2FT3A

Crystal structure of the biglycan dimer core protein
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
303
structure length
303
Chain Sequence
AMCPFGCHCHLRVVQCSDLGLKAVPKEISPDTTLLDLQNNDISELRKDDFKGLQHLYALVLVNNKISKIHEKAFSPLRKLQKLYISKNHLVEIPPNLPSSLVELRIHDNRIRKVPKGVFSGLRNMNCIEMGGNPLENSGFEPGAFDGLKLNYLRISEAKLTGIPKDLPETLNELHLDHNKIQAIELEDLLRYSKLYRLGLGHNQIRMIENGSLSFLPTLRELHLDNNKLSRVPAGLPDLKLLQVVYLHTNNITKVGVNDFCPVGFGVKRAYYNGISLFNNPVPYWEVQPATFRCVTDRLAIQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the Biglycan Dimer and Evidence That Dimerization Is Essential for Folding and Stability of Class I Small Leucine-rich Repeat Proteoglycans.
pubmed doi rcsb
molecule tags Structural protein, signaling protein
molecule keywords Biglycan
total genus 74
structure length 303
sequence length 303
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2006-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01462 LRRNT Leucine rich repeat N-terminal domain
A PF13855 LRR_8 Leucine rich repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 2ft3A00
4FMZA 4P8SA 4XGOA 4CILA 2OMYA 4FHOA 4PSJA 4LSXA 3DZEA 3WPEA 3RW7A 3W3LA 4R6GA 4CC4C 5IYXC 4R09A 3WPIA 1D0BA 3CIYA 3UN9A 3VQ2A 1XKUA 4LXSA 1FO1A 2OMWA 5GMHA 5AWAA 3RFEA 4LSCA 4M7EC 4R5CA 1M9SA 2UZYA 5CMNA 2UZXA 4Q3IA 4QBZA 1FS2A 1OTMA 4R5DA 1M10B 1H6TA 4RCWA 3ULVA 1OZNA 4IM6A 2JE0A 1DS9A 2ASTB 4NKGA 2P1PB 2O6SA 1P8VA 5LFNA 5GS0A 2O6QA 3P72A 5IJDA 3RJ0A 4H09A 4Z8GA 1W8AA 4Z64C 4CP6A 2Q4GW 4ECNA 3G3AA 2FT3A 4R6FA 3UL9A 4ARNA 4CC4A 5B0NA 1A4YA 1WWLA 4R6JA 4PEQB 4ECOA 1FQVA 1P9AG 1M0ZA 1YRGA 3CVRA 4C2AB 4J4LA 3W3NA 3RIZA 3E6JA 3O53A 2JE1A 4GT6A 4V2DA 3CIGA 1O6TA 1XCDA 4K17A 5IJBA 2WQUA 4TZHA 3ULUA 2OMVA 4U7LA 1G9UA 4HQ1A 3C6OB 3FXIA 2RR6A 4L3FA 4I6JB 5D3IA 3M19A 4YEBB 4KNGA 5HDHA 3W3KA 3W3GA 4QC0A 2Z65A 5GMGA 2OMXA 3BZ5A 3RFSA 4BSRA 1PGVA 3REZA 4LXRA 3WN4A 2Z82A 4BSUA 4R07A 3M18A 1IO0A 3A79B 1M9LA 5GMFA 1Z7XW 3OGLB 3JB9j 4P91A 2V9SA 3W3MA 3RGZA 4ARRA 3WPGA 5CMPA 3C6PB 1K5DC 3O6NA 1LTXA 4RCAB 4WP6A 4Y61B 4BV4R 4FDWA 4EZGA 4FS7A 4LSAA 1ZIWA 1DCEA 2Z62A 3OJAB 1OTNA 3ULAA 1KOOA 1O6VA 2WFHA 2Z63A 4R58A 2OMTA 4FD0A 4MQWX 5HZLB 3UL7A 3ZYNA 2Z66A 4C2BB 2Z7XB 3G06A 3OGKB 1XEUA 2CA6A 4FCGA 4KT1A 4NKHA 4V2EA 4AY9X 1K5GC 1O6SA 5IJCA 2P1OB 2A0ZA 3RGXA 1FT8A 1A9NA 2Z64A 5FTTB 3G39A 4WYKA 4L3AA 3ZYIA 3E2JA 5AWCA 4GLPA 1OTOA 5B0TA 5AWBA 1SQ0B 4PERA 1OOKG 2BEXA 2RA8A 4Q3GA 4G8AA 3RW6A 4LI1A 2ELLA 3WPBA 3ZYJA 4CNMA 4PQ8A 1P8TA 2WQWA 4J0MA 4Z61C 4Z79A 4BSSA 4KXFB 3UL8A 4Q62A 1OGQA 1U0ND 3KJ4A 3OGMB 4QXEA 5B4PA 5AWDA 3C6NB 5GQRK 2XOTA 5A5CA 4R0AA 2WQVA 3PMHG 2P1QB 3G04C 3WPFA 5AZ5A 4LI2A 1JL5A 4AW4A 4LSXC 4RWTC 2WQXA 3E4GA 1GWBA 2O6RA 2JQDA 3E3ZA 4U09A 3ZYOA 4PKIG 3RFJA 4U06A 3WPDA 5GS2B 3SB4A 3G3BA 4R6AA 1H6UA 4V2CA 4CNCA 2P1MB 4B8CD 4XOSA 2OMZA 3WPCA 1QYYA 3OJAA 4R08A 3TSRE 2Z81A 4MN8B 4M7EA 2ASSB 4XSQA 2ID5A 1XECA 4OQTA 2Y5QA 4U08A 4UFRA 2OMUA 2V70A 1KOHA 1XWDC 2BNHA 2R9UA 2Z7XA 4Z94G 3VQ1A 3W3JA 1DFJI 2XWTC 3GOZA 3WPHA 2IFGA 2V9TB 2P1NB
chains in the Genus database with same CATH superfamily
4FMZA 4P8SA 4XGOA 4CILA 2OMYA 4FHOA 4NZTM 4PSJA 3DZEA 4LSXA 3RW7A 3W3LA 4R6GA 4CC4C 5IYXC 4R09A 3WPIA 1D0BA 3CIYA 3UN9A 3VQ2A 1XKUA 4LXSA 1FO1A 2OMWA 5GMHA 5AWAA 3RFEA 4LSCA 4M7EC 4R5CA 1M9SA 2UZYA 5CMNA 2UZXA 4Q3IA 4QBZA 1FS2A 1OTMA 4R5DA 1M10B 1H6TA 4RCWA 3ULVA 1OZNA 4IM6A 2JE0A 1DS9A 2ASTB 4NKGA 2P1PB 2O6SA 1P8VA 5LFNA 5GS0A 2O6QA 3P72A 5IJDA 3RJ0A 4H09A 4Z8GA 1W8AA 4Z64C 4CP6A 2Q4GW 4ECNA 3G3AA 2FT3A 4R6FA 3UL9A 4ARNA 4CC4A 5B0NA 1A4YA 1WWLA 4R6JA 4PEQB 4ECOA 1FQVA 1P9AG 1M0ZA 1YRGA 3CVRA 4C2AB 3WPEA 4J4LA 3W3NA 3RIZA 3E6JA 3O53A 2JE1A 4GT6A 4V2DA 3CIGA 1O6TA 1XCDA 4K17A 5IJBA 2WQUA 4TZHA 3ULUA 2OMVA 4U7LA 1G9UA 4HQ1A 3C6OB 3FXIA 2RR6A 4L3FA 4I6JB 5D3IA 3M19A 4YEBB 4KNGA 5HDHA 3W3KA 3W3GA 4QC0A 2Z65A 5GMGA 2OMXA 3BZ5A 3RFSA 4BSRA 1PGVA 3REZA 4LXRA 3WN4A 2Z82A 4BSUA 4R07A 3M18A 1IO0A 3A79B 1M9LA 5GMFA 1Z7XW 3OGLB 3JB9j 4P91A 2V9SA 3W3MA 3RGZA 4ARRA 3WPGA 5CMPA 3C6PB 1K5DC 3O6NA 1LTXA 4RCAB 4WP6A 4Y61B 4BV4R 4FDWA 4EZGA 4FS7A 4LSAA 1ZIWA 1DCEA 2Z62A 3OJAB 1OTNA 3ULAA 1KOOA 1O6VA 2WFHA 2Z63A 4R58A 2OMTA 4FD0A 4MQWX 5HZLB 3UL7A 3ZYNA 2Z66A 4C2BB 2Z7XB 3G06A 3OGKB 1XEUA 2CA6A 4FCGA 4KT1A 4NKHA 4V2EA 4AY9X 1K5GC 1O6SA 5IJCA 2P1OB 2A0ZA 3RGXA 1FT8A 1A9NA 2Z64A 5FTTB 3G39A 4WYKA 4L3AA 3ZYIA 3E2JA 5AWCA 4GLPA 1OTOA 5B0TA 5AWBA 1SQ0B 4PERA 1OOKG 2BEXA 2RA8A 4Q3GA 4G8AA 3RW6A 4LI1A 2ELLA 3WPBA 3ZYJA 4CNMA 4PQ8A 1P8TA 2WQWA 4J0MA 4Z61C 4Z79A 4BSSA 4KXFB 3UL8A 4Q62A 1OGQA 1U0ND 3KJ4A 3OGMB 4QXEA 5B4PA 5AWDA 3C6NB 5GQRK 2XOTA 5A5CA 4R0AA 2WQVA 3PMHG 2P1QB 3G04C 3WPFA 5AZ5A 4LI2A 1JL5A 4AW4A 4LSXC 4RWTC 2WQXA 3E4GA 1GWBA 2O6RA 2JQDA 3E3ZA 4U09A 3ZYOA 4PKIG 3RFJA 4U06A 3WPDA 5GS2B 3SB4A 3G3BA 4NZRM 4R6AA 1H6UA 4V2CA 4CNCA 2P1MB 4B8CD 4XOSA 2OMZA 3WPCA 1QYYA 3OJAA 4R08A 3TSRE 2Z81A 4MN8B 4M7EA 2ASSB 4XSQA 2ID5A 1XECA 4OQTA 2Y5QA 4U08A 4UFRA 2OMUA 2V70A 1KOHA 1XWDC 2BNHA 2R9UA 2Z7XA 4Z94G 3VQ1A 3W3JA 1DFJI 2XWTC 3GOZA 3WPHA 2IFGA 2V9TB 2P1NB
chains in the Genus database with same CATH topology
4FMZA 4P8SA 4XGOA 4CILA 2OMYA 4FHOA 4PSJA 4LSXA 3DZEA 3WPEA 3RW7A 3W3LA 4R6GA 4CC4C 5IYXC 4R09A 3WPIA 1D0BA 3CIYA 3UN9A 3VQ2A 1XKUA 4LXSA 1FO1A 2OMWA 5GMHA 5AWAA 3RFEA 4LSCA 4M7EC 4R5CA 1M9SA 2UZYA 5CMNA 2UZXA 4Q3IA 4QBZA 1FS2A 1OTMA 4R5DA 1M10B 1H6TA 4RCWA 3ULVA 1OZNA 4IM6A 2JE0A 1DS9A 2ASTB 4NKGA 2P1PB 2O6SA 1P8VA 5LFNA 5GS0A 2O6QA 3P72A 5IJDA 3RJ0A 4H09A 4Z8GA 1W8AA 4Z64C 4CP6A 2Q4GW 4ECNA 3G3AA 2FT3A 4R6FA 3UL9A 4ARNA 4CC4A 5B0NA 1A4YA 1WWLA 4R6JA 4PEQB 4ECOA 1FQVA 1P9AG 1M0ZA 1YRGA 3CVRA 4C2AB 4J4LA 3W3NA 3RIZA 3E6JA 3O53A 2JE1A 4GT6A 4V2DA 3CIGA 1O6TA 1XCDA 4K17A 5IJBA 2WQUA 4TZHA 3ULUA 2OMVA 4U7LA 1G9UA 4HQ1A 3C6OB 3FXIA 2RR6A 4L3FA 4I6JB 5D3IA 3M19A 4YEBB 4KNGA 5HDHA 3W3KA 3W3GA 4QC0A 2Z65A 5GMGA 2OMXA 3BZ5A 3RFSA 4BSRA 1PGVA 3REZA 4LXRA 3WN4A 2Z82A 4BSUA 4R07A 3M18A 1IO0A 3A79B 1M9LA 5GMFA 1Z7XW 3OGLB 3JB9j 4P91A 2V9SA 3W3MA 3RGZA 4ARRA 3WPGA 5CMPA 3C6PB 1K5DC 3O6NA 1LTXA 4RCAB 4WP6A 4Y61B 4BV4R 4FDWA 4EZGA 4FS7A 4LSAA 1ZIWA 1DCEA 2Z62A 3OJAB 1OTNA 3ULAA 1KOOA 1O6VA 2WFHA 2Z63A 4R58A 2OMTA 4FD0A 4MQWX 5HZLB 3UL7A 3ZYNA 2Z66A 4C2BB 2Z7XB 3G06A 3OGKB 1XEUA 2CA6A 4FCGA 4KT1A 4NKHA 4V2EA 4AY9X 1K5GC 1O6SA 5IJCA 2P1OB 2A0ZA 3RGXA 1FT8A 1A9NA 2Z64A 5FTTB 3G39A 4WYKA 4L3AA 3ZYIA 3E2JA 5AWCA 4GLPA 1OTOA 5B0TA 5AWBA 1SQ0B 4PERA 1OOKG 2BEXA 2RA8A 4Q3GA 4G8AA 3RW6A 4LI1A 2ELLA 3WPBA 3ZYJA 4CNMA 4PQ8A 1P8TA 2WQWA 4J0MA 4Z61C 4Z79A 4BSSA 4KXFB 3UL8A 4Q62A 1OGQA 1U0ND 3KJ4A 3OGMB 4QXEA 5B4PA 5AWDA 3C6NB 5GQRK 2XOTA 5A5CA 4R0AA 2WQVA 3PMHG 2P1QB 3G04C 3WPFA 5AZ5A 4LI2A 1JL5A 4AW4A 4LSXC 4RWTC 2WQXA 3E4GA 1GWBA 2O6RA 2JQDA 3E3ZA 4U09A 3ZYOA 4PKIG 3RFJA 4U06A 3WPDA 5GS2B 3SB4A 3G3BA 4R6AA 1H6UA 4V2CA 4CNCA 2P1MB 4B8CD 4XOSA 2OMZA 3WPCA 1QYYA 3OJAA 4R08A 3TSRE 2Z81A 4MN8B 4M7EA 2ASSB 4XSQA 2ID5A 1XECA 4OQTA 2Y5QA 4U08A 4UFRA 2OMUA 2V70A 1KOHA 1XWDC 2BNHA 2R9UA 2Z7XA 4Z94G 3VQ1A 3W3JA 1DFJI 2XWTC 3GOZA 3WPHA 2IFGA 2V9TB 2P1NB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FMZ A;  4P8S A;  4XGO A;  4CIL A;  2OMY A;  4FHO A;  4PSJ A;  4LSX A;  3DZE A;  3WPE A;  3RW7 A;  3W3L A;  4R6G A;  4CC4 C;  5IYX C;  4R09 A;  3WPI A;  1D0B A;  3CIY A;  3UN9 A;  3VQ2 A;  1XKU A;  4LXS A;  1FO1 A;  2OMW A;  5GMH A;  5AWA A;  3RFE A;  4LSC A;  4M7E C;  4R5C A;  1M9S A;  2UZY A;  5CMN A;  2UZX A;  4Q3I A;  4QBZ A;  1FS2 A;  1OTM A;  4R5D A;  1M10 B;  1H6T A;  4RCW A;  3ULV A;  1OZN A;  4IM6 A;  2JE0 A;  1DS9 A;  2AST B;  4NKG A;  2P1P B;  2O6S A;  1P8V A;  5LFN A;  5GS0 A;  2O6Q A;  3P72 A;  5IJD A;  3RJ0 A;  4H09 A;  4Z8G A;  1W8A A;  4Z64 C;  4CP6 A;  2Q4G W;  4ECN A;  3G3A A;  2FT3 A;  4R6F A;  3UL9 A;  4ARN A;  4CC4 A;  5B0N A;  1A4Y A;  1WWL A;  4R6J A;  4PEQ B;  4ECO A;  1FQV A;  1P9A G;  1M0Z A;  1YRG A;  3CVR A;  4C2A B;  4J4L A;  3W3N A;  3RIZ A;  3E6J A;  3O53 A;  2JE1 A;  4GT6 A;  4V2D A;  3CIG A;  1O6T A;  1XCD A;  4K17 A;  5IJB A;  2WQU A;  4TZH A;  3ULU A;  2OMV A;  4U7L A;  1G9U A;  4HQ1 A;  3C6O B;  3FXI A;  2RR6 A;  4L3F A;  4I6J B;  5D3I A;  3M19 A;  4YEB B;  4KNG A;  5HDH A;  3W3K A;  3W3G A;  4QC0 A;  2Z65 A;  5GMG A;  2OMX A;  3BZ5 A;  3RFS A;  4BSR A;  1PGV A;  3REZ A;  4LXR A;  3WN4 A;  2Z82 A;  4BSU A;  4R07 A;  3M18 A;  1IO0 A;  3A79 B;  1M9L A;  5GMF A;  1Z7X W;  3OGL B;  3JB9 j;  4P91 A;  2V9S A;  3W3M A;  3RGZ A;  4ARR A;  3WPG A;  5CMP A;  3C6P B;  1K5D C;  3O6N A;  1LTX A;  4RCA B;  4WP6 A;  4Y61 B;  4BV4 R;  4FDW A;  4EZG A;  4FS7 A;  4LSA A;  1ZIW A;  1DCE A;  2Z62 A;  3OJA B;  1OTN A;  3ULA A;  1KOO A;  1O6V A;  2WFH A;  2Z63 A;  4R58 A;  2OMT A;  4FD0 A;  4MQW X;  5HZL B;  3UL7 A;  3ZYN A;  2Z66 A;  4C2B B;  2Z7X B;  3G06 A;  3OGK B;  1XEU A;  2CA6 A;  4FCG A;  4KT1 A;  4NKH A;  4V2E A;  4AY9 X;  1K5G C;  1O6S A;  5IJC A;  2P1O B;  2A0Z A;  3RGX A;  1FT8 A;  1A9N A;  2Z64 A;  5FTT B;  3G39 A;  4WYK A;  4L3A A;  3ZYI A;  3E2J A;  5AWC A;  4GLP A;  1OTO A;  5B0T A;  5AWB A;  1SQ0 B;  4PER A;  1OOK G;  2BEX A;  2RA8 A;  4Q3G A;  4G8A A;  3RW6 A;  4LI1 A;  2ELL A;  3WPB A;  3ZYJ A;  4CNM A;  4PQ8 A;  1P8T A;  2WQW A;  4J0M A;  4Z61 C;  4Z79 A;  4BSS A;  4KXF B;  3UL8 A;  4Q62 A;  1OGQ A;  1U0N D;  3KJ4 A;  3OGM B;  4QXE A;  5B4P A;  5AWD A;  3C6N B;  5GQR K;  2XOT A;  5A5C A;  4R0A A;  2WQV A;  3PMH G;  2P1Q B;  3G04 C;  3WPF A;  5AZ5 A;  4LI2 A;  1JL5 A;  4AW4 A;  4LSX C;  4RWT C;  2WQX A;  3E4G A;  1GWB A;  2O6R A;  2JQD A;  3E3Z A;  4U09 A;  3ZYO A;  4PKI G;  3RFJ A;  4U06 A;  3WPD A;  5GS2 B;  3SB4 A;  3G3B A;  4R6A A;  1H6U A;  4V2C A;  4CNC A;  2P1M B;  4B8C D;  4XOS A;  2OMZ A;  3WPC A;  1QYY A;  3OJA A;  4R08 A;  3TSR E;  2Z81 A;  4MN8 B;  4M7E A;  2ASS B;  4XSQ A;  2ID5 A;  1XEC A;  4OQT A;  2Y5Q A;  4U08 A;  4UFR A;  2OMU A;  2V70 A;  1KOH A;  1XWD C;  2BNH A;  2R9U A;  2Z7X A;  4Z94 G;  3VQ1 A;  3W3J A;  1DFJ I;  2XWT C;  3GOZ A;  3WPH A;  2IFG A;  2V9T B;  2P1N B; 
#chains in the Genus database with same CATH topology
 4FMZ A;  4P8S A;  4XGO A;  4CIL A;  2OMY A;  4FHO A;  4NZT M;  4PSJ A;  3DZE A;  4LSX A;  3RW7 A;  3W3L A;  4R6G A;  4CC4 C;  5IYX C;  4R09 A;  3WPI A;  1D0B A;  3CIY A;  3UN9 A;  3VQ2 A;  1XKU A;  4LXS A;  1FO1 A;  2OMW A;  5GMH A;  5AWA A;  3RFE A;  4LSC A;  4M7E C;  4R5C A;  1M9S A;  2UZY A;  5CMN A;  2UZX A;  4Q3I A;  4QBZ A;  1FS2 A;  1OTM A;  4R5D A;  1M10 B;  1H6T A;  4RCW A;  3ULV A;  1OZN A;  4IM6 A;  2JE0 A;  1DS9 A;  2AST B;  4NKG A;  2P1P B;  2O6S A;  1P8V A;  5LFN A;  5GS0 A;  2O6Q A;  3P72 A;  5IJD A;  3RJ0 A;  4H09 A;  4Z8G A;  1W8A A;  4Z64 C;  4CP6 A;  2Q4G W;  4ECN A;  3G3A A;  2FT3 A;  4R6F A;  3UL9 A;  4ARN A;  4CC4 A;  5B0N A;  1A4Y A;  1WWL A;  4R6J A;  4PEQ B;  4ECO A;  1FQV A;  1P9A G;  1M0Z A;  1YRG A;  3CVR A;  4C2A B;  3WPE A;  4J4L A;  3W3N A;  3RIZ A;  3E6J A;  3O53 A;  2JE1 A;  4GT6 A;  4V2D A;  3CIG A;  1O6T A;  1XCD A;  4K17 A;  5IJB A;  2WQU A;  4TZH A;  3ULU A;  2OMV A;  4U7L A;  1G9U A;  4HQ1 A;  3C6O B;  3FXI A;  2RR6 A;  4L3F A;  4I6J B;  5D3I A;  3M19 A;  4YEB B;  4KNG A;  5HDH A;  3W3K A;  3W3G A;  4QC0 A;  2Z65 A;  5GMG A;  2OMX A;  3BZ5 A;  3RFS A;  4BSR A;  1PGV A;  3REZ A;  4LXR A;  3WN4 A;  2Z82 A;  4BSU A;  4R07 A;  3M18 A;  1IO0 A;  3A79 B;  1M9L A;  5GMF A;  1Z7X W;  3OGL B;  3JB9 j;  4P91 A;  2V9S A;  3W3M A;  3RGZ A;  4ARR A;  3WPG A;  5CMP A;  3C6P B;  1K5D C;  3O6N A;  1LTX A;  4RCA B;  4WP6 A;  4Y61 B;  4BV4 R;  4FDW A;  4EZG A;  4FS7 A;  4LSA A;  1ZIW A;  1DCE A;  2Z62 A;  3OJA B;  1OTN A;  3ULA A;  1KOO A;  1O6V A;  2WFH A;  2Z63 A;  4R58 A;  2OMT A;  4FD0 A;  4MQW X;  5HZL B;  3UL7 A;  3ZYN A;  2Z66 A;  4C2B B;  2Z7X B;  3G06 A;  3OGK B;  1XEU A;  2CA6 A;  4FCG A;  4KT1 A;  4NKH A;  4V2E A;  4AY9 X;  1K5G C;  1O6S A;  5IJC A;  2P1O B;  2A0Z A;  3RGX A;  1FT8 A;  1A9N A;  2Z64 A;  5FTT B;  3G39 A;  4WYK A;  4L3A A;  3ZYI A;  3E2J A;  5AWC A;  4GLP A;  1OTO A;  5B0T A;  5AWB A;  1SQ0 B;  4PER A;  1OOK G;  2BEX A;  2RA8 A;  4Q3G A;  4G8A A;  3RW6 A;  4LI1 A;  2ELL A;  3WPB A;  3ZYJ A;  4CNM A;  4PQ8 A;  1P8T A;  2WQW A;  4J0M A;  4Z61 C;  4Z79 A;  4BSS A;  4KXF B;  3UL8 A;  4Q62 A;  1OGQ A;  1U0N D;  3KJ4 A;  3OGM B;  4QXE A;  5B4P A;  5AWD A;  3C6N B;  5GQR K;  2XOT A;  5A5C A;  4R0A A;  2WQV A;  3PMH G;  2P1Q B;  3G04 C;  3WPF A;  5AZ5 A;  4LI2 A;  1JL5 A;  4AW4 A;  4LSX C;  4RWT C;  2WQX A;  3E4G A;  1GWB A;  2O6R A;  2JQD A;  3E3Z A;  4U09 A;  3ZYO A;  4PKI G;  3RFJ A;  4U06 A;  3WPD A;  5GS2 B;  3SB4 A;  3G3B A;  4NZR M;  4R6A A;  1H6U A;  4V2C A;  4CNC A;  2P1M B;  4B8C D;  4XOS A;  2OMZ A;  3WPC A;  1QYY A;  3OJA A;  4R08 A;  3TSR E;  2Z81 A;  4MN8 B;  4M7E A;  2ASS B;  4XSQ A;  2ID5 A;  1XEC A;  4OQT A;  2Y5Q A;  4U08 A;  4UFR A;  2OMU A;  2V70 A;  1KOH A;  1XWD C;  2BNH A;  2R9U A;  2Z7X A;  4Z94 G;  3VQ1 A;  3W3J A;  1DFJ I;  2XWT C;  3GOZ A;  3WPH A;  2IFG A;  2V9T B;  2P1N B; 
#chains in the Genus database with same CATH homology
 4FMZ A;  4P8S A;  4XGO A;  4CIL A;  2OMY A;  4FHO A;  4PSJ A;  4LSX A;  3DZE A;  3WPE A;  3RW7 A;  3W3L A;  4R6G A;  4CC4 C;  5IYX C;  4R09 A;  3WPI A;  1D0B A;  3CIY A;  3UN9 A;  3VQ2 A;  1XKU A;  4LXS A;  1FO1 A;  2OMW A;  5GMH A;  5AWA A;  3RFE A;  4LSC A;  4M7E C;  4R5C A;  1M9S A;  2UZY A;  5CMN A;  2UZX A;  4Q3I A;  4QBZ A;  1FS2 A;  1OTM A;  4R5D A;  1M10 B;  1H6T A;  4RCW A;  3ULV A;  1OZN A;  4IM6 A;  2JE0 A;  1DS9 A;  2AST B;  4NKG A;  2P1P B;  2O6S A;  1P8V A;  5LFN A;  5GS0 A;  2O6Q A;  3P72 A;  5IJD A;  3RJ0 A;  4H09 A;  4Z8G A;  1W8A A;  4Z64 C;  4CP6 A;  2Q4G W;  4ECN A;  3G3A A;  2FT3 A;  4R6F A;  3UL9 A;  4ARN A;  4CC4 A;  5B0N A;  1A4Y A;  1WWL A;  4R6J A;  4PEQ B;  4ECO A;  1FQV A;  1P9A G;  1M0Z A;  1YRG A;  3CVR A;  4C2A B;  4J4L A;  3W3N A;  3RIZ A;  3E6J A;  3O53 A;  2JE1 A;  4GT6 A;  4V2D A;  3CIG A;  1O6T A;  1XCD A;  4K17 A;  5IJB A;  2WQU A;  4TZH A;  3ULU A;  2OMV A;  4U7L A;  1G9U A;  4HQ1 A;  3C6O B;  3FXI A;  2RR6 A;  4L3F A;  4I6J B;  5D3I A;  3M19 A;  4YEB B;  4KNG A;  5HDH A;  3W3K A;  3W3G A;  4QC0 A;  2Z65 A;  5GMG A;  2OMX A;  3BZ5 A;  3RFS A;  4BSR A;  1PGV A;  3REZ A;  4LXR A;  3WN4 A;  2Z82 A;  4BSU A;  4R07 A;  3M18 A;  1IO0 A;  3A79 B;  1M9L A;  5GMF A;  1Z7X W;  3OGL B;  3JB9 j;  4P91 A;  2V9S A;  3W3M A;  3RGZ A;  4ARR A;  3WPG A;  5CMP A;  3C6P B;  1K5D C;  3O6N A;  1LTX A;  4RCA B;  4WP6 A;  4Y61 B;  4BV4 R;  4FDW A;  4EZG A;  4FS7 A;  4LSA A;  1ZIW A;  1DCE A;  2Z62 A;  3OJA B;  1OTN A;  3ULA A;  1KOO A;  1O6V A;  2WFH A;  2Z63 A;  4R58 A;  2OMT A;  4FD0 A;  4MQW X;  5HZL B;  3UL7 A;  3ZYN A;  2Z66 A;  4C2B B;  2Z7X B;  3G06 A;  3OGK B;  1XEU A;  2CA6 A;  4FCG A;  4KT1 A;  4NKH A;  4V2E A;  4AY9 X;  1K5G C;  1O6S A;  5IJC A;  2P1O B;  2A0Z A;  3RGX A;  1FT8 A;  1A9N A;  2Z64 A;  5FTT B;  3G39 A;  4WYK A;  4L3A A;  3ZYI A;  3E2J A;  5AWC A;  4GLP A;  1OTO A;  5B0T A;  5AWB A;  1SQ0 B;  4PER A;  1OOK G;  2BEX A;  2RA8 A;  4Q3G A;  4G8A A;  3RW6 A;  4LI1 A;  2ELL A;  3WPB A;  3ZYJ A;  4CNM A;  4PQ8 A;  1P8T A;  2WQW A;  4J0M A;  4Z61 C;  4Z79 A;  4BSS A;  4KXF B;  3UL8 A;  4Q62 A;  1OGQ A;  1U0N D;  3KJ4 A;  3OGM B;  4QXE A;  5B4P A;  5AWD A;  3C6N B;  5GQR K;  2XOT A;  5A5C A;  4R0A A;  2WQV A;  3PMH G;  2P1Q B;  3G04 C;  3WPF A;  5AZ5 A;  4LI2 A;  1JL5 A;  4AW4 A;  4LSX C;  4RWT C;  2WQX A;  3E4G A;  1GWB A;  2O6R A;  2JQD A;  3E3Z A;  4U09 A;  3ZYO A;  4PKI G;  3RFJ A;  4U06 A;  3WPD A;  5GS2 B;  3SB4 A;  3G3B A;  4R6A A;  1H6U A;  4V2C A;  4CNC A;  2P1M B;  4B8C D;  4XOS A;  2OMZ A;  3WPC A;  1QYY A;  3OJA A;  4R08 A;  3TSR E;  2Z81 A;  4MN8 B;  4M7E A;  2ASS B;  4XSQ A;  2ID5 A;  1XEC A;  4OQT A;  2Y5Q A;  4U08 A;  4UFR A;  2OMU A;  2V70 A;  1KOH A;  1XWD C;  2BNH A;  2R9U A;  2Z7X A;  4Z94 G;  3VQ1 A;  3W3J A;  1DFJ I;  2XWT C;  3GOZ A;  3WPH A;  2IFG A;  2V9T B;  2P1N B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...