2FT3A

Crystal structure of the biglycan dimer core protein
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
303
structure length
303
Chain Sequence
AMCPFGCHCHLRVVQCSDLGLKAVPKEISPDTTLLDLQNNDISELRKDDFKGLQHLYALVLVNNKISKIHEKAFSPLRKLQKLYISKNHLVEIPPNLPSSLVELRIHDNRIRKVPKGVFSGLRNMNCIEMGGNPLENSGFEPGAFDGLKLNYLRISEAKLTGIPKDLPETLNELHLDHNKIQAIELEDLLRYSKLYRLGLGHNQIRMIENGSLSFLPTLRELHLDNNKLSRVPAGLPDLKLLQVVYLHTNNITKVGVNDFCPVGFGVKRAYYNGISLFNNPVPYWEVQPATFRCVTDRLAIQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Biglycan
publication title Crystal Structure of the Biglycan Dimer and Evidence That Dimerization Is Essential for Folding and Stability of Class I Small Leucine-rich Repeat Proteoglycans.
pubmed doi rcsb
molecule tags Structural protein, signaling protein
total genus 74
structure length 303
sequence length 303
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2006-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01462 LRRNT Leucine rich repeat N-terminal domain
A PF13855 LRR_8 Leucine rich repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 2ft3A00
2RA8A 4Z64C 4LXRA 2V9TB 3A79B 3GOZA 1OTMA 1JL5A 4Q3IA 4FHOA 3E3ZA 1IO0A 2OMVA 4PSJA 4CNCA 3C6PB 1G9UA 1PGVA 2Z63A 4LSCA 4FCGA 3ZYNA 3O6NA 1XCDA 2P1NB 4EZGA 2WFHA 4LXSA 3W3NA 5AWCA 3RW7A 4Z79A 3UL7A 1DFJI 2JE1A 4QBZA 5AWBA 5GMFA 1KOOA 1U0ND 2Z82A 2BNHA 4MN8B 3E2JA 4ECNA 4RWTC 4Z8GA 3PMHG 5GS2B 3CVRA 3OGMB 3RW6A 3M19A 3CIYA 4R6JA 4XOSA 1ZIWA 1XECA 4C2BB 1P8TA 2OMZA 3ZYIA 4KT1A 1K5DC 3O53A 3RGXA 2ID5A 4GT6A 1W8AA 4L3AA 3RJ0A 2O6RA 5D3IA 4PERA 4ARNA 3P72A 2P1MB 2RR6A 1D0BA 5LFNA 1OTNA 5GMHA 1A4YA 2R9UA 4FMZA 4PEQB 5IYXC 3WN4A 4R07A 2Z64A 4IM6A 4BSRA 4TZHA 2Y5QA 5GQRK 1DS9A 5IJCA 5B0TA 4NKHA 3VQ1A 2XWTC 3RFSA 5AWAA 2XOTA 3FXIA 4R6AA 2FT3A 3OJAA 3WPEA 2OMYA 5GMGA 2Z7XB 3E4GA 1SQ0B 4R58A 1H6UA 2ASSB 2IFGA 4CP6A 3UL8A 3RFJA 4BSSA 4ECOA 3WPDA 1FS2A 3RIZA 3RFEA 4OQTA 1XEUA 3TSRE 2OMWA 3UN9A 4H09A 5AWDA 4K17A 1FO1A 3ZYOA 1A9NA 3W3KA 3G06A 2V9SA 1FT8A 4GLPA 1OOKG 3C6OB 5GS0A 1K5GC 5HDHA 1QYYA 1OZNA 4LSXC 3ULUA 1FQVA 4LSXA 3DZEA 3W3GA 5B4PA 2WQWA 4FDWA 4P8SA 1H6TA 2Z65A 1O6SA 4BSUA 1M9LA 4Y61B 1O6TA 2WQUA 2V70A 2Z66A 3WPCA 4U7LA 2O6SA 1P9AG 2OMXA 4CILA 1WWLA 4RCWA 4CC4C 4PQ8A 4R08A 4J0MA 3E6JA 3SB4A 1M9SA 3C6NB 4QXEA 3W3JA 4AW4A 4QC0A 2P1QB 1M0ZA 3BZ5A 4L3FA 4Z61C 1KOHA 4LI1A 2UZXA 4UFRA 4XGOA 3OGLB 1P8VA 3WPFA 2WQXA 3M18A 4R6GA 2OMUA 4G8AA 5CMNA 4R6FA 4KNGA 2JQDA 1Z7XW 3CIGA 4B8CD 2A0ZA 4R5DA 4R0AA 5IJBA 5CMPA 4I6JB 3ULVA 4U09A 1O6VA 5FTTB 2CA6A 4WP6A 4XSQA 2Z81A 4MQWX 2P1PB 4FS7A 3REZA 3KJ4A 4R5CA 4KXFB 4RCAB 4WYKA 2JE0A 2O6QA 3G3AA 2UZYA 1OGQA 2Z7XA 3WPGA 3G04C 4J4LA 1OTOA 4P91A 4Q3GA 4ARRA 4M7EC 2WQVA 4NKGA 5A5CA 3W3LA 4PKIG 4M7EA 5HZLB 4V2DA 4R09A 1LTXA 3G3BA 3G39A 5IJDA 3ULAA 2Q4GW 2Z62A 4U08A 3OJAB 4AY9X 1XKUA 4HQ1A 4CNMA 5B0NA 2P1OB 4C2AB 2BEXA 4V2EA 4Z94G 4LSAA 3VQ2A 3W3MA 3ZYJA 3RGZA 4FD0A 3WPIA 2ASTB 4CC4A 1DCEA 1GWBA 2ELLA 3WPHA 3UL9A 3WPBA 4Q62A 3OGKB 4BV4R 1YRGA 3JB9j 1XWDC 1M10B 4U06A 4LI2A 2OMTA 5AZ5A 4YEBB 4V2CA
chains in the Genus database with same CATH superfamily
2RA8A 4Z64C 4LXRA 2V9TB 3A79B 3GOZA 1OTMA 1JL5A 4Q3IA 4FHOA 3E3ZA 1IO0A 2OMVA 4PSJA 4CNCA 3C6PB 1G9UA 1PGVA 2Z63A 4LSCA 4FCGA 3ZYNA 3O6NA 1XCDA 2P1NB 4EZGA 2WFHA 4LXSA 3W3NA 5AWCA 3RW7A 4Z79A 3UL7A 1DFJI 2JE1A 4QBZA 5AWBA 5GMFA 1KOOA 1U0ND 2Z82A 2BNHA 4MN8B 3E2JA 4ECNA 4RWTC 4Z8GA 3PMHG 5GS2B 3CVRA 3OGMB 3RW6A 3M19A 3CIYA 4R6JA 4XOSA 1ZIWA 1XECA 4C2BB 1P8TA 2OMZA 3ZYIA 4KT1A 1K5DC 3O53A 3RGXA 2ID5A 4GT6A 1W8AA 4L3AA 3RJ0A 2O6RA 5D3IA 4PERA 4ARNA 3P72A 2P1MB 2RR6A 1D0BA 5LFNA 1OTNA 5GMHA 1A4YA 2R9UA 4FMZA 4PEQB 5IYXC 3WN4A 4R07A 2Z64A 4IM6A 4BSRA 4TZHA 2Y5QA 5GQRK 1DS9A 5IJCA 5B0TA 4NKHA 3VQ1A 2XWTC 3RFSA 5AWAA 2XOTA 3FXIA 4R6AA 2FT3A 3OJAA 3WPEA 2OMYA 5GMGA 2Z7XB 3E4GA 1SQ0B 4R58A 1H6UA 2ASSB 2IFGA 4CP6A 3UL8A 3RFJA 4BSSA 4ECOA 3WPDA 1FS2A 3RIZA 3RFEA 4OQTA 1XEUA 3TSRE 2OMWA 3UN9A 4H09A 5AWDA 4K17A 1FO1A 3ZYOA 1A9NA 3W3KA 3G06A 2V9SA 1FT8A 4GLPA 1OOKG 3C6OB 5GS0A 1K5GC 5HDHA 1QYYA 1OZNA 4LSXC 3ULUA 1FQVA 4LSXA 3DZEA 3W3GA 5B4PA 2WQWA 4FDWA 4P8SA 1H6TA 2Z65A 1O6SA 4BSUA 1M9LA 4Y61B 1O6TA 2WQUA 2V70A 2Z66A 3WPCA 4U7LA 2O6SA 1P9AG 2OMXA 4CILA 1WWLA 4RCWA 4CC4C 4PQ8A 4R08A 4J0MA 3E6JA 3SB4A 1M9SA 3C6NB 4QXEA 3W3JA 4AW4A 4QC0A 2P1QB 1M0ZA 3BZ5A 4L3FA 4Z61C 1KOHA 4LI1A 2UZXA 4UFRA 4XGOA 3OGLB 1P8VA 3WPFA 2WQXA 3M18A 4R6GA 2OMUA 4G8AA 5CMNA 4R6FA 4KNGA 2JQDA 1Z7XW 3CIGA 4B8CD 2A0ZA 4R5DA 4R0AA 5IJBA 5CMPA 4I6JB 3ULVA 4U09A 1O6VA 5FTTB 2CA6A 4WP6A 4XSQA 2Z81A 4MQWX 2P1PB 4FS7A 3REZA 3KJ4A 4R5CA 4KXFB 4RCAB 4WYKA 2JE0A 2O6QA 3G3AA 2UZYA 1OGQA 2Z7XA 3WPGA 3G04C 4J4LA 1OTOA 4P91A 4Q3GA 4ARRA 4M7EC 2WQVA 4NKGA 5A5CA 3W3LA 4PKIG 4M7EA 5HZLB 4V2DA 4R09A 1LTXA 3G3BA 3G39A 5IJDA 3ULAA 2Q4GW 2Z62A 4U08A 3OJAB 4AY9X 1XKUA 4HQ1A 4CNMA 5B0NA 2P1OB 4C2AB 2BEXA 4V2EA 4Z94G 4LSAA 3VQ2A 3W3MA 3ZYJA 3RGZA 4FD0A 3WPIA 2ASTB 4CC4A 1DCEA 4NZRM 1GWBA 2ELLA 3WPHA 4NZTM 3UL9A 3WPBA 4Q62A 3OGKB 4BV4R 1YRGA 3JB9j 1XWDC 1M10B 4U06A 4LI2A 2OMTA 5AZ5A 4YEBB 4V2CA
chains in the Genus database with same CATH topology
2RA8A 4Z64C 4LXRA 2V9TB 3A79B 3GOZA 1OTMA 1JL5A 4Q3IA 4FHOA 3E3ZA 1IO0A 2OMVA 4PSJA 4CNCA 3C6PB 1G9UA 1PGVA 2Z63A 4LSCA 4FCGA 3ZYNA 3O6NA 1XCDA 2P1NB 4EZGA 2WFHA 4LXSA 3W3NA 5AWCA 3RW7A 4Z79A 3UL7A 1DFJI 2JE1A 4QBZA 5AWBA 5GMFA 1KOOA 1U0ND 2Z82A 2BNHA 4MN8B 3E2JA 4ECNA 4RWTC 4Z8GA 3PMHG 5GS2B 3CVRA 3OGMB 3RW6A 3M19A 3CIYA 4R6JA 4XOSA 1ZIWA 1XECA 4C2BB 1P8TA 2OMZA 3ZYIA 4KT1A 1K5DC 3O53A 3RGXA 2ID5A 4GT6A 1W8AA 4L3AA 3RJ0A 2O6RA 5D3IA 4PERA 4ARNA 3P72A 2P1MB 2RR6A 1D0BA 5LFNA 1OTNA 5GMHA 1A4YA 2R9UA 4FMZA 4PEQB 5IYXC 3WN4A 4R07A 2Z64A 4IM6A 4BSRA 4TZHA 2Y5QA 5GQRK 1DS9A 5IJCA 5B0TA 4NKHA 3VQ1A 2XWTC 3RFSA 5AWAA 2XOTA 3FXIA 4R6AA 2FT3A 3OJAA 3WPEA 2OMYA 5GMGA 2Z7XB 3E4GA 1SQ0B 4R58A 1H6UA 2ASSB 2IFGA 4CP6A 3UL8A 3RFJA 4BSSA 4ECOA 3WPDA 1FS2A 3RIZA 3RFEA 4OQTA 1XEUA 3TSRE 2OMWA 3UN9A 4H09A 5AWDA 4K17A 1FO1A 3ZYOA 1A9NA 3W3KA 3G06A 2V9SA 1FT8A 4GLPA 1OOKG 3C6OB 5GS0A 1K5GC 5HDHA 1QYYA 1OZNA 4LSXC 3ULUA 1FQVA 4LSXA 3DZEA 3W3GA 5B4PA 2WQWA 4FDWA 4P8SA 1H6TA 2Z65A 1O6SA 4BSUA 1M9LA 4Y61B 1O6TA 2WQUA 2V70A 2Z66A 3WPCA 4U7LA 2O6SA 1P9AG 2OMXA 4CILA 1WWLA 4RCWA 4CC4C 4PQ8A 4R08A 4J0MA 3E6JA 3SB4A 1M9SA 3C6NB 4QXEA 3W3JA 4AW4A 4QC0A 2P1QB 1M0ZA 3BZ5A 4L3FA 4Z61C 1KOHA 4LI1A 2UZXA 4UFRA 4XGOA 3OGLB 1P8VA 3WPFA 2WQXA 3M18A 4R6GA 2OMUA 4G8AA 5CMNA 4R6FA 4KNGA 2JQDA 1Z7XW 3CIGA 4B8CD 2A0ZA 4R5DA 4R0AA 5IJBA 5CMPA 4I6JB 3ULVA 4U09A 1O6VA 5FTTB 2CA6A 4WP6A 4XSQA 2Z81A 4MQWX 2P1PB 4FS7A 3REZA 3KJ4A 4R5CA 4KXFB 4RCAB 4WYKA 2JE0A 2O6QA 3G3AA 2UZYA 1OGQA 2Z7XA 3WPGA 3G04C 4J4LA 1OTOA 4P91A 4Q3GA 4ARRA 4M7EC 2WQVA 4NKGA 5A5CA 3W3LA 4PKIG 4M7EA 5HZLB 4V2DA 4R09A 1LTXA 3G3BA 3G39A 5IJDA 3ULAA 2Q4GW 2Z62A 4U08A 3OJAB 4AY9X 1XKUA 4HQ1A 4CNMA 5B0NA 2P1OB 4C2AB 2BEXA 4V2EA 4Z94G 4LSAA 3VQ2A 3W3MA 3ZYJA 3RGZA 4FD0A 3WPIA 2ASTB 4CC4A 1DCEA 1GWBA 2ELLA 3WPHA 3UL9A 3WPBA 4Q62A 3OGKB 4BV4R 1YRGA 3JB9j 1XWDC 1M10B 4U06A 4LI2A 2OMTA 5AZ5A 4YEBB 4V2CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RA8 A;  4Z64 C;  4LXR A;  2V9T B;  3A79 B;  3GOZ A;  1OTM A;  1JL5 A;  4Q3I A;  4FHO A;  3E3Z A;  1IO0 A;  2OMV A;  4PSJ A;  4CNC A;  3C6P B;  1G9U A;  1PGV A;  2Z63 A;  4LSC A;  4FCG A;  3ZYN A;  3O6N A;  1XCD A;  2P1N B;  4EZG A;  2WFH A;  4LXS A;  3W3N A;  5AWC A;  3RW7 A;  4Z79 A;  3UL7 A;  1DFJ I;  2JE1 A;  4QBZ A;  5AWB A;  5GMF A;  1KOO A;  1U0N D;  2Z82 A;  2BNH A;  4MN8 B;  3E2J A;  4ECN A;  4RWT C;  4Z8G A;  3PMH G;  5GS2 B;  3CVR A;  3OGM B;  3RW6 A;  3M19 A;  3CIY A;  4R6J A;  4XOS A;  1ZIW A;  1XEC A;  4C2B B;  1P8T A;  2OMZ A;  3ZYI A;  4KT1 A;  1K5D C;  3O53 A;  3RGX A;  2ID5 A;  4GT6 A;  1W8A A;  4L3A A;  3RJ0 A;  2O6R A;  5D3I A;  4PER A;  4ARN A;  3P72 A;  2P1M B;  2RR6 A;  1D0B A;  5LFN A;  1OTN A;  5GMH A;  1A4Y A;  2R9U A;  4FMZ A;  4PEQ B;  5IYX C;  3WN4 A;  4R07 A;  2Z64 A;  4IM6 A;  4BSR A;  4TZH A;  2Y5Q A;  5GQR K;  1DS9 A;  5IJC A;  5B0T A;  4NKH A;  3VQ1 A;  2XWT C;  3RFS A;  5AWA A;  2XOT A;  3FXI A;  4R6A A;  2FT3 A;  3OJA A;  3WPE A;  2OMY A;  5GMG A;  2Z7X B;  3E4G A;  1SQ0 B;  4R58 A;  1H6U A;  2ASS B;  2IFG A;  4CP6 A;  3UL8 A;  3RFJ A;  4BSS A;  4ECO A;  3WPD A;  1FS2 A;  3RIZ A;  3RFE A;  4OQT A;  1XEU A;  3TSR E;  2OMW A;  3UN9 A;  4H09 A;  5AWD A;  4K17 A;  1FO1 A;  3ZYO A;  1A9N A;  3W3K A;  3G06 A;  2V9S A;  1FT8 A;  4GLP A;  1OOK G;  3C6O B;  5GS0 A;  1K5G C;  5HDH A;  1QYY A;  1OZN A;  4LSX C;  3ULU A;  1FQV A;  4LSX A;  3DZE A;  3W3G A;  5B4P A;  2WQW A;  4FDW A;  4P8S A;  1H6T A;  2Z65 A;  1O6S A;  4BSU A;  1M9L A;  4Y61 B;  1O6T A;  2WQU A;  2V70 A;  2Z66 A;  3WPC A;  4U7L A;  2O6S A;  1P9A G;  2OMX A;  4CIL A;  1WWL A;  4RCW A;  4CC4 C;  4PQ8 A;  4R08 A;  4J0M A;  3E6J A;  3SB4 A;  1M9S A;  3C6N B;  4QXE A;  3W3J A;  4AW4 A;  4QC0 A;  2P1Q B;  1M0Z A;  3BZ5 A;  4L3F A;  4Z61 C;  1KOH A;  4LI1 A;  2UZX A;  4UFR A;  4XGO A;  3OGL B;  1P8V A;  3WPF A;  2WQX A;  3M18 A;  4R6G A;  2OMU A;  4G8A A;  5CMN A;  4R6F A;  4KNG A;  2JQD A;  1Z7X W;  3CIG A;  4B8C D;  2A0Z A;  4R5D A;  4R0A A;  5IJB A;  5CMP A;  4I6J B;  3ULV A;  4U09 A;  1O6V A;  5FTT B;  2CA6 A;  4WP6 A;  4XSQ A;  2Z81 A;  4MQW X;  2P1P B;  4FS7 A;  3REZ A;  3KJ4 A;  4R5C A;  4KXF B;  4RCA B;  4WYK A;  2JE0 A;  2O6Q A;  3G3A A;  2UZY A;  1OGQ A;  2Z7X A;  3WPG A;  3G04 C;  4J4L A;  1OTO A;  4P91 A;  4Q3G A;  4ARR A;  4M7E C;  2WQV A;  4NKG A;  5A5C A;  3W3L A;  4PKI G;  4M7E A;  5HZL B;  4V2D A;  4R09 A;  1LTX A;  3G3B A;  3G39 A;  5IJD A;  3ULA A;  2Q4G W;  2Z62 A;  4U08 A;  3OJA B;  4AY9 X;  1XKU A;  4HQ1 A;  4CNM A;  5B0N A;  2P1O B;  4C2A B;  2BEX A;  4V2E A;  4Z94 G;  4LSA A;  3VQ2 A;  3W3M A;  3ZYJ A;  3RGZ A;  4FD0 A;  3WPI A;  2AST B;  4CC4 A;  1DCE A;  1GWB A;  2ELL A;  3WPH A;  3UL9 A;  3WPB A;  4Q62 A;  3OGK B;  4BV4 R;  1YRG A;  3JB9 j;  1XWD C;  1M10 B;  4U06 A;  4LI2 A;  2OMT A;  5AZ5 A;  4YEB B;  4V2C A; 
#chains in the Genus database with same CATH topology
 2RA8 A;  4Z64 C;  4LXR A;  2V9T B;  3A79 B;  3GOZ A;  1OTM A;  1JL5 A;  4Q3I A;  4FHO A;  3E3Z A;  1IO0 A;  2OMV A;  4PSJ A;  4CNC A;  3C6P B;  1G9U A;  1PGV A;  2Z63 A;  4LSC A;  4FCG A;  3ZYN A;  3O6N A;  1XCD A;  2P1N B;  4EZG A;  2WFH A;  4LXS A;  3W3N A;  5AWC A;  3RW7 A;  4Z79 A;  3UL7 A;  1DFJ I;  2JE1 A;  4QBZ A;  5AWB A;  5GMF A;  1KOO A;  1U0N D;  2Z82 A;  2BNH A;  4MN8 B;  3E2J A;  4ECN A;  4RWT C;  4Z8G A;  3PMH G;  5GS2 B;  3CVR A;  3OGM B;  3RW6 A;  3M19 A;  3CIY A;  4R6J A;  4XOS A;  1ZIW A;  1XEC A;  4C2B B;  1P8T A;  2OMZ A;  3ZYI A;  4KT1 A;  1K5D C;  3O53 A;  3RGX A;  2ID5 A;  4GT6 A;  1W8A A;  4L3A A;  3RJ0 A;  2O6R A;  5D3I A;  4PER A;  4ARN A;  3P72 A;  2P1M B;  2RR6 A;  1D0B A;  5LFN A;  1OTN A;  5GMH A;  1A4Y A;  2R9U A;  4FMZ A;  4PEQ B;  5IYX C;  3WN4 A;  4R07 A;  2Z64 A;  4IM6 A;  4BSR A;  4TZH A;  2Y5Q A;  5GQR K;  1DS9 A;  5IJC A;  5B0T A;  4NKH A;  3VQ1 A;  2XWT C;  3RFS A;  5AWA A;  2XOT A;  3FXI A;  4R6A A;  2FT3 A;  3OJA A;  3WPE A;  2OMY A;  5GMG A;  2Z7X B;  3E4G A;  1SQ0 B;  4R58 A;  1H6U A;  2ASS B;  2IFG A;  4CP6 A;  3UL8 A;  3RFJ A;  4BSS A;  4ECO A;  3WPD A;  1FS2 A;  3RIZ A;  3RFE A;  4OQT A;  1XEU A;  3TSR E;  2OMW A;  3UN9 A;  4H09 A;  5AWD A;  4K17 A;  1FO1 A;  3ZYO A;  1A9N A;  3W3K A;  3G06 A;  2V9S A;  1FT8 A;  4GLP A;  1OOK G;  3C6O B;  5GS0 A;  1K5G C;  5HDH A;  1QYY A;  1OZN A;  4LSX C;  3ULU A;  1FQV A;  4LSX A;  3DZE A;  3W3G A;  5B4P A;  2WQW A;  4FDW A;  4P8S A;  1H6T A;  2Z65 A;  1O6S A;  4BSU A;  1M9L A;  4Y61 B;  1O6T A;  2WQU A;  2V70 A;  2Z66 A;  3WPC A;  4U7L A;  2O6S A;  1P9A G;  2OMX A;  4CIL A;  1WWL A;  4RCW A;  4CC4 C;  4PQ8 A;  4R08 A;  4J0M A;  3E6J A;  3SB4 A;  1M9S A;  3C6N B;  4QXE A;  3W3J A;  4AW4 A;  4QC0 A;  2P1Q B;  1M0Z A;  3BZ5 A;  4L3F A;  4Z61 C;  1KOH A;  4LI1 A;  2UZX A;  4UFR A;  4XGO A;  3OGL B;  1P8V A;  3WPF A;  2WQX A;  3M18 A;  4R6G A;  2OMU A;  4G8A A;  5CMN A;  4R6F A;  4KNG A;  2JQD A;  1Z7X W;  3CIG A;  4B8C D;  2A0Z A;  4R5D A;  4R0A A;  5IJB A;  5CMP A;  4I6J B;  3ULV A;  4U09 A;  1O6V A;  5FTT B;  2CA6 A;  4WP6 A;  4XSQ A;  2Z81 A;  4MQW X;  2P1P B;  4FS7 A;  3REZ A;  3KJ4 A;  4R5C A;  4KXF B;  4RCA B;  4WYK A;  2JE0 A;  2O6Q A;  3G3A A;  2UZY A;  1OGQ A;  2Z7X A;  3WPG A;  3G04 C;  4J4L A;  1OTO A;  4P91 A;  4Q3G A;  4ARR A;  4M7E C;  2WQV A;  4NKG A;  5A5C A;  3W3L A;  4PKI G;  4M7E A;  5HZL B;  4V2D A;  4R09 A;  1LTX A;  3G3B A;  3G39 A;  5IJD A;  3ULA A;  2Q4G W;  2Z62 A;  4U08 A;  3OJA B;  4AY9 X;  1XKU A;  4HQ1 A;  4CNM A;  5B0N A;  2P1O B;  4C2A B;  2BEX A;  4V2E A;  4Z94 G;  4LSA A;  3VQ2 A;  3W3M A;  3ZYJ A;  3RGZ A;  4FD0 A;  3WPI A;  2AST B;  4CC4 A;  1DCE A;  4NZR M;  1GWB A;  2ELL A;  3WPH A;  4NZT M;  3UL9 A;  3WPB A;  4Q62 A;  3OGK B;  4BV4 R;  1YRG A;  3JB9 j;  1XWD C;  1M10 B;  4U06 A;  4LI2 A;  2OMT A;  5AZ5 A;  4YEB B;  4V2C A; 
#chains in the Genus database with same CATH homology
 2RA8 A;  4Z64 C;  4LXR A;  2V9T B;  3A79 B;  3GOZ A;  1OTM A;  1JL5 A;  4Q3I A;  4FHO A;  3E3Z A;  1IO0 A;  2OMV A;  4PSJ A;  4CNC A;  3C6P B;  1G9U A;  1PGV A;  2Z63 A;  4LSC A;  4FCG A;  3ZYN A;  3O6N A;  1XCD A;  2P1N B;  4EZG A;  2WFH A;  4LXS A;  3W3N A;  5AWC A;  3RW7 A;  4Z79 A;  3UL7 A;  1DFJ I;  2JE1 A;  4QBZ A;  5AWB A;  5GMF A;  1KOO A;  1U0N D;  2Z82 A;  2BNH A;  4MN8 B;  3E2J A;  4ECN A;  4RWT C;  4Z8G A;  3PMH G;  5GS2 B;  3CVR A;  3OGM B;  3RW6 A;  3M19 A;  3CIY A;  4R6J A;  4XOS A;  1ZIW A;  1XEC A;  4C2B B;  1P8T A;  2OMZ A;  3ZYI A;  4KT1 A;  1K5D C;  3O53 A;  3RGX A;  2ID5 A;  4GT6 A;  1W8A A;  4L3A A;  3RJ0 A;  2O6R A;  5D3I A;  4PER A;  4ARN A;  3P72 A;  2P1M B;  2RR6 A;  1D0B A;  5LFN A;  1OTN A;  5GMH A;  1A4Y A;  2R9U A;  4FMZ A;  4PEQ B;  5IYX C;  3WN4 A;  4R07 A;  2Z64 A;  4IM6 A;  4BSR A;  4TZH A;  2Y5Q A;  5GQR K;  1DS9 A;  5IJC A;  5B0T A;  4NKH A;  3VQ1 A;  2XWT C;  3RFS A;  5AWA A;  2XOT A;  3FXI A;  4R6A A;  2FT3 A;  3OJA A;  3WPE A;  2OMY A;  5GMG A;  2Z7X B;  3E4G A;  1SQ0 B;  4R58 A;  1H6U A;  2ASS B;  2IFG A;  4CP6 A;  3UL8 A;  3RFJ A;  4BSS A;  4ECO A;  3WPD A;  1FS2 A;  3RIZ A;  3RFE A;  4OQT A;  1XEU A;  3TSR E;  2OMW A;  3UN9 A;  4H09 A;  5AWD A;  4K17 A;  1FO1 A;  3ZYO A;  1A9N A;  3W3K A;  3G06 A;  2V9S A;  1FT8 A;  4GLP A;  1OOK G;  3C6O B;  5GS0 A;  1K5G C;  5HDH A;  1QYY A;  1OZN A;  4LSX C;  3ULU A;  1FQV A;  4LSX A;  3DZE A;  3W3G A;  5B4P A;  2WQW A;  4FDW A;  4P8S A;  1H6T A;  2Z65 A;  1O6S A;  4BSU A;  1M9L A;  4Y61 B;  1O6T A;  2WQU A;  2V70 A;  2Z66 A;  3WPC A;  4U7L A;  2O6S A;  1P9A G;  2OMX A;  4CIL A;  1WWL A;  4RCW A;  4CC4 C;  4PQ8 A;  4R08 A;  4J0M A;  3E6J A;  3SB4 A;  1M9S A;  3C6N B;  4QXE A;  3W3J A;  4AW4 A;  4QC0 A;  2P1Q B;  1M0Z A;  3BZ5 A;  4L3F A;  4Z61 C;  1KOH A;  4LI1 A;  2UZX A;  4UFR A;  4XGO A;  3OGL B;  1P8V A;  3WPF A;  2WQX A;  3M18 A;  4R6G A;  2OMU A;  4G8A A;  5CMN A;  4R6F A;  4KNG A;  2JQD A;  1Z7X W;  3CIG A;  4B8C D;  2A0Z A;  4R5D A;  4R0A A;  5IJB A;  5CMP A;  4I6J B;  3ULV A;  4U09 A;  1O6V A;  5FTT B;  2CA6 A;  4WP6 A;  4XSQ A;  2Z81 A;  4MQW X;  2P1P B;  4FS7 A;  3REZ A;  3KJ4 A;  4R5C A;  4KXF B;  4RCA B;  4WYK A;  2JE0 A;  2O6Q A;  3G3A A;  2UZY A;  1OGQ A;  2Z7X A;  3WPG A;  3G04 C;  4J4L A;  1OTO A;  4P91 A;  4Q3G A;  4ARR A;  4M7E C;  2WQV A;  4NKG A;  5A5C A;  3W3L A;  4PKI G;  4M7E A;  5HZL B;  4V2D A;  4R09 A;  1LTX A;  3G3B A;  3G39 A;  5IJD A;  3ULA A;  2Q4G W;  2Z62 A;  4U08 A;  3OJA B;  4AY9 X;  1XKU A;  4HQ1 A;  4CNM A;  5B0N A;  2P1O B;  4C2A B;  2BEX A;  4V2E A;  4Z94 G;  4LSA A;  3VQ2 A;  3W3M A;  3ZYJ A;  3RGZ A;  4FD0 A;  3WPI A;  2AST B;  4CC4 A;  1DCE A;  1GWB A;  2ELL A;  3WPH A;  3UL9 A;  3WPB A;  4Q62 A;  3OGK B;  4BV4 R;  1YRG A;  3JB9 j;  1XWD C;  1M10 B;  4U06 A;  4LI2 A;  2OMT A;  5AZ5 A;  4YEB B;  4V2C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...