPA 5GS2B 1URNA 1WEZA 2BEXA 4LJMA 2MKCA 1ZZNA 1M5PC 2YKAA 1OTOA 2ZJPQ 2ELLA 3E6JA 3CCQS 3ZYIA 3THTA 1FNXH 2CPDA 4A8XA 2CPJA 5LJ5Y 1UP1A 2LECA 4F02A 1OTNA 3RIZA 3Q2SC 2OMYA 4BSSA 4LMZA 1CVJA 1GWBA 4OQTA 5GS0A 1X4GA 2E5JA 4LIRA 3G4SS 2XOTA 3U1MA 4TU7A 2B0GA 2YH0A 1DZ5A 2PE8A 1VQNS 4FMZA 2CQ3A 3G6ES 3VAHA 1M90T 3O53A 5HZLB 3HI9A 2DIVA 2LXIA 1VQ6S 3CD6S 5AZ5A 2MKHA 2J0QD 3ZZZA 1SJ3P 3CCVS 3NMRA 4U08A 4ARNA 3OGLB 1K8AT 2O3DA 1Z7XW 4RWTC 1X0FA 2IFGA 1M9SA 2MY7A 4IOAQ 2CPYA 5HDHA 5AWAA 3W3MA 2JRSA 4P6QA 4LSXC 2CPEA 4P91A 2MZJA 2CQHA 2CPIA 3BS9A 2HGMA 3CC2S 4TU8A 2FY1A 3BO3A 4CC4A 1K5DC 1XEUA 3TP2A 3W3NA 3S01A 1WEYA 1H6TA 3WPHA 2DITA 3ZYNA 1XKUA 3CC7S 2MPUA 1YJ9S 1RKJA 4RU2A 3OJAA 4AW4A 4WF9Q 1U1LA 5IJDA 5DM7Q 1YTYA 3E2JA 2RRBA 2GO9A 1H6KX 2KU7A 5B0NA 2O6RA 2OMXA 1FO1A 3VAMA 4QC0A 3CCJS 3FEXB 1Q81T 1X5OA 4CIOA 3PIPQ 4GLPA 2DGWA 2KXHA 4BV4R 3G39A 4LXSA 4OZ0A 4KT1A 2P1NB 1X5SA 3CUNA 2DO4A 1WHWA 1VQ9S 2XSFA 1VQLS 3HHNB 4LI2A 2KRBA 2FT3A 2MHNA 2HGNA 4R6JA 3CIYA 3ZYJA 2MSTA 4CP6A 2N7CA 3RFEA 2UZYA 2KYXA 3UCGA 2MMYA 2F9DA 3CTRA 3R27A 2ASSB 2LQ5A 4UFRA 2YWKA 1ZIWA 5GMHA 2E44A 5GADU 1X4FA 2MQPA 5JVHQ 1WWLA 4I6JB 1U2FA 3SB4A 2XS5A 1S72S 3LPYA 4MN8B 4PKDB 1H2UX 4FCGA 1R8HA 2DNZA 1JJHA 2LXUA 2X1FA 2KM8B 4WKRA 1XWDC 3GOZA 3CCES 2DNMA 4F25A 3RW7A 4FXWA 3OGMB 4ZKAA 1JMTA 2MXYA 1SJRA 1U1RA 1P1TA 1QM9A 2SXLA 4QQBA 1X4HA 1P8VA 4Z2XA 3UL8A 2MQNA 1ZZFA 4QU6A 2BNHA 2NZ4A 1VQ8S 1KOOA 2OMUA 4ARRA 4V2DA 2U1AA 2RNEA 1WF2A 4R6AA 1W2BR 2OMVA 4CC4C 1QYYA 1OPIA 4PR6A 4Y00A 3CCUS 2QFJA 2XB2D 3CCRS 1D9AA 4V2CA 4YUDA 2BZ2A 5DETA 1WI8A 2MQOA 4RCWA 1UAWA 5CYJA 1PGVA 1O0PA 1N54B 3ULHA 1OO0B 2Z64A 2CPZA 2DGVA 1DFJI 1Q7YT 2O6QA 1ZH5A 2RRAA 5LXRA 2LEBA 3C6PB 2HVZA 5D78A 2ADCA 4IUFA 1X4EA 2OTJS 2WQWA 5GMKa 3DLLQ 3M19A 1OWXA 3Q2TC 4ED5A 2G1DA 2Z7XA 1Q86T 1WELA 2LMIA 1XCDA 4PERA 4CH0S 1OOKG 3RJ0A 1HD1A 1VBZA 1SJQA 2DNLA 3P5TL 1P8TA 3CXCR 1FQVA 1NJIT 3G3BA 4FD0A 1SJFA 3UL7A 3TSRE 3G96A 3NS6A 4PKIG 1X4DA 2K8GA 3E4GA 2N82B 2DHSA 2CQBA 2KXFA 1VC6A 3FXIA 1VQ5S 4ECOA 3JB9j 1WG4A 2V9SA 4PQ8A 2JWNA 2OSQA 3TYTA 2U2FA 3N9UC 5IM0A 3CPWR 2XS2A 3SDEA 5AWDA 3I55S 1DHMA 3BO4A 1KC8T 1NO8A 5JVGQ 2ERRA 3W3LA 3IRWP 2FHOB 4FS7A 3RGZA 4RCAB 1U1MA 1N8RT 2JX2A 4IO9Q 1N52B 1K73T 1WI6A 2MZSA 3BZ5A 3J7ZT 5LJ3Y 4IOCQ 3US5A 5CA5A 1M10B 3SMZA 1P9AG 1B7FA 4XGOA 2DNKA 2OSRA 4M7EA 5DDOC 4FXVA 3NNHA 3VQ1A 3W3KA 2P1OB 4AY9X 1O6SA 4P8SA 1YJWS 1WHYA 2DGUA 2DB1A 3WPDA 2OMTA 3UL9A 2AYGA 4UQTA 1M1KT 3CMES 4C2AB 2WQXA 2DNOA 5DDQC 1WHXA 2KRRA 1YHQS 1VC5A 2KHCA 1VC0A 2Z81A 3R1LA 2Z82A 2Q4GW 3REZA 2DNNA 2ZJQQ 4BS2A 2WQUA 2DGXA 2RQCA 4GT6A 2MQQA 5GAGU 5GMGA 2HGLA 1D8ZA 2O6SA 3RW6A 2ID5A 1SXLA 2MZQA 3UE2A 4WFNQ 2JVOA 2XNRA 1U1QA 4R5CA 2EK1A 1NU4A 2DO0A 2KT5A 2XNQA 4YEBB 2Q79A 3K0JA 5IJBA 1DBDA 3BO2A 2MGZA 2DGOA 2LA4A 1KQSR 3MOJB 3W3JA 2M9KA 3D2WA 2MZTA 3CVRA 4J5OA 2L08A 3TO8A 2D9PA 3CIGA 4WP6A 4K17A 3U1LA 4L3AA 1M0ZA 3G04C 2P1QB 1O6TA 2BOPA 2MKSA 3UWTA 2XWTC 3RFSA 1BY9A 2QA4S 5D3IA 2CQ4A 3CC4S 4LSAA 2VOOA 4Q3GA 2AYMA 3S7RA 2P1PB 2DH8A 2G4BA 1VBXA 2CQ2A 2EK6A 1S79A 3E3ZA 2D9OA 3MDFA 3M18A 1U1OA 5IFMA 2M52A 3EGNA 3J7YU 1HD0A 4L3FA 2MGZB 3UN9A 2F9JA 1IO0A 3ULAA 3VAKA 4B8CD 5IJCA 2WQVA 4R58A 2M8HA 2CA6A 2E5HA 2MZ1A 4Y61B 2GHPA 3IWNC 2A0ZA 4M7EC 2N3LA 1OZNA 3A79B 3P6YC 2DNGA 5GVQA 1JJ4A 5CMPA 4LSXA 5MLCV 5FJ4A 4HQ1A 3RGXA 1A7GE 2Y5QA 2DGQA 4ECNA 1R8PA 1YWXA 4U67Q 1OIAA 4FDWA 4TLQA 2P1MB 2CJKA 2G0CA 1HA1A 1WG1A 5HL7Q 2MKIA 1RK8A 2LEAA 1M5KC 3DXBA 1VQMS 1A9NB 4Q3IA 2DHGA 1VQPS 3L3CA 2HYIB 3RFJA 4LXRA 2OJ3A 4WYKA 1H2TZ 3WPEA 2RR6A 3THPA 1OTMA 2LYVA 1A9NA 1FJEB 1WF0A 2OIHA 5IQQA 1YIJS 1KOHA 2RVJA 2UP1A 2DNYA 3V4MA 4W92B 2X1AA 2J0SD 2FC8A 3CMAS 1W8AA 2JE0A 4C4WA 3DZEA 3O6NA 3WN4A 5AWBA 2RUGA 1WTBA 1XECA 5D77A 5B4PA 1M9LA 1U1PA 3WPGA 1WEXA 5IYXC 4W90B 2VONA 2OMWA 3C6OB 2RS8A 3KJ4A 2M2BA 3B4MA 1YITS 3VALA 4EZGA 3H2VE 3FEYB 4V19X 1QVGR 2PEHA 4F26A 1G2EA 2KH9A 2DNHA 2V94A 2DIUA 2VODA 2I2YA 2Z7XB 5CMNA 2MJUA 3MUTP 5GAEU 1PGZA 3LQVA 1FJCA 3P3DA 3NNCA 2CQ1A 4Q62A 3WPCA 5CXTA 4FHOA 2CQ0A 4PEQB 5LFNA 1N88A 4CQ1A 2M8DB 2MYFA 4CILA 5DDRC 3PIOQ 3VQ2A 2J76E 2MKJA 2CQDA 2WBRA 1P27B 2CPFA 2M7SA 4KNGA 3WPIA 3VAGA 4U7LA 1VQ7S 1G9UA 3MD3A 2MB0B 1U6BA 3NNAA 2RU3A 2NLWA 4Z61C 4BSUA 2YH1A 1YRGA 4XSQA 4Z94G 2MQMA
chains in the Genus database with same CATH superfamily
2POKA 3QT5A 3RRKA 2XMAA 4PCQA 3UVJB 4KXFB 5J2MA 4J0MA 4NZ6A 1RT7A 3ET6B 1H7WA 3KK1B 1NNDA 4CNMA 4RLEA 2FHMA 3RBXA 4IRKA 3SDEB 1Q1KA 2XS7A 3D7SB 2IY5B 4M5IA 5EWGA 1D0BA 5KFCA 4ZVUB 3CJRA 1RLDA 3PKYA 2CRLA 3ULVA 1N33J 4P7VA 2AYBA 2GQQA 3IA0A 4URSA 2AX1A 5HBMB 2C22A 2OELA 1WUUA 2OPRA 3UDEA 1NZ8A 2NR0A 2EC0A 4GRSA 3SXLA 1DURA 4G8AA 2DNQA 3VGVA 1SKRA 3M9NB 4TY8B 4ID5A 4RR5A 3ZZPA 4Q43A 3QWPA 5ETTA 4DUYF 2UZXA 2KFNA 4DQQA 1WF1A 4UOGA 3RAQA 2LKZA 1LNQA 5LT5A 3DLHA 2K2PA 4LRAA 3B4DA 3FGVA 2MJNA 4DZDA 2CPHA 4ECTA 4ED7A 3GJRB 2LA6A 4USMA 1Y5NB 4DG1A 2QG9B 1HL6A 2RUSA 1HFEL 4H4OA 4DCPB 4EGLA 1ZM9A 3UPFA 2BKPA 2E7WA 5J2NA 3EZUA 5J2QA 1CJKA 1J5EF 2RDJA 3I56S 4A47A 2V9TB 1RSCA 3D0GE 3EXYA 3Q83A 2ZDOA 4C8NA 4X65F 2VQEF 2EFNA 2P6SA 2HLUA 2DH7A 3MMCA 3J80Y 1ELOA 2RB7A 2DGTA 2G1HA 2VZ9A 1V3ZA 4FYXB 4RBVA 5KFBA 3LWLA 1TK8A 1JJ2R 4KJIA 4JYAJ 2DRBA 4NCAA 2XTJP 4I67A 1CEZA 2UZAA 4RW8A 2V69A 3RRHA 1OSDA 3HKWA 4YFUA 3GFYA 3WPIA 2CDRB 2M88A 1AB8A 1FJ7A 3CCLS 3CCMS 4NCBA 2YWHA 2RRNA 1RZMA 4JI1F 2Z65A 5G4DA 2XZDB 4M5MA 3HP6A 3GYXB 5ETVA 1WNEA 1UEVA 2W2OP 2UXBJ 1X5TA 1UPPA 1UZHA 1VI7A 2R8JA 5EN1A 3BGLA 2ZNZA 4I6AA 2C2RA 1H72C 4C0OC 4DQPA 4EO8A 2UXCF 1AA1B 1VQSA 5JMNA 1B99A 4HHHA 3DOLA 4HI2A 4IR9A 1OPZA 1S4FA 2I38A 3HLUA 1U02A 2XULA 3O6QA 4K2JA 1ZPVA 1SJ1A 2LCWA 2COLA 4DHVA 4QPXA 3T3FA 1FJGF 3WPDA 1FX4A 3BREA 3UO0A 1YJVA 1U6FA 2GW8A 4NA2A 2XZWA 3RBZA 3ZZYA 5A2QU 1FS2A 5D0HA 2DH9A 3ILLA 4DQIA 3QIPB 1JL5A 4R09A 3N5BA 3IR6B 1F9EB 2B4OA 2CQPA 4ECZA 3HVWA 5B0DA 4CH1A 4NKHA 5GQRK 4L6V3 3HF5A 4R8UB 4QWBA 4KPCA 4I64A 5HO4A 5FD1A 2ZUAA 4RW6B 3RAXA 2AGPA 4MQWX 3FBEA 1LWFA 1PC4A 4KSEB 4YY3J 4ID8A 3R97A 1U1NA 3MMAB 4CRJA 1KD1T 4FNHA 4YHHJ 1T9TA 3B8HA 1L3KA 2AJ1A 2VL1A 2AX0A 1S1VA 4MFBA 3TWZA 4EI2A 3CT9A 5B09A 3MUMP 1DRZA 3C46A 4NXNF 3VAIA 4EEYA 1LW2A 1NLKL 2V6AA 5HVFA 3W8GA 1FWLA 3BO2A 1BD6A 1XN9A 2MZRA 2ZFHA 4LBPA 2Y0BB 4NRTA 2MKKA 1NH7A 4FF4A 8ATCB 1SC6A 2D3OR 3C6NB 5HROB 1PG5B 2AJFE 2NSCA 3MM8A 1Y10A 2NXEA 2BOAA 4K5RA 4P7TA 1FA0A 2GGPB 3QGHA 4PABA 1NK8A 5F8NA 3OGKB 3G71S 2BV3A 2XI3A 3R7BB 2JLFA 4IQMA 4Y28C 4AE5A 2YX4A 4R0JA 1NHKL 2EG1A 3ICLA 3NGTA 4WCEQ 2UU9F 1RTIB 2CNOB 1IQTA 4J9QA 1S0OA 3FFIA 2J9CA 3NS5A 4G1QB 5HJYA 4DSKA 3BSCA 3JSRA 2XY7A 2CJ9A 2OMLA 5AE3A 1ZTWA 2ZVSA 2YTCA 4JB8B 4DN9A 4JI5F 1VISA 4RZRA 5J2PA 2A2CA 2KI2A 2NPIA 3S6EA 3OJAB 5HP1A 2CQIA 2FUG9 1A4YA 1NH8A 2P1MB 5CYMB 3CJSA 4IM6A 5T41A 1F6TA 1Q0NA 4C8YA 2AF6A 2V4JB 1LXNA 1UFWA 3GCWP 1IR0A 1YSJA 2RQ4A 2WVCA 4DUZF 4OX7A 1PYOB 2IMOA 4D3HA 5J1EB 4CNZA 2C28A 2OMZA 1IKYA 2BQUA 3DM2B 2YKAA 3VVTA 3C3LA 2NXUA 3EICA 1JLBA 4ALZA 1NK6A 1F5AA 2JC1A 3R5GA 4QJVA 4C6AA 5LSRA 1KQGB 2O1PA 5HATA 2HRYA 1P9YA 4OZNA 2NS1B 2OMYA 3SSQA 3KHRA 1S1WA 4BSSA 2H5IB 4ZIVA 4OQTA 1DQ8A 4AUKA 4DR3F 1X4GA 1D1UA 5GS0A 4KTQA 3K58A 1U8WA 3FZ2A 3BH7B 4OHXA 1N34J 4LBIA 1T9XA 1NHUA 2V63A 2CQ3A 3HT3A 3G6ES 5HZLB 2IC3A 4M5NA 1S1VB 4LVNP 2OEJA 2ZBQA 3TA1A 4MMOA 2RSQA 1VQ6S 3UNYA 1SCJB 1SV5B 2VH7A 2J0QD 5AZ5A 2F63A 4DPOA 1U09A 4DBQA 1U0HA 5KG6A 4N5SA 2ZH5A 3LP1B 5K5MA 3CCVS 3KHHA 3NMRA 4CT8A 4KGXB 3M2VB 1PAUB 2HNYB 3R8YA 3DRPB 1K8AT 1Z7XW 2DR9A 1GXUA 1Q4RA 1KLMB 3Q24A 2H54B 4NLYA 2D74B 3W3MA 4WXOA 2QLJB 4A8WA 4L76A 2QMXA 5K8PA 3EPGA 1RBAA 2CQHA 4CTAB 1M0SA 6FDRA 1CS4B 2OPSA 3FQLA 4O44A 4DI6A 2FY1A 1XEUA 3TP2A 2N4CA 3AXKA 2RILA 1FEEA 3C6UA 3T1YJ 2ACYA 5E5NA 3OTBA 4EBEA 4OMFG 3P4UB 1HNXF 2DRDA 4K0KJ 1H6TA 1V3RA 1XKUA 3OJAA 1YJ9S 3GWCA 3JSMA 1TV6B 3QSYB 1YTYA 2E7VA 1WKJA 3IO1A 3OTDA 5B0NA 3ONQA 2OMXA 1RGVA 1FO1A 3VAMA 4YDDB 4R0EA 3IXQA 4N8OA 1Q81T 3DHXA 3MM6B 4CIOA 3NCQA 4FN5A 5CAAA 4I2QA 5G0RB 4QWCA 2B6AA 2C3PA 4GO7X 4LXSA 3ZTRA 2QYCA 5I3QA 2HFNA 3MFIA 3DRSA 1KKHA 4NOHA 1QY7A 1SKUB 2OP5A 2HVEA 2FIUA 4TKTA 3M6UA 4ATNA 3BN7A 1JK9B 4NASA 4KYZA 5CZVA 2MHNA 5HP1B 3PCOB 4OHWA 2AU0A 2MQ8A 2Z58B 4RW9A 4JV5F 3TARA 2N7CA 2CIMA 1FRKA 2LQBA 2DEJA 5KAKA 2KYXA 2F9DA 4UFRA 4DV1F 1JLBB 5EX0A 1ZIWA 3Q8UA 1EETA 4NEYA 1U0HB 1HBMB 1S4EA 2E44A 2VPZB 5GAGI 1RYRA 2E7XA 4E0DA 1KVIA 1PBAA 3J81U 3KHLA 1TKZB 2VIHA 3CDBA 4FCGA 4BC7A 3HHDA 1TMMA 3W61A 1NPRA 3N6NA 4ZVGA 3JYTB 4K50A 2R2UA 1JMTA 3M6VA 3U27A 4CLTA 2HHVA 1QM9A 4YR2A 2C1EB 4NL5A 4ZCKA 1KDNA 3EDRB 2EXUA 4OZJA 2XYGB 3W1YC 3ZXWA 4RUCA 2ZM6F 3N79A 1SH3A 4JI7F 3J7AN 3GTYX 2ROPA 2XSJA 1IKVB 5BYSA 4HDGA 4OYAA 4CLUA 5M2RA 2BNHA 3MPUB 2OMUA 3TJ8A 2V5HG 2U1AA 1CJTB 1EAYC 1KVKA 2BANB 2RHQB 5D0EA 5C24B 2K7JA 3N28A 1ZBTA 3EMTA 2W7OA 3IGVA 1N0VC 4Y00A 1QDUB 2JLEA 3CCUS 3CDWA 4KT0C 1RTDB 3KLHA 2HQGA 3NMAA 2F1FA 2B7BB 4NA3A 1FRHA 1RUSA 4Y2KA 3HSGA 2QFIA 3I32A 4DPWA 5DETA 5KG7A 1PGVA 1U4BA 1O0PA 3ULHA 3RJMB 1RT2B 2CPZA 4KFBB 2BJDA 2VJVA 1DFJI 2DJWA 4Y34A 1T3NA 4NA1A 1JLGA 4EWTA 1BWVA 2H48B 5LXRA 1GTHA 2LEBA 2DR7A 2KJVA 1NK4A 2J0WA 1EIYB 3WDOA 5GMKa 1V3SA 4KO0B 5LM7E 1PBUA 2OAUA 3AD9C 5A8WB 3A12A 2V9KA 3G86A 4USKA 4ECXA 2Z7XA 1WELA 3HT0A 3CJKA 3BR8A 5K8OA 1IUJA 4F4AA 1F2GA 3D9BA 3GV7B 5D8HB 5MAOA 4MK9A 3ET6A 5DG9A 1SJQA 2XCPA 1VBZA 2FVRA 1KTVA 3CXCR 3LALA 3IG1A 4JYAF 3WC0A 3AOBA 3JQMA 3A4TA 2XMWA 3AHPA 1JLEB 3M30A 1SJFA 1S0VA 4FD0A 3TSRE 3TQEA 3G96A 4DV3J 4FKXA 2AJ4A 2DTJA 1VJQA 2BM0A 4N41A 4P9SA 2N82B 1S76D 3PHTA 3CULA 3E4GA 1HKAA 3FXIA 3TNVA 3C16B 2HVIA 3QLHB 3JB9j 1VCTA 1WG4A 4L3KA 3D5MA 4O3SA 4PQ8A 3IN5A 4OHZA 1Z1ZA 1RAEB 3GG1A 2V50A 3TYTA 5IM0A 2UUCJ 3AODA 2WTFA 3I55S 2GJIA 1KC8T 2CYYA 1C0UA 2V68A 5JVGQ 4DOZA 2ERRA 1WDDA 4IG3A 4KRWA 1IJEB 2W2NP 2IVYA 4K4XA 4RCAB 1AFJA 2EFPA 5EDWA 2K3IA 1S99A 1DJ0A 1TKTA 2Y1LB 1EZZB 1LW0B 2MZSA 3BYRA 4DV2J 4CLSA 4YQWA 3J7ZT 4B3SF 3ILJA 2E5LJ 4A48A 4MYTA 2XMVA 2QYGA 1HNZJ 2GJFA 4JOUA 1M10B 1VK8A 1H38A 4M7EA 3PYFA 3VQ1A 2P1OB 4PG8A 4P8SA 2VFSA 4Q7AA 3J7Z5 2CJAA 2DB1A 3D0IE 3BDEA 3PACA 1TQLA 4CLKA 2ZM6J 2HQCA 2DKOB 3FQKA 3G82A 4KV8A 5F0WA 5CH7B 2OMTA 3QGPA 3LPEA 4JI6J 2V8GA 3LOUA 1K1QA 3M05A 8RUCA 5L38A 3IRXA 1M1KT 2WQXA 5CD4A 1SL1A 3MM5B 4ELUA 4C2AB 2KRRA 3KG4A 1YHQS 1VC5A 2Z81A 3GMGA 3PXGa 3ZZUA 4RJVA 4B08A 2BQRA 1GXLA 3EGVA 5L1JA 2YVSA 1O6XA 4JBCA 2RQCA 4BWJA 1EX8A 2OEKA 3SSSA 2MQQA 4Y2CA 4J9RA 2HGLA 1D8ZA 3FRYA 2O6SA 4C11A 3NG8A 2XLJA 3J81Y 2R7SA 3K5NA 4N47A 1IM4A 3DCAA 3N5FA 1VS3A 4KGVB 4WFNQ 4DV1J 1U1QA 5E3PA 2EK1A 1SIZA 2DO0A 4J37A 1YJTA 3K57A 2Q79A 3OXGA 3O2IA 3K0JA 5BXIA 3F56A 3FMWA 4AT1B 4DPYA 2DGOA 3GV5B 2LA4A 3NOCA 3R5CA 2D7SA 5FDLA 4LREA 4J5OA 3DGPB 3QPIA 3EXCX 3KDOA 3TO8A 4CTAA 5HMWA 1R0AB 2J7WA 3U1LA 2R8IA 3AJ1A 4I7FB 4L3AA 4F67A 4ZVFA 2AWZA 4URGA 1RT5A 4DL7A 2AQ4A 3PR4A 1FERA 1RBOB 3TOQA 4QCLA 2XWYA 1X0PA 4M5JA 4DJBA 3OSNA 3RR7A 3RFSA 4RW4B 1TZ0A 4YDXA 2ZKUA 4DU7A 2OPPB 2RIJA 3K89A 5LMNF 3HJVA 4J9OA 2V9WA 2P1PB 4K2XA 5C25A 3E3XA 1VBXA 3MR5A 2GVZB 3U7JA 1U1OA 1TFWA 1GK8A 1X60A 5DS7A 5IFMA 4PWDB 3LO3A 3TAMB 4ES2A 2FLOA 3NOGA 3R7NB 3RB3A 3T9NA 4ZN1A 5DQHA 3QMQA 3ULAA 4B8CD 3QBCA 5IJCA 2B6AB 3JTPA 4R58A 4AXJA 2E5HA 1QE1B 4DZ6A 2GHPA 4J90A 3IWNC 3JTNA 4CDIA 3SCJE 2N3LA 4F7VA 5K8NA 1IBKF 1SC1B 1OZNA 1RABB 4V1Ak 4K8RA 4I69A 1WD6A 1IJFB 1RB0A 3ISZA 4RO0A 1JJ4A 2YQ0A 5CMPA 4X64F 1JLQB 3LTOA 4OZ3A 2L9DA 3PTWA 1OSCA 4DUTA 4RNMA 2IBKA 1S77D 2DGQA 2E1PA 3C16A 1FRXA 2ZKTA 5KG4A 2YNGA 2V4JA 2BBEA 4RNOA 2CJKA 4FYDA 4X62J 4NCGA 3Q8YA 4WE1B 2RQMA 3DXBA 1VQMS 1GX5A 3RYLA 1FKOA 4P2SA 2DHGA 4O44B 4C98A 3A8KA 4PXCA 3HHLB 4O3PA 5HMZA 3RFJA 4MAKA 4LXRA 1HQ2A 3CIMA 4U95A 4DSLA 4WYKA 1TR0A 3L9ZA 2YXLA 2ASDA 2HHPA 2VFRA 2UXCJ 1HWUA 1CJTA 2DXDA 3CJ2A 3DI6A 2RKIA 2IDEA 2ABYA 2LYVA 3LGHA 3DMJA 3N6LA 3THPA 5L39A 3UN2A 5KT3A 3EM1A 1FJEB 4C8KA 4Q2LA 2UP1A 4KQZA 3V4MA 1AROP 2GC8A 3QWUA 1GEHA 4G1IA 4GVBB 2X1AA 3NAHA 3PX0A 2HIYA 4IH6A 4FBTA 3MF5A 2Q66A 2JE0A 2RUGA 1WTBA 5KOXA 3X1LB 3TAQA 2Z2ZA 3D66A 5KG1A 1U0SA 4JI3J 5KFSA 1M9LA 4F50A 3PJXA 3I5CA 1S6PA 2DR5A 3WPGA 3FCVA 2W2QP 1WEXA 2DYAA 2CKWA 1ZM4A 1IKWB 4PUOA 3NS7B 4C0HA 4OZLA 3C6TB 2IJRA 2WONB 3VALA 3GILA 4DR1F 1D9DA 2PT0A 3H2VE 4EZGA 3FEYB 4AXIA 5KFVA 3OR1A 1T94A 4DDFA 2I6WA 1CLFA 3KLEB 4EK2A 2GAGC 1KQKA 1FJCA 2F40A 3KLGB 4A8YA 4Q62A 1RTHB 3WPCA 4N7TA 5CXTA 1NCLA 3OUYA 1CJUB 1RT6A 2CQ0A 1GAOA 4Q44A 3HK2A 4K4ZA 4CILA 1S6QA 2MYFA 5DDRC 3JS9A 1MSWD 1VIOA 3CJ5A 4PG4A 3OVSA 2C3MA 3M6XA 3JSYA 1EHWA 3UDVA 2DCLA 4BC9A 4U7LA 1VQ7S 3MD3A 4HH0A 3W5ZA 3NNAA 2CVEA 3OR1B 1A6LA 3FUYA 4OJ3A 5A8KB 3U02A 4DR5F 3ZZTA 1NB2A 3HHLC 3SFGA 1YRTA 1AUDA 1WTFA 3TX8A 3KK2A 3MM8B 1F9HA 3B78A 1RWPB 1YJUA 3Q8VA 4ZPDA 3TZYA 2AJQA 2RS2A 3ETOA 2WW4A 2IYIA 5E3RA 5E33A 4KHRA 2X1BA 3RB4A 3LA0A 3OL6A 4F2RA 1J2VA 1X4CA 2FLPA 4PRFA 1LKZA 3MMJA 2IA0A 2FGOA 2RH3A 3T1YF 3I9ZA 1HBNA 3N6MA 2YX7A 3P5BP 4DN0A 4X4RA 1UA1A 5L1KA 3H2UB 3G8TA 2HZCA 1KHWA 3FEZA 4OV6A 3QIDA 5GMFA 4NLWA 1DARA 2OEMA 5J2QB 3NXZA 4DSJA 5EX3A 2FC9A 2LU2A 4ZLLA 1N36J 3UD3P 3DOMA 4IYQA 3HULA 4N77A 2QL9B 3PMHG 4WK3A 4Z7YA 1R3NA 2F3JA 3QO9B 4ZOSA 3LUYA 4ZITA 1ZTTA 2YQ1A 3JYTA 1Q95G 4DLGA 1KFSA 4R0AA 1UJ5A 2PD1A 2UUTA 5F41A 3G06A 4DL5A 3DKDA 1JB0C 3BH6B 4WE1A 3RG6A 3KLGA 4NZ0A 4QZVB 4OX6A 4B3OA 4PQAA 2ZH9A 4DPUA 4OJ1A 4RL1A 2XGQA 2C3UA 2Z66A 1IR1A 4K4TA 1IBKJ 4B9SA 1S6QB 4GKKJ 1QVFR 2G13A 3VGSA 2M70A 2Z30B 5KFOA 1NM2A 4I1TA 3VHQA 3OLAA 2DGSA 2W4PA 4E2FB 2EVZA 3CCTA 2AZ1A 4WFBQ 1QUPA 2JHEA 3W2VB 1FJGJ 5E41A 1RT3A 1X9SA 1MWQA 4ANEA 2WVBA 1DTQB 2P8IA 5IOLA 4TXSA 4X64J 2AKWB 1N56A 1WDTA 1FT8A 2ZOFA 5A2QY 1RDRA 3MGJA 3RU0A 4ECSA 4QIGA 2A0FB 4MYUA 2HZVA 3A13A 3ULUA 1RTZA 2GJ2A 1HHSA 4BCAA 4F2SA 4DR4J 3TZXA 3KLVA 4H09A 1FRIA 2C3OA 2ADBA 5GAHI 1ICEB 2QLWA 3PW5A 2A10A 3MPDA 4NYOA 2ZH1A 1IKWA 1BGXT 1TELA 1VGYA 2KHDA 3FK4A 1VBYA 4ICLB 1T8EA 4PUOB 1RU2A 3D6FB 4F0MA 2WFHA 1D3WA 4O0NA 4HH1A 4U96A 5F8HA 4YB1P 1NJYA 4RNNA 5EUHA 5LXYA 2Z57B 4WFYA 3A1YG 2P6TA 4JI5J 3CCSS 1WACA 5A8WA 4LF6F 2MY8A 1IBMJ 2R9UA 2VG5A 1TUGB 3QJJA 1QAIA 2HBZB 1WOOA 4R5PB 1RLCL 3NWGA 4RNHA 4P10A 1JWWA 2J7UA 4U06A 1TL5A 2M5YA 2IM1A 4C2BB 2DEIA 3DRRB 3MPWA 4JP8A 1WOPA 2XMUA 3M4XA 4O4GB 2W2MP 3P49B 3RTVA 5KFKA 5B0TA 2BE7D 4V19J 4R08A 1N5SA 3W8PA 2W9BB 1B7YB 1U47A 2UUBJ 2DHAA 1H7XA 3IM8A 1NK7A 3CF5Q 1RAHB 2ILYA 3TUIC 3KMQA 3GLJA 1HD1A 2MQLA 2B8PA 3BYPA 4USWA 4DSIA 1E6YA 1AYEA 1FI4A 1VRUA 2KO1A 3VR1A 4OV1A 4IR1A 3ZNJ1 2YNGB 5IM0B 1U0ND 1QE1A 3TR5A 3NAIA 1RTJA 1YI2S 4I68A 3UCZP 2CJYB 3OL8A 3PW0A 2OPQA 2DISA 3TW0A 1WWHA 4TU9A 1NSQA 3MEEB 4PWWA 4ECWA 4R5PA 2VG6B 3MD1A 2F65A 1HYSB 4G1PA 4LI1A 5GADI 1YBAA 3BEGB 2JSXA 2F7VA 2GHWA 4M1KA 2HWIA 5CZXA 4ZPWR 2PMZD 1O6VA 1WHVA 4YR0A 2GMLA 1FKOB 4TN2A 1OGQA 2PDAA 3S8SA 2W9CA 1PO6A 1HW9A 1VHIA 4Z64C 4ER8A 2BMBA 2UUAJ 2YNHB 3IBFB 1T02A 3PNIA 4A8KA 4NZRM 4ZK7M 1IKXA 1RWOB 3MUVP 4QIVA 4LSZB 1OMSA 2OPPA 3CW2C 4NYPA 4DSEA 2V4RA 3D1HA 4R07A 3D68A 1EARA 1TKTB 4KGMA 1U25A 2YKPA 1RWKB 3D28A 2VOPA 3C6TA 4DU8A 3R5JB 2B9YA 1HBUB 4DS4A 1T05B 2BEXA 2J9DA 1N34F 4DLEA 2ZHOA 2E1MC 3LW5C 3E6JA 4L72B 5KFRA 3ZYIA 5HSPA 1FNXH 2YNIB 5KFYA 1UP1A 4NLRA 1K0VA 1AZSB 3N0VA 5B08A 5ETPA 3ZTSA 5AXLA 4FS1A 2R7UA 1JXLA 5HVHA 4C11B 1S9EB 3ZNUA 1CJVB 3MMCB 3FSIA 1CVJA 4FF2A 1V6HA 4ECRA 2C2KB 4ED6A 4PQUB 2E5JA 2UUWA 3G4SS 4TVAB 5KFNA 3U1MA 4GC7A 1NB7A 2O66A 5KOWA 4TU7A 2CWKA 2YH0A 4QW9A 1DZ5A 1VQNS 1RT4A 1O8BA 3IRXB 1M90T 4FF1A 4FVCA 4DEZA 2ZBPA 3W2VA 3O53A 2YNIA 2CJBA 1MG7A 1SVDA 5HLFA 3CD6S 2XEXA 4WTYA 1HQUA 2I5JA 3CEDA 1AUSL 1KWMA 1PJ7A 3AAWB 4ZP7A 3R7SB 3ZZZA 5A6PA 3AD7C 1R27B 3KG1A 2HPUA 2QLBB 4FYWB 4X65J 1H6UA 3DLBA 2KJWA 2XWXA 3B82A 3CJKB 3VV2B 5KTQA 4ES1A 4EBCA 3RGIA 2EFQA 1UMJA 3MEDB 2D69A 5KFGA 1B3TA 4IOAQ 1Y3KA 2CPYA 1VIXA 2JRSA 4P6QA 2UU9J 3C14A 2CPEA 3UR0A 1VFJA 3K5MA 3G82B 1HR0J 3BS9A 2HGMA 3H5UA 2FY8A 1SB6A 4TU8A 4L3NA 4R8UA 2V67A 1BC6A 1ULRA 1K5DC 3TJ9A 1RHKB 1TTHB 3TZWA 1QD1A 1KFDA 3BBFA 1KLMA 2OD4A 3W3NA 1YRUA 2ZVIA 2EC2A 2FLNA 4F4WA 3WPHA 3I5AA 3LGMA 3NBPB 4ZVTB 4XIUA 4OI2A 3PVXA 5H9EK 1RKJA 3CC7S 4F36A 3L7UA 1KTQA 2R7WA 4DFJA 4KPYA 5DM7Q 4X66J 3MFHA 2MDAA 3ILOA 4C97A 5I42A 3OFGA 5L9XA 3LP0B 2O6RA 1ZAWA 2Q43A 5LMUJ 3HX9A 1JLQA 2AEFA 2N7YA 1S1XA 1C1CB 4WP3A 2E29A 1T9VA 1U2RA 3H5SA 4X84A 5JJBA 5AE1A 2KXHA 2IFXA 3RZAA 4BV4R 1VQKS 3KDNA 3G39A 1O51A 4KT1A 5A6WA 1U6ZA 2RF2B 2JFKA 3OBIA 4Q0BB 2ZD1B 4QYRA 1S9EA 3CUNA 3T5HA 2V8HA 4XPCA 1ITPA 1EJ7L 3RRGA 1RWVB 2XSFA 2QA4G 5AXKA 3HHLA 4LI2A 2FT3A 1GXTA 1RTHA 4R6JA 3KK1A 3QT6A 1ZS6A 5ADZA 4B9LA 1B4SA 2E1AA 4CP6A 3CIYA 1T9YA 3BSOA 4ILLA 3UCGA 5L46A 2LQ5A 4J7CA 3ZTOA 4MKAA 4FDFA 2ZWPA 1YG0A 2MQPA 5JVHQ 3W5XA 4I6JB 1TL3B 2UVVA 1U2FA 3WZ0A 1GMWD 3SB4A 5J2PB 3BKFA 1BQMA 1W25A 3HCXA 4MN8B 4FNIA 5DG8A 5AT1B 3OFEA 1HIYA 1XMBA 2V8PA 3FDSA 2CJXB 1PJ5A 1R8HA 1JJHA 1FRLA 1Q78A 2LXUA 2RE1A 3HSZA 4TY9A 3WIUA 2KM8B 4P75A 5AXNA 3CCES 2V0NA 3RW7A 1OQ6A 4F25A 3PW4A 4JV2A 2MXYA 2LP4A 1HQEA 1UZDA 2VPXB 2SXLA 1GX6A 4OHVA 4YB7A 1X4HA 3PDNA 3Q0AA 4DF8A 4ZLPA 4DR5J 4OYIA 3UL8A 1CSJA 4LF6J 3CDEA 2C2EA 2P5VA 4QU6A 3HHKA 1NXIA 4J9PA 1BLUA 1UPMB 1VQ8S 1P9QC 4OI0A 4X4NA 5KFFA 5JUMA 1LFWA 4EZ9A 5FIIA 1RXOB 2CWXA 4WFZA 1W2BR 4F0HA 1G1XA 1QYYA 1XK8A 3ILIA 5FLXU 2QFJA 4NLTA 3CCRS 3W3LA 1D9AA 2OD6A 2V34A 3GYGA 3WX8A 4FF3A 4C3LA 3GJSB 1X8DA 4K4SA 4H4KA 2R2TA 1KS2A 3HVTA 1N54B 2BVZA 3IR5B 3M8PB 3DI6B 4RBUA 1UEKA 3UW1A 4DUYJ 4NXNJ 3T1HJ 1F60B 2XG8A 3PEJA 2ROGA 2O6QA 1ZH5A 2GIRA 1SQGA 1VDHA 4M5GA 2V4QA 8AT1B 2RRAA 5D78A 1ZETA 4LFCF 3C6PB 2VICA 3D3CJ 2EBEA 4RBTA 1R8BA 4A8QA 3DLLQ 1TUVA 2I1RA 4IRCA 1OQ3A 1OWXA 3FJ2A 3ZZOA 3Q2TC 5HQLA 2G1DA 3T5LA 2WAQD 3L7OA 4Z7CA 3IC1A 3AJDA 2HVHA 2RDDA 5EGYA 2IBOA 5M2UA 3H0PA 3V6JA 3CD5A 4WYLA 4C0BA 3PX4A 2AJ0A 1N4LA 4G3IA 5LMUF 3P5TL 1F2HA 1NSAA 3KG0A 2R7XA 1WSVA 4DV4J 3PJWA 1FQVA 3G3BA 3ENWA 2GVZA 3QT7A 4KB7A 1EQ0A 1SKSA 3UL7A 4I0WA 1TP7A 3NS6A 4HT7A 1HMVB 3KJQB 4PKIG 3ADAC 2XQCA 4QYZK 2CQBA 1XNQF 1APSA 4LF2A 4ECOA 4K5SA 1OYEA 9ATCB 5CCLA 1HLWA 2VBZA 2XLKA 2JWNA 4MFBB 3JAMU 3MHYA 3IMQJ 3N9UC 3QSIA 3G87A 2WSCC 3SDEA 2J6TA 1DHMA 2B5JA 2FJXA 3TEHB 4H4MB 5C2GA 4CYUA 1TK0A 3H20A 1HR0F 2RKIB 4JUZA 1PIEA 1JJCB 2W9CB 3EPIA 1SUQB 3RGZA 3ZZ0A 2G0JA 4RW7B 4WIQA 1C2PA 4EYHB 4HTJA 4K7QA 1RA7A 4CLZA 4YB5A 1MW7A 4USTA 3PEHA 1NK9A 3W9IA 2JEJA 2Y9HA 1T9UA 1UVMA 3L7PA 3MMBA 1CULA 2EFGA 1MLAA 3SMZA 4UOCA 3G6YA 1JLCA 2B5JB 2DNKA 1I51B 1YDLA 1TFYA 5DDOC 3DNCA 2VBYA 5J1PA 3DRPA 3FRZA 4ZCLA 4X4PA 2Q1LA 5CCMA 3CCZA 1O6SA 3IGNA 4QIFA 4AYBD 4M5LA 3DOMB 4PPZA 3Q86A 4KH0B 3K5PA 2GMJA 5B0CA 4DV7F 3W5YA 2DGUA 2B4VA 4OIXA 4DX6A 3P8BB 3Q8QB 2V2ZA 1PKUA 2FVCA 4B3SJ 4UZBA 3BKTA 2AYGA 1F3FA 2VA3A 3DGVA 4OLPA 4CYUB 2XHWA 2GCFA 4MTPA 5DDQC 2CZ9A 1WHXA 4ETZA 3REZA 1FCAA 3R1LA 2Q4GW 2DNNA 1SIWB 2FVSA 1N33F 4BS2A 1TL4A 1JKHB 2DGXA 1YBTA 2BABA 2PEBA 3AA8A 5D0RA 4U7CA 3IWLA 5EWFA 5GAGU 2ATCB 2X3DA 4YEAA 4CLYA 2ZH2A 5GMGA 3RW6A 2J8SA 1R8CA 1YVFA 1Z4UA 3BN4A 3MM5A 4PWUA 2Q6BA 2BA9A 1JXEA 3IBWA 4ZVQB 4CLPA 4EMDA 1SC4B 1IVZA 2VKZG 2GNKA 4EZ6A 2ZEJA 2DPJA 2L3MA 1NU4A 2QMWA 1RA6A 1UVLA 1DBDA 3SEOA 2W1BA 1DAXA 4FPRA 4Q45A 4X4SA 4ZJOA 2BDPA 5D0GA 3IAS9 3FMBA 5HN0A 2BKNA 3HFVA 4X2BA 4IG0B 1YQHA 3BB5A 3P45B 2W7PA 4O23A 4WP6A 4K17A 3DLEA 1GNKA 3MR3A 4LF4J 4DV6J 2GX8A 2IAJB 4ZPVR 5KFDA 2YWGA 2FTRA 4GMKA 4OLOA 4B3MJ 4NZTM 2MKSA 2A6MA 2N4DA 4PXBA 5DG7A 3RUBL 2XWTC 2FJBB 5AE2A 2QA4S 2HSEB 3SQGA 5D3IA 3CC4S 1S1TA 3I0SB 4LSAA 2VOOA 2HHTA 1DTQA 1W2IA 3VVUA 3DXSX 4IDKA 4Z37A 4YMEA 2DH8A 4DFMA 3EZ5A 2KKHA 3LF0A 2XCAA 2G4BA 1QSYA 2EBGA 2D9OA 1T3OA 3VGUA 2YX1A 1RE1B 2G2YA 3EGNA 3GQCA 1HD0A 2RD5C 4L3FA 3H5XA 4FBUA 3QYYA 2B4UA 4J9KA 3QLHA 2F9JA 4ZHRA 5H9FK 1IO0A 1S0MA 1Q5VA 1OY8A 2IM2A 2FGCA 3CGIA 4G6VB 3F0NA 1EB0A 1MU2A 1X31C 2VG7B 4Q2MA 2CA6A 2A0ZA 2BJEA 2JEGA 4K4UA 2BE9B 5IS2A 2LXFA 3TVYA 2HURA 4AQYJ 3GOZA 2HLTA 2CA9A 2DNGA 4WFXA 2VASA 1HI8A 5GVQA 4BHQA 3CD7A 3I31A 5HROA 3HFKA 5MLCV 3MMAA 2XI2A 2GQ2A 1REVA 2X51A 3MAAA 2IPOB 3NY0A 1IKXB 3V6DB 2F5GA 2HNZA 4JI4F 4M63A 4F4KA 3CNQP 1FXRA 3M32B 4WXWA 1D8YA 4C9DA 2LEAA 1QUVA 4LQ3A 3M2VA 2QL5B 1SI9A 1VQPS 3T9ZA 3MR6A 2FDNA 2GZOA 1FDAA 5KFUA 4LR7A 3WPEA 3OJUA 2C2NA 4ID5B 3VQSA 2E1CA 3DFEA 5CYQB 4NCGB 4M5KA 2DBBA 3S1TA 3JAMY 5KFEA 2OIHA 5ETRA 1U26A 2WVEA 1CQMA 5A8RB 3EE3A 4NXMJ 3DZEA 2FC8A 1RAJA 1BQXA 3CMAS 4ZVRB 3LP0A 3POTB 4MK7A 3WN4A 1JLAA 2PMWA 3D3BJ 4OI3A 4ZP9A 4MKYA 5AWBA 3MM7B 4QOTA 4PG6A 3ZTQA 1NSKL 3V6DA 2PN6A 1RAAB 4P2MA 2I5JB 4W90B 2OMWA 4E8UA 3C6OB 3KJ4A 1X9WA 2IVMA 2BACA 2M2BA 3B4MA 3BBBA 5J1EA 3IG1B 2ZH4A 4IFVA 4P72A 1XNRF 2NSBA 2QMUB 1FDBA 3TEGA 2PEHA 4F26A 1G2EA 4KR0B 5GMDA 3DDKA 2VJUA 1EP4A 3OR2A 2V94A 3OSPA 2I2YA 2MJUA 3O44A 1S1WB 3AXMA 3A3PB 3LQVA 3KK3B 3PW2A 1F1BB 1VHFA 2FJEB 3QGIA 1CJKB 1L3UA 3TUZC 1EQMA 5HAOA 3KUEA 2BRKA 2HNYA 4B17A 4A8FA 1UKUA 4B3RF 1SQFA 3D6MB 4PEQB 3ZTPA 2XGPA 3CJ0A 3KJNB 4RWWA 4DV0F 1HI1A 4U9RA 2JJ4D 3WQPA 2WBRA 5U47A 1P27B 2VBXA 3DRYA 4HACB 4NLXA 4KNGA 1FE0A 4DR7F 1BWEA 1NBEB 1FESA 2RMLA 3MCMA 4M8LA 3K2YA 2MB0B 4AL5A 2RU3A 3BR9A 4OI6A 4PG7A 2YH1A 1MROA 3FSYA 4C8ZA 2X7IA 1UCNA 2F4VF 2MLXA 4ECQA 1HNZF 4Z94G 2RF2A 4N56A 4E98A 2ZDPA 2DHHA 3GCXP 3OTCA 2VPWB 3RR8A 1UJ6A 3HSDA 2XY6A 1B64A 2NQPA 4AD6A 2D3O1 2H1YA 2XMKA 3CO9A 3WHIA 1J5OB 5GAHU 5CD4H 3T5JA 2R7VA 2A6OA 3KUGA 2VFUA 4RW6A 5C5JA 2QL7B 1XERA 2F4FA 5B0FA 3JB9k 2J8AA 1G3OA 2HRUA 1HNWJ 1RAIB 2CQCA 3CIZA 4PZVA 5D4OA 3WPFA 3MEGB 2HHUA 3EVMA 3THVA 1ZAXA 2BJ7A 4H4OB 1LW2B 3MI7X 5DM6Q 3CCQS 4DR3J 4J9NA 3J80U 2AV5A 2Z4PA 1HBUA 1KBRA 2E5IA 5DGAA 1WKLA 3VGTA 1T05A 1QLNA 2PFDA 4U8VA 1DS9A 1HNIA 1FD8A 2WRMA 3K7RA 2KG1A 1WG5A 4IFYB 5F8MA 2HK3A 5KFXA 1C0TB 1DCEA 6FD1A 1VQ4S 1YBUA 1K44A 3BM7A 3BF4A 2OPRB 2DXEA 3QRPA 1TK5A 3MXHP 1X5PA 5GAEI 1CQNA 3DGPA 2MEWA 3NGUA 1R0AA 3NLCA 1N0UA 2LDYA 1YZ6A 2GV1A 2R8HA 1HPZA 2CZ4A 2QE5A 2CDQA 4GVLA 3LANA 3MEGA 4D3GA 2Y8WA 4YS2A 1C0TA 1FXLA 4J9LA 3O8WA 4KBIA 1Q82T 2CAJA 5LSLA 1G7CB 3BJYA 1S9GA 1S7HA 1LEOA 4JI4J 2L41A 5I3UA 4Q0BA 2CPXA 3GJTB 3NCRA 2GVDA 3FVYA 1RT4B 4JI2F 4QXEA 2QLFB 4ZP8A 2HKEA 1IKYB 2DHXA 1TUWA 4R5DA 3D6HB 4LQ9A 4Y65A 3VAJA 1GQEA 2CZVC 1H73A 3PFOA 5L9NA 4CO4A 3VZHA 4OZ5A 2E9RX 4KKOA 4NE9C 5C42A 2IM3A 3KMSA 2JFDA 2RHSB 3SCLE 3NGDA 4ZIWA 1OS5A 2EFVA 3IS9A 4B3RJ 5A5CA 4ILMA 3VAFA 5HVGA 4Y2MA 4RKUC 2EG2A 5KFIA 2Q6CA 1CS4A 2OPSB 3OW2R 2AD9A 4LSCA 1IBCB 2UUAF 4Z79A 3KNAA 3MR7A 2ZZTA 4LSLA 4F4YA 5A0YB 3B6BA 4UY8T 4X4TA 1N5TA 1RWXB 2QLXA 3B54A 4OZ1A 2DNRA 1M5VC 2FHJA 3NWRA 4XDDA 2YKQA 4ELVA 2QEXS 5L1IA 5KFWA 4DL3A 3MURP 2OGUA 2QA2A 2IA6A 2KXNB 2RJZA 3QAUA 5F3TA 2E5GA 4NI2B 5FDLB 2KG0A 3SFUA 4F3QA 2EFOA 4B3OB 4KHPJ 3BV8A 2CVIA 3O1LA 2QRRA 4OX9F 4JI0J 1LV5A 1NJZA 5T7LA 2HVDA 4WP9A 1RT5B 4KGKA 1XR6A 4USIA 4KKOB 1RWMB 2DNPA 3FC9A 4CLFA 4CO3A 5C42B 2KM8C 2JQDA 3J7YI 3R1HA 1YRXA 1TL7B 1NUEA 5DLGA 1YJNS 4DMZA 1L3SA 5AWCA 4QWDA 3G3AA 3D1OA 2ZNYA 4QW8A 2O5DA 1S1UB 1VRTB 2QSFA 3I87A 3MAHA 3VCDA 2D3UA 3FFIB 4C7QA 4ZJLA 2HFSA 1K9MT 1E6VB 2VDIA 1KR4A 3H25A 1XMQJ 1IBLF 4Y0FA 5BJRA 4RUHA 3JSMB 4K4WA 1NKBA 1UW4A 2L9NA 2UXBF 3D54A 4RX6A 2GVDB 4OYZA 3GPAA 1XECA 1WKKA 4CWBA 3DDNA 4LF8J 4GKJJ 4JI1J 1HWLA 4NLOA 4J4LA 1Q16B 1K5GC 2V8VA 1H2VZ 2ZE2B 3EWGA 1HWKA 2B3TB 2XOTA 3BGUA 3M9MB 4QYZJ 4QBZA 2MSSA 1UJ4A 4O4RA 4PEOA 3G8SA 1JLAB 1X4BA 3H98A 3EGWB 3PYDA 2XO6A 3QZ7A 4B9UA 4H4MA 2ILZA 2JE1A 3AT1B 2K06A 2YWEA 2K3KA 5H1SV 2W24A 3PX6A 1R43A 1MMNA 4WJBA 1VRQC 4DCJB 3KLFB 4GKJF 4MIAA 2YKOA 2P9CA 3MECB 1J5EJ 2HQFA 1LQ9A 4IFYA 1S0NA 4V2EA 2C42A 1TL3A 2VU5A 4F04B 1UVIA 3ETMA 2MLYA 4LJMA 2MKCA 4MK8A 1HMVA 2DT9A 2ELLA 1Q8KA 4OYOA 4FYVB 2WHOA 1QAXA 5DGBA 1JLCB 3THTA 5FLXY 3OR2B 4F02A 3A8JA 1RAFB 2LQ8A 1OTNA 3HD1A 3Q2SC 4H4KC 4YN3B 2OH2A 3HHNB 3OVBA 4LMZA 2VV5A 4FVMA 4HTIA 1MU2B 3FCHA 3GU0A 4Q8FA 1HQEB 1GWBA 5AXMA 4ZLNA 2PI5A 2KZMA 2VDHA 1ZM3A 2K7KA 4ENOA 3BDPA 4DWIA 4PWDA 3FBFA 4LIRA 1S59A 5KFTA 1H74A 2HMIB 2W01A 1DTTA 3Q8RB 1PYTA 4IQXA 4OI4A 3OJSA 3HM9A 1SKWA 4XAKA 1FF2A 2PA3A 2WW8A 1S7IA 3MPYA 1AZSA 4RW8B 5I3UB 3D4JA 2LXIA 1K1SA 3PZPA 3PY8A 2QV6A 4DR1J 2MKHA 2IRUA 3I0RB 3MCNA 1TV6A 3MECA 3R5AA 5KFLA 4C48A 4ZN3A 4LF4F 1IQZA 1WC4A 2JZ5A 3ZZRA 5IWAF 4QBUA 2MTLA 1Q8IA 4X62F 1DFDA 2RU9A 2FJAB 2R7QA 3LAKA 3ELHA 5KT2A 2BJ3A 1N6QB 3J7A1 2XMTA 1XBWA 1X0FA 2IFGA 4RWTC 1KLNA 1M9SA 1C1BB 2BJ9A 1RHUB 3T1HF 4ECVA 5HDHA 5AWAA 4LFCJ 3K8WA 3V6KA 1RTDA 2FZCB 2MZJA 4HYKA 3DLKB 1GFWB 1SBRA 2ZE2A 3I0RA 3CC2S 2MQMA 2LFVA 3I4HX 3ITHB 3BO3A 4UF4A 2IYGA 4CC4A 1DY3A 2NXJA 1H3DA 4Y6IA 4ZP6A 3KLIA 4ICLA 1YGYA 3M2RB 3DLGB 2MKYA 3LP2B 1C1CA 2DITA 3C14B 3ZYNA 2IAJA 2F8MA 2MPUA 1IM6A 5LL6d 2HFUA 4RU2A 2R8KA 4AW4A 1W7WA 5HQ8A 1U1LA 4QR1A 1RHMB 4U8YA 5E0OA 3J81j 3K17A 4O0IA 3E2JA 2RRBA 2BX6A 2GO9A 3K5LA 1H6KX 1XTZA 2R42A 3FCWA 1S10A 2VC1A 2WB4A 3M9OB 1NAQA 4IFVB 3OTOF 3ENVA 3PIPQ 3JQJA 3LP2A 1VRUB 2B56A 3EVWA 4A8SA 3UNGC 1PAEX 3SBMA 1GT8A 4JV5J 5A8KA 3G6VA 4W4MA 4YB6A 1NK0A 3NEKA 1S6OA 4WPAA 5IJDA 3ITHA 2NYIA 1WHWA 4ZPAA 2WBMA 1RWUA 1VQ9S 2KTQA 2J0XA 1E6VA 1RYSA 2Z8QA 1RAOA 5F9NA 2B4PA 2DY9A 2C2DA 5B0BA 3KTQA 3DLGA 2MSTA 4DV5J 2RAQA 1RHJB 4NZ7A 4USUA 1TU0B 4WP8A 2VB6A 3GFXA 2UZYA 4CI0B 5CYQA 4DR6J 4NLGA 2YWKA 2HBQB 3UDCA 1DLOA 2YWFA 3UD5A 5GMHA 3IR7B 5GADU 1X4FA 3DRSB 1ZPWX 4YHHF 3OVAA 3I9V9 5EWEA 3OUYB 1CJUA 3OL7A 4DR4F 3FKBA 2R2SA 1R6VA 3LPYA 3I96A 1IBLJ 4RW9B 1VJWA 4RPFA 1O5JA 2F8EX 2JL9A 2PC6A 2W9AA 2VFTA 2W8KA 2X1FA 3LGNA 3I4PA 1KHVA 5B0GA 2VBWA 3FBCA 3K5OA 3OGMB 4LF7F 3A3OB 4ZKAA 5KFZA 3C15B 4NRUA 1QTMA 1SJRA 1U1RA 2YNFB 5F0UA 1KVJA 1P1TA 4JI6F 3R2DJ 3CO0P 3EVOA 1PSDA 1N5YA 1RT7B 3H42A 5KFMA 3O5TB 1L3TA 3V4IA 3F41A 2NZ4A 3KUHA 3HJFA 1UTAA 1HWJA 2WCXA 4IG3B 2DR6A 3WIVA 3QRQA 4V2DA 3JSBA 1S6PB 3MZIA 2QZ8A 3PHEA 4O3RA 4ARRA 1WF2A 4NPOA 4WYWA 4A4JA 3KJVA 4ED0A 4CC4C 4R6AA 1OPIA 3CJQA 4DF4A 2K1RA 3W9JA 1YK9A 4QR2A 5K8MA 2R7RA 4Y2IA 1GH8A 3GIRA 4OYWA 1Y5LB 2E5LF 4ELTA 3GIIA 4DV2F 4IOBA 4I2PB 1AT1B 2BZ2A 5ETQA 4YUDA 1TL1B 1WI8A 1KN6A 3I0SA 4RCWA 2KFZA 1UAWA 4JI8J 1NSPA 3JTOA 3KLIB 2R4FA 3QJLA 1RHQB 3OQ2A 4J9UE 2Z64A 2LDIA 2HNDB 3W63A 4IO9Q 2Z0GA 2DGVA 2VQFF 3GFHA 1Q7YT 2W9BA 4WWSA 1XR5A 3QIPA 3TA0A 2GQCA 5BR8F 1RADB 4C8OA 2OTJS 2WQWA 1IWGA 3A8EA 1T0TV 2GS8A 3W62A 2ZH6A 4ZA1A 4ED4A 3M19A 1WOSA 2VFVA 2W25A 4R25A 4WU3A 3DDIA 2RDIA 5K14A 4ED1A 4ED5A 5IC4B 2AZ3A 4FP9A 1FVSA 1Q86T 1JLFB 1LFPA 1R0CB 2ZBRA 4F0KA 1XCDA 1FFSB 4PERA 1RTJB 3KOAA 1HBMA 1BHNA 3SSRA 1NRKA 4HL9A 2DNLA 3RBDA 2HHSA 3MM9B 1RQ0A 1RP5A 1FRMA 1Q5YA 1J27A 3FNNA 4IH5A 3V81B 2FD2A 4WKRA 2APOA 4DCOB 4LRCA 1RKIA 4LSNB 2E9TA 3R6GB 1UWBA 5LOQA 1VR6A 4IRDA 2NYHA 2V2QA 1RCXB 1RWNB 3L95X 4NLVA 1VC6A 4NXMF 2WOMB 3BPSP 3QQCD 1VQ5S 1HBOA 3HXMA 4P2XA 4ZMMA 2V9SA 5CQGA 2ZBCA 3CWJA 2BXJA 2WK4A 1MMDA 2ATLA 4C8MA 2BE2A 2U2FA 2YQ3A 3BGRA 3CPWR 1CG2A 1HNVB 3BO4A 2B8QA 2QSWA 3E01B 3MM6A 3IRWP 2FHOB 3QNWB 3R3TA 1PYSB 3GIMA 1Q53A 1U1MA 2JX2A 1FNMA 2XYPB 2BJ8A 1GMWA 2HWHA 3H8YA 1N52B 1D09B 2PO4A 4QIEA 4TNOA 2NPFA 4ED8A 1D0EA 3G8QA 2D41A 4KGZB 5LJ3Y 4LVOP 2FVQA 2WVFA 4H54A 1HYSA 2FHKA 2HAFA 2R3VA 3K59A 1OYDA 2G9OA 2OI2A 2ZUGA 3AB4B 1T03A 1B7FA 4XGOA 3NNHA 2CG4A 3W3KA 3X3UA 4AY9X 1Q7LB 1T9WA 2FZGB 3DM2A 2H4WB 1V5VA 4HHJA 2VHGA 4IH7A 1YJWS 3I5BA 1WHYA 2OKQA 5I3PA 3OTEA 3M7VA 3NGSA 5F8IA 2W4CA 4ITSA 3M1VB 2ZZNA 3UL9A 1M1HA 4UQTA 4WBFA 4DX5A 4B9TA 3OFHA 5BYQA 1C0UB 1UL3A 2WONA 1KNZA 2Z82A 2KHCA 4TQSA 3MR2A 2HMIA 3V6HA 3DU6A 1N5VA 1A9NB 4DR7J 3DU5A 3KKFA 2ZWOA 4OHYA 2WQUA 3DOKA 2B9EA 3FZBA 2DXFA 1TVRA 1Q8LA 4DL0C 1VQYA 5RUBA 1XC9A 3P72A 1MWYA 2ID5A 5IZHA 1UVNA 1Y00A 2FJVA 1T03B 4BDPA 3BSNA 3UE2A 1F5BA 1XNQJ 2XNRA 4R5CA 4LFBF 4CH7A 3W7BA 1IXKA 1S97A 1S1XB 1LWEB 3Q8PB 3M2RA 2L48A 5DJBA 3KWMA 4NEZA 1QSSA 3PO5A 1FDDA 3CD0A 2XM3A 4ZPTR 2MGZA 2XHCA 1KQSR 1FWKA 1S57A 1TMJA 3DRXA 2MZTA 3D2WA 3MOJB 3CVRA 2WSFC 4MT1A 1MROB 2L08A 4NLUA 3TX0A 2D9PA 3CVKA 3DLKA 1U49A 1HHTP 1PC5A 3UDLA 5C7PA 2W2PP 1JXVA 3CIGA 2PA8D 3NBPA 4B9NA 2VF3A 2ZC3A 5IT9Y 3NL0A 4YEBB 3UWTA 2F8HA 1YLXA 1KSPA 2YPZA 1J5OA 4F3OA 2CNNB 4KFBA 2CQ4A 1I3OB 1G6BA 2ASYA 2NZCA 4Q3GA 3HVTB 4HHUA 4KY3A 5KFPA 3KHGA 2VG7A 2CQ2A 1FVQA 4BLGA 2DY1A 5KFJA 4NMLA 3MDFA 3E3ZA 1FD2A 1NPKA 2BM1A 2M52A 5DZ7A 5DZ6A 2R7TA 2VG5B 1K0TA 4ECNA 4M5DA 2CUYA 2AT1B 4DV3F 5IC6B 3NRBA 5D4NA 2MGZB 3M8SA 1HNXJ 4RNFA 1RI7A 3VAKA 4K0KF 3PO4A 2WQVA 4F4XA 5LMNJ 3BSAA 1CJVA 4Y61B 4LF9F 2IRXA 1Y11A 1LOUA 2OFHX 4UTGA 4GKKF 3UVJA 5D3GA 2WSEC 1HNWF 3A79B 1TL7A 3NGKA 1FTRA 3WBZA 3CMQA 2HS3A 3NKYA 5KG2A 3UR3C 5KT5A 4DS5A 1NK5A 4CNYA 2XO7A 2FYXA 3H90A 3C2PA 2HHQA 2HQ3A 4UW2A 3RGXA 2Y5QA 2Z63A 3HPOA 4U67Q 2AHOB 3AQOA 2GA7A 3EJMA 1BQMB 1MN9A 2G0CA 1HA1A 1WG1A 2HBYB 2H5JB 2O67A 4NI2A 4RUBA 4GVBA 2MKIA 1LWCB 1M5SA 1M5KC 2J5AA 3GSIA 4Q3IA 2CFXA 4ZCMA 4QWEA 3M1VA 1UETA 2EI5A 3U1NA 3DN9A 3L3CA 2HYIB 2R2RA 1H2TZ 3O3LA 4A8OA 4CO5A 1LW0A 2IM0A 2QTWA 3AOCA 3M2UB 4HVZA 1ZM2A 1OTMA 1N32J 1SUQA 3GZ7A 4MKBA 4CO2A 5IQQA 1YIJS 1KOHA 2RVJA 2Z2MA 5HI7A 4B3MF 4W92B 1Q79A 2J0SD 3O6NA 1N5YB 2HFOA 5H9FJ 1LWXA 2JEFA 4XK8C 2KZZA 3T41A 1SQEA 2C3YA 4EFAC 5DQIA 4I2QB 5G0RA 3PM9A 3R5DA 2KL8A 2BANA 2OMOA 2QC3A 1U1PA 4ARNA 1SV5A 4WK1A 4ZVEA 2UUBF 2WVDA 2VONA 4PPDA 4ZDNA 1ACMB 4PYDA 4N8NA 1YITS 4LF5J 4ZVSB 2YY3A 1NHVA 3GV8B 1RACB 2YKMA 5A76A 2W7AA 2YKNA 5IQ6A 4LF9J 4B9MA 2VODA 2Z7XB 2KDOA 4B02A 5CMNA 1N5QA 3OHBA 2Q3PA 2Y1RI 1PGZA 3NNCA 4ILRA 1KRPA 4HACA 2HFVA 4QWAA 2CQ1A 2HHXA 3BGFA 3C6UB 5L8RC 3MM9A 4F8RA 4DR6F 1YX2A 4DQSA 4LF8F 3GR0A 2WB1D 1N88A 1P6TA 2BW7A 4CQ1A 1FWPA 2MLZA 4RWXA 3QATA 1DQ9A 3RB0A 3VQ2A 2OHDA 2MKJA 1RT1A 2B43A 2GHVC 3AH6A 1FX2A 1XWLA 4NLPA 5HMYA 3Q23A 4OQJA 5DQGA 2CPFA 2M7SA 4ZVPB 1U7LA 2FJDB 2ASLA 3H59A 3IBCB 2O01C 3ZC4A 2XC9A 1PJ6A 9RUBA 4YR3A 3TANA 4HKQA 1MMLA 3C66A 1G9UA 3BPDA 4DPTA 1U6BA 2NLWA 4KC5A 3M6WA 1RJJA 4TYAA 4OI1A 4F4ZA 4YY3F 1KP6A 1RTIA 2M0GB 4QPTA 3G9CA 4JI3F 1T95A 1X7VA 2H5EA 2X1GA 3A8IA 4HT5A 1JNZB 2QN6B 4LR9A 4EU0A 4BBYA 1B0VA 1CBKA 3KNGA 3QFHA 3UN9A 2RQKA 4PSJA 1NJXA 1S1TB 2L9WA 3E51A 4DR2J 5AJ3J 2HW3A 5SZTA 4M5DB 2Z62A 4ZVOB 5DRKA 5HMXA 2ZHAA 3PV8A 4R6FA 1X4AA 1M1GA 5DDPC 3SZ2A 2RT3A 5KG3A 3MMBB 7FDRA 5J2MB 2Y1IA 1LK5A 1B70B 2ALYB 2QGFB 1BE4A 3BQ2A 5KFAA 3PRBA 1TKZA 3HZEA 1SQ0B 4P2FA 5ETLA 4C8LA 3KJFB 2ZITA 4NWBA 3W65A 2DK2A 2KVIA 4X4OA 2P9GA 4Z8GA 5IWAJ 3TUPA 4KIAA 4R6GA 1JIHA 2FPHX 1S49A 4CM0A 1DTTB 3ISNC 3MCSA 3L09A 2M4MA 4YP3A 4N76A 2LEPA 1SJ3P 2HS4A 4ERDA 2IDLA 4XPEA 1Y4ZB 3CDAA 3N4WA 5LSOA 3QO9A 1KONA 4JI7J 3W64A 4XOSA 1LTXA 1FNOA 2A1BA 4MKVA 4QIWD 5KFHA 4YOEA 2G2OA 2QA1A 4CNCA 2W4DA 3SCKE 2JEIA 4XTTA 1VBKA 5ETMA 2ZZMA 2H3EB 2VC0A 2ASJA 4FDWA 2CQGA 4U7UD 4AL6A 5D4LA 1NEEA 1FFGB 2LVWA 3MM7A 3SYZA 1I94J 4WZMA 1F9FA 2EW9A 4NLQA 1L5UA 2ASTB 1OTOA 2RA8A 5FTTB 1R0BG 3R2CJ 3NP5A 5KT6A 4TQRA 3POTA 3VF0B 2N3OA 1M5OC 4M94A 1QSLA 4ANCA 4J9MA 4M5HA 5KT7A 4DR2F 5K9FA 3JQKA 2UV8G 3ZYOA 2NXCA 1W26A 2E1RA 4ZCIA 2H4YB 1FHTA 1Z2LA 5GMEA 3UCUP 3TAPA 1AXQA 5K14B 2JVRA 4LIWA 2AYEA 1UW9A 3TAMA 2FJWA 2JOQA 3R9LA 3W2WA 4WTOB 4LRBA 1GMUA 3MTKA 3EDQB 3Q22A 1YKWA 2KN4A 2DVIA 4LUBA 2IRYA 4OX8A 2I9SA 1YJRA 3G2XA 1U1KA 3VTIA 2P2CB 4CO1A 4AL7A 2UVRA 2HNDA 5T14A 3E8OA 1YJ7A 3W3GA 4P73A 1BXNA 3OPKA 1UA0A 1LK7A 4UZCA 3PKMA 3UQSA 3QJPA 1BUXA 2BEFA 1FKPA 4NLDA 4EUVA 4I4BA 4GC6A 2B9XA 4DQRA 2GGPA 3EGZA 2IHR1 2K1RB 2VUGA 1FEHA 5E7OB 2A3JA 2BE2B 3BGRB 3HZGA 3SI8A 2GFFA 4IO1A 4JV0A 5IV4A 3OHAA 1N48A 5ITHA 2XLIA 4BSRA 2CNLB 1WC1A 1VQOS 3K8VA 3QT8A 3DHWC 4OJGA 1FRJA 2J7KA 3GJQB 5B0AA 3TVZA 2JLGA 3BQ0A 2CG8A 2G0IA 1WC6A 3N01A 2QJ3A 4Y2AA 5HQMA 3V81A 1D9FA 4TZHA 2OFGX 3SCIE 5DLFA 4J9SA 1SJ4P 4MIWA 4UQGA 1JLGB 3H4BA 1I1GA 1CPZA 3DMJB 2V70A 1MWZA 4OYXA 3DC2A 4NKGA 4U09A 4C3KA 2IMWP 4UOFA 2EWHA 2KFYA 4WIIA 3PYEA 3KFWX 4WFAQ 2FB0A 2HK2A 3NCPA 3GIJA 2WZ1A 4DG1B 3EX7B 4QU7A 3FBBA 5J2NB 1VMBA 2ZJRQ 3UD4P 4KV8B 2BW2A 3M32A 4L73A 3TI0A 1EKRA 1WC0A 3ZFVA 1KEKA 1UFLA 1RCOB 2P9EA 4G1QA 3T6BA 2BKOA 1URNA 1WEZA 5C24A 1ZZNA 4WU2A 3HDSA 1M5PC 2UUCF 3CJTA 3OT9A 1NDLA 4TY8A 2FQQB 3H40A 4FKYA 2ZJPQ 4C3MA 2GIQA 1JQGA 1G4CA 2XSJB 2CPDA 2YNHA 2CPJA 2VG6A 3CSKA 4A8XA 5LJ5Y 2IC3B 3VWSA 3RAMA 3MWBA 5THWA 1Y3JA 3AY0A 3EZOA 4MJKA 3SQOP 4NYZA 3M8QB 2EKNA 2EKYA 5B7WA 1LWEA 1Y5IB 2B0GA 4CO0A 3SV4A 2PE8A 1OY9A 4DFPA 3V4IB 3VAHA 4FMZA 2BJ1A 2DIVA 3HI9A 4FYYB 3EYZA 1TKXA 4EYIB 1HI0P 4DXLA 3I82A 5IXUA 3BGOP 2IJFA 3GYNA 3CCWA 3KYLA 2XMMA 5I42B 3D67A 2CXEA 1LWCA 1JLFA 2HG4A 2QO3A 3E2EA 2O3DA 2Y0SD 1IBMF 3OGLB 4O4GA 2MY7A 4XO0A 1H0HB 2J9DE 3GIKA 4LR8A 1Y0HA 2HNZB 3H7HB 3HKZD 4OYMA 1JX4A 4LSXC 4NLSA 4PXEA 2HEKA 4LF1A 4USJC 4JI8F 5C25B 4IG0A 2CPIA 2AP6A 1AFIA 1T11A 4P91A 1HQUB 2DD8S 2JH3A 3D6TB 4A46A 3TQ1A 1U48A 3M8PA 4ZS6A 1IWAA 4QR0A 1C1BA 2ACMA 2HBRB 3QFWA 3GG0A 1U2CA 3S01A 4KAIA 1WEYA 1I94F 2XYHB 2HAIA 2PI4A 3W3SA 3DOKB 1V5IB 2AW0A 4WF9Q 1FXDA 3BZQA 1S12A 2NUUG 3QGGA 4UUWA 1NDKA 3AD8C 1VRTA 5IT4A 3NGRA 4LRFA 2IVFB 2DCUB 2Y1JA 3T1AA 2WOMA 2C2MB 4DV4F 2FZKB 2KU7A 4DSFA 3I6PA 3JXOA 1HW8A 4B9VA 4QC0A 1RBLA 2PSZA 3CCJS 4UY85 1CC8A 3FEXB 1X5OA 4OJHA 2DGWA 3D0HE 2UXDF 1HNVA 4PXDA 4K4YA 4HI1A 3SQGB 3M8ZA 1BQNB 2MHEA 4OZ0A 4Y3CA 4LF5F 2P1NB 1X5SA 2YBVA 3T5KA 2DO4A 3PRDA 2KB2A 1EETB 3GR1A 2ZH7A 2BRLA 2UVWA 1S48A 4PQUA 4OFZA 2KRBA 3F44A 2FHJD 2HGNA 3TUJC 4DX7A 3ZYJA 1NPPA 2GIFA 2KVQE 2HS0A 3GFZA 4X66F 3RFEA 4ZJQA 2MMYA 1CC7A 4J9VA 2AEJA 2H9ZA 3CTRA 3R27A 4RW4A 3KLHB 2AIRB 4LRDA 1SL0A 1QAJA 2J6SA 2ASSB 4CCHA 1VLOA 2CJQA 3HHLD 3HSJA 1HPZB 4UUXA 2LQ9A 4W98A 3IS9B 1WWLA 2V2VA 2XS5A 3PYGA 4PYAA 1I6JA 4GLPA 3MEDA 4DV0J 1S72S 3LAMA 1H2UX 3D1QA 4PKDB 4CP5A 4DUZJ 1ROFA 1TVRB 1UWAA 2DNZA 2BUNA 2JC0A 5DO2A 4X4QA 3OLBA 3UN3A 1XNRJ 2DNMA 3IFEA 3KXDA 4FXWA 4DL2A 3T6JA 3OXLA 1VK3A 4DV6F 1WSRA 2ZOGA 3KJVB 3W60A 4QQBA 1L3VA 1XMOJ 1P8VA 4CZCA 3QZ8A 4HR2A 4Z2XA 3Q89A 2MQNA 1LXJA 1ZZFA 3UN5A 3V2UC 3M8RA 3MAQA 2VQEJ 1KOOA 5KT4A 4I2PA 4P71A 2ZHBA 4FPIA 2KYZA 4CLWA 2A18A 3GSDA 2QIFA 3GP9A 3R5BA 3TJAA 1HBNB 2RNEA 2CADA 1U45A 2YNFA 2OMVA 2H51B 4RUAA 4PR6A 4ED2A 2B7CB 2VPYB 2XB2D 5C2CA 4KH1B 4AFFA 4L75A 5BR8J 3TZZA 4HDHA 4B3TF 4LFAJ 1CULB 1NJWA 1TAUA 4V2CA 2HHHF 4F3MA 4NX9A 4USHA 3ENAA 2MQOA 3TA2A 4TLRA 5CYJA 1HWIA 1RT1B 1OO0B 2X3GA 2XZTB 3VZIA 5F8GA 4FXDA 1R7IA 3IM9A 3AQPA 3LP1A 4P74A 1P8GA 3A3NB 3CJ4A 3HHEA 4URQU 4CLLA 5BYRA 2NCKL 3DOLB 4RU9A 3RBEA 2HVZA 2Y3YA 2ADCA 4IUFA 1X4EA 4DL4A 4WZQA 2E9ZA 3HO1A 3C8YA 3SIPB 4PG5A 4TYBA 2DPIA 4LT6A 3HFZB 4U6PA 4G65A 4P52A 3CE8A 1A0OB 1HARA 1NMEB 1ZOTA 2Z56B 2LMIA 4OYPA 3TVKA 2M3DA 4RW7A 4ZHRB 1UVJA 1RWWB 3PFEA 4CH0S 1OOKG 3CJ8A 3RJ0A 1RT3B 4I6WA 1P8TA 2I0XA 2OO4A 2ZD1A 1NJIT 2VQFJ 2VA2A 3AFGA 2OUGA 2QX0A 3C19A 5E3QA 4LF7J 2HRTA 2OPQB 3E01A 1ZA1B 1LWFB 5F3ZA 1X4DA 2EEYA 2K8GA 3AJ2A 3IAM9 2DHSA 2KXFA 2NXNA 4FZVA 5IV3A 3KLEA 1REVB 3MAAB 5JXSA 2Y8YA 3AB2B 3QAEA 3W66A 2VD3A 1N32F 1REGX 2OSQA 4KHMA 1RAGB 3OFFA 5D4PA 5AWDA 2XS2A 1JLEA 1IR2A 5H9EJ 4DPXA 3CJ3A 1NO8A 3GONA 3MEKA 1R6YA 3AOAA 3PJ9A 4LSNA 5HK4A 5D3GB 4M95A 3M2UA 4UOHA 2ZOMA 1N36F 1ZYQA 2R8GA 4FS7A 1AW0A 1FDNA 1H98A 3MCOA 1N8RT 3F73A 2J9EA 3BBCA 4MH8A 1K73T 1WI6A 5E3AA 2HHHJ 3BZ5A 2UV8A 4U08A 4IOCQ 1PCAA 3US5A 5CA5A 1VLYA 3HVRA 1P9AG 5K20B 1WC3A 4EO6A 1Z2ZA 2OSRA 4LSLB 4OZ2A 4FXVA 4PAAA 3OD2A 5L1LA 4ANDA 2HZAA 4K4VA 3DYAA 1FKAF 2HIQA 2OLWA 1U24A 3LH2S 5EHHA 4DL6A 2ZBIA 5HLFB 1R8AA 5CYMA 3HVAA 2YKMB 1QTNB 1U8SA 4K59A 3CDUA 3ISND 1SH2A 2IIHA 5ETSA 4U7UK 1YZ7A 3SV3A 4A8MP 3CMES 3DLEB 2XMJA 1S5ZA 2DNOA 1SPBP 3GE9A 2XBPA 3TRGA 5M2PA 1XEZA 7AT1B 1VC0A 3WC2A 4CM2A 1SH0A 3C15A 1KQFB 2ZJQQ 1BMQB 2R7OA 2GO8A 2GMHA 3AA9A 5I4MA 2FLLA 4JV1A 1ZAVA 5ETKA 3MOZA 4DV5F 1B0TA 1MNEA 2VKRA 5ETNA 5A8RA 2DR8A 4B3TJ 4GT6A 4ZVHA 1IKVA 1SXLA 1OJ4A 2MZQA 5E3CA 2BQ3A 1XMQF 2V8DA 1FK9B 2ZH8A 1IN0A 4DV7J 1MN7A 1P1LA 4C2MA 2JVOA 4O3NA 3UI3A 2HHWA 2KT5A 2XNQA 4X4UA 5IJBA 1RT6B 4HEA9 2G2ZA 1Y7PA 2ZC4A 5ETOA 4WKYA 4ZLJA 1OY6A 3PRVA 4HLBA 4X4VA 1VOMA 3ZO7A 2M9KA 3EUNA 3OTOJ 3IWXA 3OV7A 1FFWB 3H2LA 5E2QA 4O3QA 4ETXA 1TL1A 1F5CA 2AMCB 2HQIA 3P96A 1NKEA 4KO0A 4KHPF 1M0ZA 1RU1A 2D1CA 2H65B 3PG9A 4XDCA 5A0YA 3G04C 2P1QB 1O6TA 4DX8H 2ROEA 3M8WA 3Q8SB 2BOPA 4AQYF 2C2ZB 1BY9A 4OYBA 5IT0A 4I6YA 2XY5A 3BKUA 3IP0A 2FVPA 2B51A 3KLFA 5F8LA 2AYMA 2Z2LA 1DLOB 3S7RA 3BQ1A 5GS2B 4EBDA 1WORA 2EK6A 1FK9A 2HFZA 1HHQA 1F3VA 1F0XA 1S79A 2KT2A 4I7FA 2AGOA 3M18A 2QT7A 1NDPA 2PIIA 2LLZA 3M8QA 3MPVA 3J7YU 4ECUA 3RB6A 2ALZA 1S6UA 1VQLS 1GMVA 1UVKA 2LECA 1R89A 2JDJA 1HBOB 1RISA 1C4AA 1UEUA 2A2DA 2PGCA 2YPYA 1UFKA 4ZPBA 1SL2A 3ENQA 3H5YA 2M8HA 2JNJA 1S1UA 2MZ1A 1TKXB 4CT9A 4IDKB 4M7EC 3KK2B 1XQIA 2E66A 1E6YB 5AJ3F 3P6YC 3LWMA 1NDCA 5T7LB 5HANA 3HMJG 4LSXA 2V2KA 5FJ4A 4I56A 1JNRB 4JI2J 4HQ1A 4UT4A 1A7GE 4S0MA 5CHCB 4L74A 3WX4A 2UVUA 2ZH3A 2I8EA 1R8PA 1XIQA 1YWXA 1OIAA 1QJHA 2HWTA 1PILA 3DYAB 3FSXA 5KG5A 4TLQA 1TKDA 2KT3A 1UWBB 1XJWB 1URRA 1T7PA 6AT1B 2OTLS 3DRRA 3G6XA 5HL7Q 3WPBA 1RK8A 1B0PA 4GO5X 3W9HA 1N6QA 5F9LA 4Q5VA 5HBMA 4BWMA 3M8YA 5KG0A 2PMHA 1QAYA 1EKSA 2OJ3A 7FD1A 2NREA 3DLJA 1Y9OA 2AEMA 4DFKA 4LFAF 4LBHA 3UFCX 1HNIB 3V5RA 5F8JA 2RR6A 1A9NA 1WF0A 3VQTA 2J6UA 1R31A 5CABA 2DNYA 1W8AA 4IKAA 4USVA 4C4WA 4MIBA 4ZPCA 1Q8BA 3H4DA 1FE4A 3MEEA 5D6GA 2IJNA 1EP4B 1DQAA 2LQJA 2NUHA 2BR0A 4Q8EA 1VYAA 2LU1A 2YKNB 1TAQA 2YWWA 5D77A 5B4PA 1WC5A 2BYCA 1XMOF 2PFFB 1NKCA 5IYXC 1C4CA 4JI0F 2EPIA 1S9FA 1X9MA 4NMXA 4OX9J 1K47A 2RS8A 4FS2A 4OL8A 3R6LB 1NZAA 3MTJA 5SUHA 3T19A 4LFBJ 3M30B 2GAHC 5J1NA 3OL9A 1S9GB 4V19X 1QVGR 3CB4A 1WJ9A 2KH9A 2B9WA 1JKHA 2DNHA 4J91A 2CNKB 2DIUA 3RIZA 1XR7A 3W3JA 3MUTP 4ECYA 2D3ZA 1M5HA 5GAEU 3W2WB 2F4VJ 3P3DA 2AGQA 5B0EA 3QRRA 4ES3A 2Z2YB 1FKPB 3PR5B 2W8LA 4FHOA 5KFQA 2R9LA 5LFNA 2M8DB 1RHRB 1GTEA 2C2OB 3PIOQ 1FTCA 2J76E 1ZA2B 2CQDA 2HQDA 4ED3A 1RT2A 1SC3B 3L4BC 1XWDC 3OXFA 3HD2A 3KK3A 3VAGA 5IT9U 3GB0A 4Z61C 1I5OB 4BSUA 1YRGA 2UXDJ 5HJXA 4O3OA 1V9OA 2DRAA 4XSQA 3PW7A 5D15A 1BQNA 4KE5A 2AJ2A
chains in the Genus database with same CATH topology
2POKA 3RRKA 4J0MA 4PCQA 4KXFB 5J2MA 4NZ6A 1RT7A 1H7WA 3KK1B 1NNDA 4CNMA 4RLEA 2FHMA 4IRKA 2XS7A 3SDEB 1Q1KA 1D0BA 2Z63A 5EWGA 5KFCA 3PKYA 2CRLA 3ULVA 4P7VA 2AYBA 2GQQA 3IA0A 4URSA 2AX1A 5HBMB 2C22A 2OPRA 2NR0A 2EC0A 3SXLA 1DURA 4G8AA 2DNQA 1SKRA 3M9NB 4TY8B 4ID5A 3ZZPA 4Q43A 4DUYF 3QWPA 2UZXA 2KFNA 4DQQA 1WF1A 3RAQA 2LKZA 5LT5A 3DLHA 2K2PA 3B4DA 3FGVA 2MJNA 2CPHA 4ECTA 4ED7A 2LA6A 1Y5NB 4DG1A 4EGLA 1HL6A 3UPFA 1HFEL 4H4OA 4X65F 1ZM9A 5J2NA 2E7WA 5J2QA 2OTLS 3EZUA 1J5EF 2RDJA 3I56S 4A47A 2V9TB 3D0GE 3EXYA 2ZDOA 4C8NA 2VQEF 2EFNA 2P6SA 2HLUA 2DH7A 3MMCA 3J80Y 1ELOA 2RB7A 2DGTA 5KFBA 2VZ9A 1V3ZA 4RBVA 3LWLA 1TK8A 1JJ2R 4KJIA 2DRBA 4NCAA 4I67A 1CEZA 2UZAA 4RW8A 3RRHA 1OSDA 3HKWA 4YFUA 3GFYA 2M88A 1FJ7A 3CCLS 3CCMS 4NCBA 2YWHA 2RRNA 4JI1F 2Z65A 5G4DA 3HP6A 3GYXB 1WNEA