4TZHA

Structure of leptospira interrogans lrr protein lic12234
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
190
structure length
190
Chain Sequence
PKEVIIHKNLSDALKTPNEVQILDLSRNQLTILPKEIEQLVNLESLHLRDNELTTLPEEIGILKNLKYLDISRNQISNFPKEIQKLKNLEVLFLNGNSLSNLPEEIGELEKLGILYLNNNQLTTLPKEIGQLENLVSLSLSSNKLTSIPDELGQLKKLRILNLWDNPTLTTPERNIRKLFRNQEITIEIS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Unknown function
molecule keywords LIC12234
publication title Structural characterization of a novel subfamily of leucine-rich repeat proteins from the human pathogen Leptospira interrogans.
pubmed doi rcsb
source organism Leptospira interrogans
total genus 67
structure length 190
sequence length 190
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-07-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13855 LRR_8 Leucine rich repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 4tzhA00
1WWLA 4HQ1A 4GT6A 3WPIA 4CNCA 1W8AA 2Z65A 1KOOA 4PEQB 5CMPA 4BSRA 4XGOA 1D0BA 3OGMB 5AZ5A 4Z64C 5IJDA 2Z82A 3VQ1A 4RCWA 3WPDA 4R58A 5GMHA 3OJAB 2Z62A 4TZHA 1K5DC 2OMZA 2V9TB 5B0NA 3WN4A 4FS7A 2OMWA 2OMUA 3OGKB 3SB4A 1FO1A 4P91A 2Z63A 2OMYA 3GOZA 4GLPA 4Z8GA 2JE1A 3W3KA 3RW6A 3G06A 1GWBA 2ID5A 1XCDA 4J4LA 3OJAA 3PMHG 3WPFA 4H09A 4C2AB 3ZYIA 1DCEA 3KJ4A 4NKHA 1DS9A 3G3BA 5GS0A 1OGQA 3W3MA 4MN8B 4EZGA 3ZYNA 1LTXA 3OGLB 1XWDC 2WQXA 1P8VA 3G3AA 4CC4C 4Q62A 2RA8A 1JL5A 4RCAB 4ARRA 2XOTA 4R09A 4BSSA 2Z7XA 1U0ND 5AWDA 4FMZA 3RGZA 2OMTA 4P8SA 1O6SA 2UZYA 3ULAA 4L3FA 3WPGA 4R08A 3FXIA 4AW4A 3REZA 3O6NA 1A9NA 4KNGA 1YRGA 2ASSB 2Y5QA 4R6JA 3E3ZA 1M0ZA 4CILA 2FT3A 4Q3GA 3W3LA 3RJ0A 2XWTC 3WPBA 2A0ZA 2WFHA 5FTTB 4U09A 4Z61C 2P1OB 3RIZA 4PSJA 5B4PA 3JB9j 1K5GC 4FCGA 3WPCA 1H6TA 2ELLA 3C6PB 5IJBA 2OMXA 1FT8A 4Z94G 1M10B 1IO0A 5AWCA 2JQDA 4R5DA 3W3NA 5AWBA 1XKUA 3RFEA 3BZ5A 3WPEA 1H6UA 1OTNA 1XECA 4V2EA 5LFNA 2WQVA 3E4GA 3A79B 4R07A 4IM6A 4PKIG 3VQ2A 4QBZA 3RFSA 2Z64A 2Z7XB 1OOKG 4LI2A 1G9UA 4R5CA 4ECOA 4R6AA 1QYYA 2WQUA 4J0MA 4FD0A 2BNHA 4WP6A 3M18A 4I6JB 1O6TA 5B0TA 4U06A 4ARNA 5IJCA 4LSXC 2V70A 5HDHA 1XEUA 4M7EC 3RFJA 3P72A 4LSCA 4AY9X 2Z81A 4BV4R 4FDWA 4R0AA 4Q3IA 3E6JA 4QC0A 4KXFB 3UN9A 2ASTB 4K17A 4R6GA 1PGVA 4U08A 1Z7XW 4PERA 3WPHA 4LI1A 4V2DA 1P8TA 3G04C 4YEBB 4XSQA 2O6QA 1SQ0B 3RGXA 4L3AA 5HZLB 3CIGA 2P1PB 3ZYJA 4OQTA 5GMGA 4CC4A 4RWTC 2RR6A 4C2BB 2CA6A 4LSXA 1OZNA 4ECNA 3UL8A 3ULUA 3TSRE 5CMNA 3W3JA 1OTMA 4LXSA 4M7EA 2Q4GW 3O53A 4FHOA 1M9LA 2WQWA 5D3IA 1DFJI 2V9SA 1P9AG 3G39A 1A4YA 5IYXC 3CVRA 4R6FA 5AWAA 4G8AA 4CP6A 3M19A 1FS2A 3DZEA 2IFGA 4UFRA 2JE0A 3UL7A 3RW7A 5GS2B 4LXRA 2O6RA 4XOSA 3ZYOA 4WYKA 2R9UA 4QXEA 3UL9A 2O6SA 1FQVA 3ULVA 1OTOA 4Y61B 1O6VA 4PQ8A 3C6NB 4U7LA 5A5CA 2P1QB 1KOHA 4MQWX 4BSUA 4KT1A 4V2CA 1ZIWA 2P1NB 4B8CD 4LSAA 3CIYA 2OMVA 4Z79A 4NKGA 2UZXA 2P1MB 3W3GA 4CNMA 3E2JA 2BEXA 5GQRK 2Z66A 1M9SA 5GMFA 3C6OB
chains in the Genus database with same CATH superfamily
1WWLA 4HQ1A 4GT6A 3WPIA 4CNCA 1W8AA 2Z65A 1KOOA 4PEQB 5CMPA 4NZTM 4BSRA 4XGOA 1D0BA 3OGMB 5AZ5A 4Z64C 5IJDA 2Z82A 3VQ1A 4RCWA 3WPDA 4R58A 5GMHA 3OJAB 2Z62A 4TZHA 1K5DC 2OMZA 2V9TB 5B0NA 3WN4A 4FS7A 2OMWA 2OMUA 3OGKB 3SB4A 1FO1A 4P91A 2Z63A 2OMYA 3GOZA 4GLPA 4Z8GA 2JE1A 3W3KA 3RW6A 3G06A 1GWBA 2ID5A 1XCDA 4J4LA 3OJAA 3PMHG 3WPFA 4H09A 4C2AB 3ZYIA 1DCEA 3KJ4A 4NKHA 1DS9A 3G3BA 5GS0A 1OGQA 3W3MA 4MN8B 4EZGA 3ZYNA 1LTXA 3OGLB 1XWDC 2WQXA 1P8VA 3G3AA 4CC4C 4Q62A 2RA8A 1JL5A 4RCAB 4ARRA 2XOTA 4R09A 4BSSA 2Z7XA 1U0ND 5AWDA 4FMZA 3RGZA 2OMTA 4P8SA 1O6SA 2UZYA 3ULAA 4L3FA 3WPGA 4R08A 3FXIA 4AW4A 3REZA 3O6NA 1A9NA 4KNGA 1YRGA 2ASSB 2Y5QA 4R6JA 3E3ZA 1M0ZA 4CILA 2FT3A 4Q3GA 3W3LA 3RJ0A 2XWTC 3WPBA 2A0ZA 2WFHA 5FTTB 4U09A 4Z61C 2P1OB 3RIZA 4PSJA 5B4PA 3JB9j 1K5GC 4FCGA 3WPCA 1H6TA 2ELLA 3C6PB 5IJBA 2OMXA 1FT8A 4Z94G 1M10B 1IO0A 5AWCA 2JQDA 4R5DA 3W3NA 5AWBA 1XKUA 3RFEA 3BZ5A 3WPEA 1H6UA 1OTNA 1XECA 4V2EA 5LFNA 2WQVA 3E4GA 3A79B 4R07A 4IM6A 4PKIG 3VQ2A 4QBZA 3RFSA 2Z64A 2Z7XB 1OOKG 4LI2A 1G9UA 4R5CA 4ECOA 4R6AA 1QYYA 2WQUA 4J0MA 4FD0A 2BNHA 4WP6A 3M18A 4I6JB 1O6TA 5B0TA 4U06A 4ARNA 5IJCA 4LSXC 2V70A 5HDHA 1XEUA 4M7EC 3RFJA 3P72A 4LSCA 4AY9X 2Z81A 4BV4R 4FDWA 4R0AA 4Q3IA 3E6JA 4QC0A 4KXFB 3UN9A 2ASTB 4K17A 4R6GA 1PGVA 4U08A 1Z7XW 4PERA 3WPHA 4LI1A 4V2DA 1P8TA 3G04C 4YEBB 4XSQA 2O6QA 1SQ0B 3RGXA 4L3AA 5HZLB 3CIGA 2P1PB 3ZYJA 4OQTA 5GMGA 4CC4A 4RWTC 2RR6A 4C2BB 2CA6A 4LSXA 1OZNA 4ECNA 3UL8A 3ULUA 3TSRE 5CMNA 3W3JA 1OTMA 4LXSA 4M7EA 2Q4GW 3O53A 4FHOA 1M9LA 2WQWA 5D3IA 1DFJI 2V9SA 1P9AG 3G39A 1A4YA 5IYXC 3CVRA 4R6FA 5AWAA 4G8AA 4CP6A 3M19A 1FS2A 3DZEA 2IFGA 4UFRA 2JE0A 3UL7A 3RW7A 5GS2B 4LXRA 2O6RA 4XOSA 4NZRM 3ZYOA 4WYKA 2R9UA 4QXEA 3UL9A 2O6SA 1FQVA 3ULVA 1OTOA 4Y61B 1O6VA 4PQ8A 3C6NB 4U7LA 5A5CA 2P1QB 1KOHA 4MQWX 4BSUA 4KT1A 4V2CA 1ZIWA 2P1NB 4B8CD 4LSAA 3CIYA 2OMVA 4Z79A 4NKGA 2UZXA 2P1MB 3W3GA 4CNMA 3E2JA 2BEXA 5GQRK 2Z66A 1M9SA 5GMFA 3C6OB
chains in the Genus database with same CATH topology
1WWLA 4HQ1A 4GT6A 3WPIA 4CNCA 1W8AA 2Z65A 1KOOA 4PEQB 5CMPA 4BSRA 4XGOA 1D0BA 3OGMB 5AZ5A 4Z64C 5IJDA 2Z82A 3VQ1A 4RCWA 3WPDA 4R58A 5GMHA 3OJAB 2Z62A 4TZHA 1K5DC 2OMZA 2V9TB 5B0NA 3WN4A 4FS7A 2OMWA 2OMUA 3OGKB 3SB4A 1FO1A 4P91A 2Z63A 2OMYA 3GOZA 4GLPA 4Z8GA 2JE1A 3W3KA 3RW6A 3G06A 1GWBA 2ID5A 1XCDA 4J4LA 3OJAA 3PMHG 3WPFA 4H09A 4C2AB 3ZYIA 1DCEA 3KJ4A 4NKHA 1DS9A 3G3BA 5GS0A 1OGQA 3W3MA 4MN8B 4EZGA 3ZYNA 1LTXA 3OGLB 1XWDC 2WQXA 1P8VA 3G3AA 4CC4C 4Q62A 2RA8A 1JL5A 4RCAB 4ARRA 2XOTA 4R09A 4BSSA 2Z7XA 1U0ND 5AWDA 4FMZA 3RGZA 2OMTA 4P8SA 1O6SA 2UZYA 3ULAA 4L3FA 3WPGA 4R08A 3FXIA 4AW4A 3REZA 3O6NA 1A9NA 4KNGA 1YRGA 2ASSB 2Y5QA 4R6JA 3E3ZA 1M0ZA 4CILA 2FT3A 4Q3GA 3W3LA 3RJ0A 2XWTC 3WPBA 2A0ZA 2WFHA 5FTTB 4U09A 4Z61C 2P1OB 3RIZA 4PSJA 5B4PA 3JB9j 1K5GC 4FCGA 3WPCA 1H6TA 2ELLA 3C6PB 5IJBA 2OMXA 1FT8A 4Z94G 1M10B 1IO0A 5AWCA 2JQDA 4R5DA 3W3NA 5AWBA 1XKUA 3RFEA 3BZ5A 3WPEA 1H6UA 1OTNA 1XECA 4V2EA 5LFNA 2WQVA 3E4GA 3A79B 4R07A 4IM6A 4PKIG 3VQ2A 4QBZA 3RFSA 2Z64A 2Z7XB 1OOKG 4LI2A 1G9UA 4R5CA 4ECOA 4R6AA 1QYYA 2WQUA 4J0MA 4FD0A 2BNHA 4WP6A 3M18A 4I6JB 1O6TA 5B0TA 4U06A 4ARNA 5IJCA 4LSXC 2V70A 5HDHA 1XEUA 4M7EC 3RFJA 3P72A 4LSCA 4AY9X 2Z81A 4BV4R 4FDWA 4R0AA 4Q3IA 3E6JA 4QC0A 4KXFB 3UN9A 2ASTB 4K17A 4R6GA 1PGVA 4U08A 1Z7XW 4PERA 3WPHA 4LI1A 4V2DA 1P8TA 3G04C 4YEBB 4XSQA 2O6QA 1SQ0B 3RGXA 4L3AA 5HZLB 3CIGA 2P1PB 3ZYJA 4OQTA 5GMGA 4CC4A 4RWTC 2RR6A 4C2BB 2CA6A 4LSXA 1OZNA 4ECNA 3UL8A 3ULUA 3TSRE 5CMNA 3W3JA 1OTMA 4LXSA 4M7EA 2Q4GW 3O53A 4FHOA 1M9LA 2WQWA 5D3IA 1DFJI 2V9SA 1P9AG 3G39A 1A4YA 5IYXC 3CVRA 4R6FA 5AWAA 4G8AA 4CP6A 3M19A 1FS2A 3DZEA 2IFGA 4UFRA 2JE0A 3UL7A 3RW7A 5GS2B 4LXRA 2O6RA 4XOSA 3ZYOA 4WYKA 2R9UA 4QXEA 3UL9A 2O6SA 1FQVA 3ULVA 1OTOA 4Y61B 1O6VA 4PQ8A 3C6NB 4U7LA 5A5CA 2P1QB 1KOHA 4MQWX 4BSUA 4KT1A 4V2CA 1ZIWA 2P1NB 4B8CD 4LSAA 3CIYA 2OMVA 4Z79A 4NKGA 2UZXA 2P1MB 3W3GA 4CNMA 3E2JA 2BEXA 5GQRK 2Z66A 1M9SA 5GMFA 3C6OB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WWL A;  4HQ1 A;  4GT6 A;  3WPI A;  4CNC A;  1W8A A;  2Z65 A;  1KOO A;  4PEQ B;  5CMP A;  4BSR A;  4XGO A;  1D0B A;  3OGM B;  5AZ5 A;  4Z64 C;  5IJD A;  2Z82 A;  3VQ1 A;  4RCW A;  3WPD A;  4R58 A;  5GMH A;  3OJA B;  2Z62 A;  4TZH A;  1K5D C;  2OMZ A;  2V9T B;  5B0N A;  3WN4 A;  4FS7 A;  2OMW A;  2OMU A;  3OGK B;  3SB4 A;  1FO1 A;  4P91 A;  2Z63 A;  2OMY A;  3GOZ A;  4GLP A;  4Z8G A;  2JE1 A;  3W3K A;  3RW6 A;  3G06 A;  1GWB A;  2ID5 A;  1XCD A;  4J4L A;  3OJA A;  3PMH G;  3WPF A;  4H09 A;  4C2A B;  3ZYI A;  1DCE A;  3KJ4 A;  4NKH A;  1DS9 A;  3G3B A;  5GS0 A;  1OGQ A;  3W3M A;  4MN8 B;  4EZG A;  3ZYN A;  1LTX A;  3OGL B;  1XWD C;  2WQX A;  1P8V A;  3G3A A;  4CC4 C;  4Q62 A;  2RA8 A;  1JL5 A;  4RCA B;  4ARR A;  2XOT A;  4R09 A;  4BSS A;  2Z7X A;  1U0N D;  5AWD A;  4FMZ A;  3RGZ A;  2OMT A;  4P8S A;  1O6S A;  2UZY A;  3ULA A;  4L3F A;  3WPG A;  4R08 A;  3FXI A;  4AW4 A;  3REZ A;  3O6N A;  1A9N A;  4KNG A;  1YRG A;  2ASS B;  2Y5Q A;  4R6J A;  3E3Z A;  1M0Z A;  4CIL A;  2FT3 A;  4Q3G A;  3W3L A;  3RJ0 A;  2XWT C;  3WPB A;  2A0Z A;  2WFH A;  5FTT B;  4U09 A;  4Z61 C;  2P1O B;  3RIZ A;  4PSJ A;  5B4P A;  3JB9 j;  1K5G C;  4FCG A;  3WPC A;  1H6T A;  2ELL A;  3C6P B;  5IJB A;  2OMX A;  1FT8 A;  4Z94 G;  1M10 B;  1IO0 A;  5AWC A;  2JQD A;  4R5D A;  3W3N A;  5AWB A;  1XKU A;  3RFE A;  3BZ5 A;  3WPE A;  1H6U A;  1OTN A;  1XEC A;  4V2E A;  5LFN A;  2WQV A;  3E4G A;  3A79 B;  4R07 A;  4IM6 A;  4PKI G;  3VQ2 A;  4QBZ A;  3RFS A;  2Z64 A;  2Z7X B;  1OOK G;  4LI2 A;  1G9U A;  4R5C A;  4ECO A;  4R6A A;  1QYY A;  2WQU A;  4J0M A;  4FD0 A;  2BNH A;  4WP6 A;  3M18 A;  4I6J B;  1O6T A;  5B0T A;  4U06 A;  4ARN A;  5IJC A;  4LSX C;  2V70 A;  5HDH A;  1XEU A;  4M7E C;  3RFJ A;  3P72 A;  4LSC A;  4AY9 X;  2Z81 A;  4BV4 R;  4FDW A;  4R0A A;  4Q3I A;  3E6J A;  4QC0 A;  4KXF B;  3UN9 A;  2AST B;  4K17 A;  4R6G A;  1PGV A;  4U08 A;  1Z7X W;  4PER A;  3WPH A;  4LI1 A;  4V2D A;  1P8T A;  3G04 C;  4YEB B;  4XSQ A;  2O6Q A;  1SQ0 B;  3RGX A;  4L3A A;  5HZL B;  3CIG A;  2P1P B;  3ZYJ A;  4OQT A;  5GMG A;  4CC4 A;  4RWT C;  2RR6 A;  4C2B B;  2CA6 A;  4LSX A;  1OZN A;  4ECN A;  3UL8 A;  3ULU A;  3TSR E;  5CMN A;  3W3J A;  1OTM A;  4LXS A;  4M7E A;  2Q4G W;  3O53 A;  4FHO A;  1M9L A;  2WQW A;  5D3I A;  1DFJ I;  2V9S A;  1P9A G;  3G39 A;  1A4Y A;  5IYX C;  3CVR A;  4R6F A;  5AWA A;  4G8A A;  4CP6 A;  3M19 A;  1FS2 A;  3DZE A;  2IFG A;  4UFR A;  2JE0 A;  3UL7 A;  3RW7 A;  5GS2 B;  4LXR A;  2O6R A;  4XOS A;  3ZYO A;  4WYK A;  2R9U A;  4QXE A;  3UL9 A;  2O6S A;  1FQV A;  3ULV A;  1OTO A;  4Y61 B;  1O6V A;  4PQ8 A;  3C6N B;  4U7L A;  5A5C A;  2P1Q B;  1KOH A;  4MQW X;  4BSU A;  4KT1 A;  4V2C A;  1ZIW A;  2P1N B;  4B8C D;  4LSA A;  3CIY A;  2OMV A;  4Z79 A;  4NKG A;  2UZX A;  2P1M B;  3W3G A;  4CNM A;  3E2J A;  2BEX A;  5GQR K;  2Z66 A;  1M9S A;  5GMF A;  3C6O B; 
#chains in the Genus database with same CATH topology
 1WWL A;  4HQ1 A;  4GT6 A;  3WPI A;  4CNC A;  1W8A A;  2Z65 A;  1KOO A;  4PEQ B;  5CMP A;  4NZT M;  4BSR A;  4XGO A;  1D0B A;  3OGM B;  5AZ5 A;  4Z64 C;  5IJD A;  2Z82 A;  3VQ1 A;  4RCW A;  3WPD A;  4R58 A;  5GMH A;  3OJA B;  2Z62 A;  4TZH A;  1K5D C;  2OMZ A;  2V9T B;  5B0N A;  3WN4 A;  4FS7 A;  2OMW A;  2OMU A;  3OGK B;  3SB4 A;  1FO1 A;  4P91 A;  2Z63 A;  2OMY A;  3GOZ A;  4GLP A;  4Z8G A;  2JE1 A;  3W3K A;  3RW6 A;  3G06 A;  1GWB A;  2ID5 A;  1XCD A;  4J4L A;  3OJA A;  3PMH G;  3WPF A;  4H09 A;  4C2A B;  3ZYI A;  1DCE A;  3KJ4 A;  4NKH A;  1DS9 A;  3G3B A;  5GS0 A;  1OGQ A;  3W3M A;  4MN8 B;  4EZG A;  3ZYN A;  1LTX A;  3OGL B;  1XWD C;  2WQX A;  1P8V A;  3G3A A;  4CC4 C;  4Q62 A;  2RA8 A;  1JL5 A;  4RCA B;  4ARR A;  2XOT A;  4R09 A;  4BSS A;  2Z7X A;  1U0N D;  5AWD A;  4FMZ A;  3RGZ A;  2OMT A;  4P8S A;  1O6S A;  2UZY A;  3ULA A;  4L3F A;  3WPG A;  4R08 A;  3FXI A;  4AW4 A;  3REZ A;  3O6N A;  1A9N A;  4KNG A;  1YRG A;  2ASS B;  2Y5Q A;  4R6J A;  3E3Z A;  1M0Z A;  4CIL A;  2FT3 A;  4Q3G A;  3W3L A;  3RJ0 A;  2XWT C;  3WPB A;  2A0Z A;  2WFH A;  5FTT B;  4U09 A;  4Z61 C;  2P1O B;  3RIZ A;  4PSJ A;  5B4P A;  3JB9 j;  1K5G C;  4FCG A;  3WPC A;  1H6T A;  2ELL A;  3C6P B;  5IJB A;  2OMX A;  1FT8 A;  4Z94 G;  1M10 B;  1IO0 A;  5AWC A;  2JQD A;  4R5D A;  3W3N A;  5AWB A;  1XKU A;  3RFE A;  3BZ5 A;  3WPE A;  1H6U A;  1OTN A;  1XEC A;  4V2E A;  5LFN A;  2WQV A;  3E4G A;  3A79 B;  4R07 A;  4IM6 A;  4PKI G;  3VQ2 A;  4QBZ A;  3RFS A;  2Z64 A;  2Z7X B;  1OOK G;  4LI2 A;  1G9U A;  4R5C A;  4ECO A;  4R6A A;  1QYY A;  2WQU A;  4J0M A;  4FD0 A;  2BNH A;  4WP6 A;  3M18 A;  4I6J B;  1O6T A;  5B0T A;  4U06 A;  4ARN A;  5IJC A;  4LSX C;  2V70 A;  5HDH A;  1XEU A;  4M7E C;  3RFJ A;  3P72 A;  4LSC A;  4AY9 X;  2Z81 A;  4BV4 R;  4FDW A;  4R0A A;  4Q3I A;  3E6J A;  4QC0 A;  4KXF B;  3UN9 A;  2AST B;  4K17 A;  4R6G A;  1PGV A;  4U08 A;  1Z7X W;  4PER A;  3WPH A;  4LI1 A;  4V2D A;  1P8T A;  3G04 C;  4YEB B;  4XSQ A;  2O6Q A;  1SQ0 B;  3RGX A;  4L3A A;  5HZL B;  3CIG A;  2P1P B;  3ZYJ A;  4OQT A;  5GMG A;  4CC4 A;  4RWT C;  2RR6 A;  4C2B B;  2CA6 A;  4LSX A;  1OZN A;  4ECN A;  3UL8 A;  3ULU A;  3TSR E;  5CMN A;  3W3J A;  1OTM A;  4LXS A;  4M7E A;  2Q4G W;  3O53 A;  4FHO A;  1M9L A;  2WQW A;  5D3I A;  1DFJ I;  2V9S A;  1P9A G;  3G39 A;  1A4Y A;  5IYX C;  3CVR A;  4R6F A;  5AWA A;  4G8A A;  4CP6 A;  3M19 A;  1FS2 A;  3DZE A;  2IFG A;  4UFR A;  2JE0 A;  3UL7 A;  3RW7 A;  5GS2 B;  4LXR A;  2O6R A;  4XOS A;  4NZR M;  3ZYO A;  4WYK A;  2R9U A;  4QXE A;  3UL9 A;  2O6S A;  1FQV A;  3ULV A;  1OTO A;  4Y61 B;  1O6V A;  4PQ8 A;  3C6N B;  4U7L A;  5A5C A;  2P1Q B;  1KOH A;  4MQW X;  4BSU A;  4KT1 A;  4V2C A;  1ZIW A;  2P1N B;  4B8C D;  4LSA A;  3CIY A;  2OMV A;  4Z79 A;  4NKG A;  2UZX A;  2P1M B;  3W3G A;  4CNM A;  3E2J A;  2BEX A;  5GQR K;  2Z66 A;  1M9S A;  5GMF A;  3C6O B; 
#chains in the Genus database with same CATH homology
 1WWL A;  4HQ1 A;  4GT6 A;  3WPI A;  4CNC A;  1W8A A;  2Z65 A;  1KOO A;  4PEQ B;  5CMP A;  4BSR A;  4XGO A;  1D0B A;  3OGM B;  5AZ5 A;  4Z64 C;  5IJD A;  2Z82 A;  3VQ1 A;  4RCW A;  3WPD A;  4R58 A;  5GMH A;  3OJA B;  2Z62 A;  4TZH A;  1K5D C;  2OMZ A;  2V9T B;  5B0N A;  3WN4 A;  4FS7 A;  2OMW A;  2OMU A;  3OGK B;  3SB4 A;  1FO1 A;  4P91 A;  2Z63 A;  2OMY A;  3GOZ A;  4GLP A;  4Z8G A;  2JE1 A;  3W3K A;  3RW6 A;  3G06 A;  1GWB A;  2ID5 A;  1XCD A;  4J4L A;  3OJA A;  3PMH G;  3WPF A;  4H09 A;  4C2A B;  3ZYI A;  1DCE A;  3KJ4 A;  4NKH A;  1DS9 A;  3G3B A;  5GS0 A;  1OGQ A;  3W3M A;  4MN8 B;  4EZG A;  3ZYN A;  1LTX A;  3OGL B;  1XWD C;  2WQX A;  1P8V A;  3G3A A;  4CC4 C;  4Q62 A;  2RA8 A;  1JL5 A;  4RCA B;  4ARR A;  2XOT A;  4R09 A;  4BSS A;  2Z7X A;  1U0N D;  5AWD A;  4FMZ A;  3RGZ A;  2OMT A;  4P8S A;  1O6S A;  2UZY A;  3ULA A;  4L3F A;  3WPG A;  4R08 A;  3FXI A;  4AW4 A;  3REZ A;  3O6N A;  1A9N A;  4KNG A;  1YRG A;  2ASS B;  2Y5Q A;  4R6J A;  3E3Z A;  1M0Z A;  4CIL A;  2FT3 A;  4Q3G A;  3W3L A;  3RJ0 A;  2XWT C;  3WPB A;  2A0Z A;  2WFH A;  5FTT B;  4U09 A;  4Z61 C;  2P1O B;  3RIZ A;  4PSJ A;  5B4P A;  3JB9 j;  1K5G C;  4FCG A;  3WPC A;  1H6T A;  2ELL A;  3C6P B;  5IJB A;  2OMX A;  1FT8 A;  4Z94 G;  1M10 B;  1IO0 A;  5AWC A;  2JQD A;  4R5D A;  3W3N A;  5AWB A;  1XKU A;  3RFE A;  3BZ5 A;  3WPE A;  1H6U A;  1OTN A;  1XEC A;  4V2E A;  5LFN A;  2WQV A;  3E4G A;  3A79 B;  4R07 A;  4IM6 A;  4PKI G;  3VQ2 A;  4QBZ A;  3RFS A;  2Z64 A;  2Z7X B;  1OOK G;  4LI2 A;  1G9U A;  4R5C A;  4ECO A;  4R6A A;  1QYY A;  2WQU A;  4J0M A;  4FD0 A;  2BNH A;  4WP6 A;  3M18 A;  4I6J B;  1O6T A;  5B0T A;  4U06 A;  4ARN A;  5IJC A;  4LSX C;  2V70 A;  5HDH A;  1XEU A;  4M7E C;  3RFJ A;  3P72 A;  4LSC A;  4AY9 X;  2Z81 A;  4BV4 R;  4FDW A;  4R0A A;  4Q3I A;  3E6J A;  4QC0 A;  4KXF B;  3UN9 A;  2AST B;  4K17 A;  4R6G A;  1PGV A;  4U08 A;  1Z7X W;  4PER A;  3WPH A;  4LI1 A;  4V2D A;  1P8T A;  3G04 C;  4YEB B;  4XSQ A;  2O6Q A;  1SQ0 B;  3RGX A;  4L3A A;  5HZL B;  3CIG A;  2P1P B;  3ZYJ A;  4OQT A;  5GMG A;  4CC4 A;  4RWT C;  2RR6 A;  4C2B B;  2CA6 A;  4LSX A;  1OZN A;  4ECN A;  3UL8 A;  3ULU A;  3TSR E;  5CMN A;  3W3J A;  1OTM A;  4LXS A;  4M7E A;  2Q4G W;  3O53 A;  4FHO A;  1M9L A;  2WQW A;  5D3I A;  1DFJ I;  2V9S A;  1P9A G;  3G39 A;  1A4Y A;  5IYX C;  3CVR A;  4R6F A;  5AWA A;  4G8A A;  4CP6 A;  3M19 A;  1FS2 A;  3DZE A;  2IFG A;  4UFR A;  2JE0 A;  3UL7 A;  3RW7 A;  5GS2 B;  4LXR A;  2O6R A;  4XOS A;  3ZYO A;  4WYK A;  2R9U A;  4QXE A;  3UL9 A;  2O6S A;  1FQV A;  3ULV A;  1OTO A;  4Y61 B;  1O6V A;  4PQ8 A;  3C6N B;  4U7L A;  5A5C A;  2P1Q B;  1KOH A;  4MQW X;  4BSU A;  4KT1 A;  4V2C A;  1ZIW A;  2P1N B;  4B8C D;  4LSA A;  3CIY A;  2OMV A;  4Z79 A;  4NKG A;  2UZX A;  2P1M B;  3W3G A;  4CNM A;  3E2J A;  2BEX A;  5GQR K;  2Z66 A;  1M9S A;  5GMF A;  3C6O B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...