2FT3A

Crystal structure of the biglycan dimer core protein
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
303
structure length
303
Chain Sequence
AMCPFGCHCHLRVVQCSDLGLKAVPKEISPDTTLLDLQNNDISELRKDDFKGLQHLYALVLVNNKISKIHEKAFSPLRKLQKLYISKNHLVEIPPNLPSSLVELRIHDNRIRKVPKGVFSGLRNMNCIEMGGNPLENSGFEPGAFDGLKLNYLRISEAKLTGIPKDLPETLNELHLDHNKIQAIELEDLLRYSKLYRLGLGHNQIRMIENGSLSFLPTLRELHLDNNKLSRVPAGLPDLKLLQVVYLHTNNITKVGVNDFCPVGFGVKRAYYNGISLFNNPVPYWEVQPATFRCVTDRLAIQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein, signaling protein
molecule keywords Biglycan
publication title Crystal Structure of the Biglycan Dimer and Evidence That Dimerization Is Essential for Folding and Stability of Class I Small Leucine-rich Repeat Proteoglycans.
pubmed doi rcsb
total genus 74
structure length 303
sequence length 303
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2006-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01462 LRRNT Leucine rich repeat N-terminal domain
A PF13855 LRR_8 Leucine rich repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 2ft3A00
1KOOA 1OTNA 5HZLB 3RJ0A 4EZGA 3CIGA 1WWLA 3UL7A 4G8AA 4WYKA 5AWAA 3G3BA 3ZYOA 4LSAA 3JB9j 3C6PB 3RIZA 2XWTC 4R5DA 4MN8B 4PQ8A 1YRGA 4Z94G 5AZ5A 4U7LA 5B0TA 2O6QA 2Y5QA 3WPHA 2Z7XB 2O6RA 4CC4A 5A5CA 4IM6A 4FMZA 5GS0A 4C2AB 4R08A 2CA6A 3RFSA 3OJAB 3RW6A 4AY9X 2WQWA 2RA8A 2UZXA 4L3AA 1O6VA 1U0ND 3RFEA 5AWBA 2O6SA 1A4YA 3O6NA 4RCAB 4M7EA 4RWTC 2OMUA 3WPCA 2Z63A 1IO0A 3A79B 2JE0A 4K17A 4PKIG 4Z8GA 2Z81A 4PEQB 2V70A 3OJAA 1XKUA 4KXFB 4Q62A 1O6TA 4LXRA 5HDHA 1P8VA 4I6JB 3G3AA 2P1NB 1P8TA 4V2CA 3VQ2A 4ARNA 2A0ZA 3WPGA 4AW4A 3M19A 4KNGA 5GS2B 4QC0A 4C2BB 4R58A 3E3ZA 5D3IA 3W3LA 4XSQA 1H6TA 3UL9A 1FO1A 1XCDA 3G39A 4CNMA 2ID5A 4LI1A 3TSRE 2FT3A 3RGZA 4QXEA 4XOSA 3CVRA 4MQWX 1M9LA 1FQVA 1DFJI 4R5CA 4RCWA 3ULUA 4R6FA 4V2DA 1DCEA 4R0AA 4R07A 1OOKG 1GWBA 4BSSA 5LFNA 2WQXA 4R09A 1LTXA 4FCGA 5GQRK 5B0NA 2V9SA 2ASTB 2OMXA 1H6UA 2JQDA 4P91A 3RW7A 3ZYJA 3M18A 3FXIA 2P1QB 4NKGA 3CIYA 1M9SA 1OZNA 2IFGA 2RR6A 4R6GA 5AWDA 5IJBA 4H09A 3DZEA 4R6JA 1K5DC 4BSRA 2BEXA 4TZHA 1K5GC 4BV4R 4Z64C 2Z7XA 3E4GA 1P9AG 4LXSA 4FS7A 3GOZA 1SQ0B 3UN9A 4Z61C 1A9NA 4FD0A 1M0ZA 1OGQA 2ELLA 3WPFA 3OGMB 4HQ1A 4LSCA 3REZA 3W3MA 3ULAA 4ARRA 4CILA 1XECA 5FTTB 2OMZA 2P1PB 3WPIA 4XGOA 4Y61B 4R6AA 2WFHA 4CNCA 4Q3IA 4U08A 3C6NB 2JE1A 2OMWA 3W3NA 4LSXC 4ECOA 1JL5A 5GMHA 4NKHA 4U06A 2Z62A 3W3KA 4V2EA 2Z66A 2WQVA 3OGLB 1W8AA 1PGVA 4UFRA 5GMFA 4FHOA 3E2JA 3RGXA 2UZYA 3W3GA 1XWDC 3WPDA 1FS2A 4LI2A 3W3JA 3OGKB 4L3FA 5AWCA 1KOHA 4FDWA 4PERA 2Z65A 1D0BA 3RFJA 4GT6A 3PMHG 4PSJA 5CMNA 4QBZA 3WPBA 5GMGA 2P1OB 1XEUA 3O53A 4Z79A 3ZYIA 3P72A 5IYXC 4CC4C 2V9TB 1FT8A 3WPEA 3G06A 2Z82A 4U09A 3SB4A 4WP6A 2OMVA 5IJDA 2Q4GW 4M7EC 2ASSB 2WQUA 3UL8A 2XOTA 2Z64A 3C6OB 2OMTA 5B4PA 5CMPA 3ULVA 4J0MA 2R9UA 4Q3GA 3E6JA 3G04C 1QYYA 1Z7XW 3BZ5A 1G9UA 5IJCA 3KJ4A 4KT1A 4CP6A 3VQ1A 4BSUA 1OTOA 4OQTA 3WN4A 4YEBB 2BNHA 1M10B 4GLPA 2OMYA 1DS9A 4P8SA 1ZIWA 1O6SA 2P1MB 4LSXA 3ZYNA 1OTMA 4B8CD 4J4LA 4ECNA
chains in the Genus database with same CATH superfamily
1KOOA 1OTNA 5HZLB 3RJ0A 4EZGA 3CIGA 1WWLA 3UL7A 4G8AA 4WYKA 5AWAA 3G3BA 3ZYOA 4LSAA 3JB9j 3C6PB 3RIZA 2XWTC 4R5DA 4MN8B 4PQ8A 1YRGA 4Z94G 5AZ5A 4U7LA 5B0TA 2O6QA 2Y5QA 3WPHA 2Z7XB 2O6RA 4CC4A 5A5CA 4IM6A 4FMZA 5GS0A 4C2AB 4R08A 2CA6A 3RFSA 3OJAB 3RW6A 4AY9X 2WQWA 2RA8A 2UZXA 4L3AA 1O6VA 1U0ND 3RFEA 5AWBA 2O6SA 1A4YA 3O6NA 4RCAB 4M7EA 4RWTC 2OMUA 3WPCA 2Z63A 1IO0A 3A79B 2JE0A 4K17A 4PKIG 4Z8GA 2Z81A 4PEQB 2V70A 3OJAA 1XKUA 4KXFB 4Q62A 1O6TA 4LXRA 5HDHA 1P8VA 4I6JB 3G3AA 2P1NB 1P8TA 4V2CA 3VQ2A 4ARNA 2A0ZA 3WPGA 4AW4A 3M19A 4KNGA 5GS2B 4QC0A 4C2BB 4R58A 3E3ZA 5D3IA 3W3LA 4XSQA 4NZTM 1H6TA 3UL9A 1FO1A 1XCDA 3G39A 4CNMA 2ID5A 4LI1A 3TSRE 4NZRM 2FT3A 3RGZA 4QXEA 4XOSA 3CVRA 4MQWX 1M9LA 1FQVA 1DFJI 4R5CA 4RCWA 3ULUA 4R6FA 4V2DA 1DCEA 4R0AA 4R07A 1OOKG 1GWBA 4BSSA 5LFNA 2WQXA 4R09A 1LTXA 4FCGA 5GQRK 5B0NA 2V9SA 2ASTB 2OMXA 1H6UA 2JQDA 4P91A 3RW7A 3ZYJA 3M18A 3FXIA 2P1QB 4NKGA 3CIYA 1M9SA 1OZNA 2IFGA 2RR6A 4R6GA 5AWDA 5IJBA 4H09A 3DZEA 4R6JA 1K5DC 4BSRA 2BEXA 4TZHA 1K5GC 4BV4R 4Z64C 2Z7XA 3E4GA 1P9AG 4LXSA 4FS7A 3GOZA 1SQ0B 3UN9A 4Z61C 1A9NA 4FD0A 1M0ZA 1OGQA 2ELLA 3WPFA 3OGMB 4HQ1A 4LSCA 3REZA 3W3MA 3ULAA 4ARRA 4CILA 1XECA 5FTTB 2OMZA 2P1PB 3WPIA 4XGOA 4Y61B 4R6AA 2WFHA 4CNCA 4Q3IA 4U08A 3C6NB 2JE1A 2OMWA 3W3NA 4LSXC 4ECOA 1JL5A 5GMHA 4NKHA 4U06A 2Z62A 3W3KA 4V2EA 2Z66A 2WQVA 3OGLB 1W8AA 1PGVA 4UFRA 5GMFA 4FHOA 3E2JA 3RGXA 2UZYA 3W3GA 1XWDC 3WPDA 1FS2A 4LI2A 3W3JA 3OGKB 4L3FA 5AWCA 1KOHA 4FDWA 4PERA 2Z65A 1D0BA 3RFJA 4GT6A 3PMHG 4PSJA 5CMNA 4QBZA 3WPBA 5GMGA 2P1OB 1XEUA 3O53A 4Z79A 3ZYIA 3P72A 5IYXC 4CC4C 2V9TB 1FT8A 3WPEA 3G06A 2Z82A 4U09A 3SB4A 4WP6A 2OMVA 5IJDA 2Q4GW 4M7EC 2ASSB 2WQUA 3UL8A 2XOTA 2Z64A 3C6OB 2OMTA 5B4PA 5CMPA 3ULVA 4J0MA 2R9UA 4Q3GA 3E6JA 3G04C 1QYYA 1Z7XW 3BZ5A 1G9UA 5IJCA 3KJ4A 4KT1A 4CP6A 3VQ1A 4BSUA 1OTOA 4OQTA 3WN4A 4YEBB 2BNHA 1M10B 4GLPA 2OMYA 1DS9A 4P8SA 1ZIWA 1O6SA 2P1MB 4LSXA 3ZYNA 1OTMA 4B8CD 4J4LA 4ECNA
chains in the Genus database with same CATH topology
1KOOA 1OTNA 5HZLB 3RJ0A 4EZGA 3CIGA 1WWLA 3UL7A 4G8AA 4WYKA 5AWAA 3G3BA 3ZYOA 4LSAA 3JB9j 3C6PB 3RIZA 2XWTC 4R5DA 4MN8B 4PQ8A 1YRGA 4Z94G 5AZ5A 4U7LA 5B0TA 2O6QA 2Y5QA 3WPHA 2Z7XB 2O6RA 4CC4A 5A5CA 4IM6A 4FMZA 5GS0A 4C2AB 4R08A 2CA6A 3RFSA 3OJAB 3RW6A 4AY9X 2WQWA 2RA8A 2UZXA 4L3AA 1O6VA 1U0ND 3RFEA 5AWBA 2O6SA 1A4YA 3O6NA 4RCAB 4M7EA 4RWTC 2OMUA 3WPCA 2Z63A 1IO0A 3A79B 2JE0A 4K17A 4PKIG 4Z8GA 2Z81A 4PEQB 2V70A 3OJAA 1XKUA 4KXFB 4Q62A 1O6TA 4LXRA 5HDHA 1P8VA 4I6JB 3G3AA 2P1NB 1P8TA 4V2CA 3VQ2A 4ARNA 2A0ZA 3WPGA 4AW4A 3M19A 4KNGA 5GS2B 4QC0A 4C2BB 4R58A 3E3ZA 5D3IA 3W3LA 4XSQA 1H6TA 3UL9A 1FO1A 1XCDA 3G39A 4CNMA 2ID5A 4LI1A 3TSRE 2FT3A 3RGZA 4QXEA 4XOSA 3CVRA 4MQWX 1M9LA 1FQVA 1DFJI 4R5CA 4RCWA 3ULUA 4R6FA 4V2DA 1DCEA 4R0AA 4R07A 1OOKG 1GWBA 4BSSA 5LFNA 2WQXA 4R09A 1LTXA 4FCGA 5GQRK 5B0NA 2V9SA 2ASTB 2OMXA 1H6UA 2JQDA 4P91A 3RW7A 3ZYJA 3M18A 3FXIA 2P1QB 4NKGA 3CIYA 1M9SA 1OZNA 2IFGA 2RR6A 4R6GA 5AWDA 5IJBA 4H09A 3DZEA 4R6JA 1K5DC 4BSRA 2BEXA 4TZHA 1K5GC 4BV4R 4Z64C 2Z7XA 3E4GA 1P9AG 4LXSA 4FS7A 3GOZA 1SQ0B 3UN9A 4Z61C 1A9NA 4FD0A 1M0ZA 1OGQA 2ELLA 3WPFA 3OGMB 4HQ1A 4LSCA 3REZA 3W3MA 3ULAA 4ARRA 4CILA 1XECA 5FTTB 2OMZA 2P1PB 3WPIA 4XGOA 4Y61B 4R6AA 2WFHA 4CNCA 4Q3IA 4U08A 3C6NB 2JE1A 2OMWA 3W3NA 4LSXC 4ECOA 1JL5A 5GMHA 4NKHA 4U06A 2Z62A 3W3KA 4V2EA 2Z66A 2WQVA 3OGLB 1W8AA 1PGVA 4UFRA 5GMFA 4FHOA 3E2JA 3RGXA 2UZYA 3W3GA 1XWDC 3WPDA 1FS2A 4LI2A 3W3JA 3OGKB 4L3FA 5AWCA 1KOHA 4FDWA 4PERA 2Z65A 1D0BA 3RFJA 4GT6A 3PMHG 4PSJA 5CMNA 4QBZA 3WPBA 5GMGA 2P1OB 1XEUA 3O53A 4Z79A 3ZYIA 3P72A 5IYXC 4CC4C 2V9TB 1FT8A 3WPEA 3G06A 2Z82A 4U09A 3SB4A 4WP6A 2OMVA 5IJDA 2Q4GW 4M7EC 2ASSB 2WQUA 3UL8A 2XOTA 2Z64A 3C6OB 2OMTA 5B4PA 5CMPA 3ULVA 4J0MA 2R9UA 4Q3GA 3E6JA 3G04C 1QYYA 1Z7XW 3BZ5A 1G9UA 5IJCA 3KJ4A 4KT1A 4CP6A 3VQ1A 4BSUA 1OTOA 4OQTA 3WN4A 4YEBB 2BNHA 1M10B 4GLPA 2OMYA 1DS9A 4P8SA 1ZIWA 1O6SA 2P1MB 4LSXA 3ZYNA 1OTMA 4B8CD 4J4LA 4ECNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KOO A;  1OTN A;  5HZL B;  3RJ0 A;  4EZG A;  3CIG A;  1WWL A;  3UL7 A;  4G8A A;  4WYK A;  5AWA A;  3G3B A;  3ZYO A;  4LSA A;  3JB9 j;  3C6P B;  3RIZ A;  2XWT C;  4R5D A;  4MN8 B;  4PQ8 A;  1YRG A;  4Z94 G;  5AZ5 A;  4U7L A;  5B0T A;  2O6Q A;  2Y5Q A;  3WPH A;  2Z7X B;  2O6R A;  4CC4 A;  5A5C A;  4IM6 A;  4FMZ A;  5GS0 A;  4C2A B;  4R08 A;  2CA6 A;  3RFS A;  3OJA B;  3RW6 A;  4AY9 X;  2WQW A;  2RA8 A;  2UZX A;  4L3A A;  1O6V A;  1U0N D;  3RFE A;  5AWB A;  2O6S A;  1A4Y A;  3O6N A;  4RCA B;  4M7E A;  4RWT C;  2OMU A;  3WPC A;  2Z63 A;  1IO0 A;  3A79 B;  2JE0 A;  4K17 A;  4PKI G;  4Z8G A;  2Z81 A;  4PEQ B;  2V70 A;  3OJA A;  1XKU A;  4KXF B;  4Q62 A;  1O6T A;  4LXR A;  5HDH A;  1P8V A;  4I6J B;  3G3A A;  2P1N B;  1P8T A;  4V2C A;  3VQ2 A;  4ARN A;  2A0Z A;  3WPG A;  4AW4 A;  3M19 A;  4KNG A;  5GS2 B;  4QC0 A;  4C2B B;  4R58 A;  3E3Z A;  5D3I A;  3W3L A;  4XSQ A;  1H6T A;  3UL9 A;  1FO1 A;  1XCD A;  3G39 A;  4CNM A;  2ID5 A;  4LI1 A;  3TSR E;  2FT3 A;  3RGZ A;  4QXE A;  4XOS A;  3CVR A;  4MQW X;  1M9L A;  1FQV A;  1DFJ I;  4R5C A;  4RCW A;  3ULU A;  4R6F A;  4V2D A;  1DCE A;  4R0A A;  4R07 A;  1OOK G;  1GWB A;  4BSS A;  5LFN A;  2WQX A;  4R09 A;  1LTX A;  4FCG A;  5GQR K;  5B0N A;  2V9S A;  2AST B;  2OMX A;  1H6U A;  2JQD A;  4P91 A;  3RW7 A;  3ZYJ A;  3M18 A;  3FXI A;  2P1Q B;  4NKG A;  3CIY A;  1M9S A;  1OZN A;  2IFG A;  2RR6 A;  4R6G A;  5AWD A;  5IJB A;  4H09 A;  3DZE A;  4R6J A;  1K5D C;  4BSR A;  2BEX A;  4TZH A;  1K5G C;  4BV4 R;  4Z64 C;  2Z7X A;  3E4G A;  1P9A G;  4LXS A;  4FS7 A;  3GOZ A;  1SQ0 B;  3UN9 A;  4Z61 C;  1A9N A;  4FD0 A;  1M0Z A;  1OGQ A;  2ELL A;  3WPF A;  3OGM B;  4HQ1 A;  4LSC A;  3REZ A;  3W3M A;  3ULA A;  4ARR A;  4CIL A;  1XEC A;  5FTT B;  2OMZ A;  2P1P B;  3WPI A;  4XGO A;  4Y61 B;  4R6A A;  2WFH A;  4CNC A;  4Q3I A;  4U08 A;  3C6N B;  2JE1 A;  2OMW A;  3W3N A;  4LSX C;  4ECO A;  1JL5 A;  5GMH A;  4NKH A;  4U06 A;  2Z62 A;  3W3K A;  4V2E A;  2Z66 A;  2WQV A;  3OGL B;  1W8A A;  1PGV A;  4UFR A;  5GMF A;  4FHO A;  3E2J A;  3RGX A;  2UZY A;  3W3G A;  1XWD C;  3WPD A;  1FS2 A;  4LI2 A;  3W3J A;  3OGK B;  4L3F A;  5AWC A;  1KOH A;  4FDW A;  4PER A;  2Z65 A;  1D0B A;  3RFJ A;  4GT6 A;  3PMH G;  4PSJ A;  5CMN A;  4QBZ A;  3WPB A;  5GMG A;  2P1O B;  1XEU A;  3O53 A;  4Z79 A;  3ZYI A;  3P72 A;  5IYX C;  4CC4 C;  2V9T B;  1FT8 A;  3WPE A;  3G06 A;  2Z82 A;  4U09 A;  3SB4 A;  4WP6 A;  2OMV A;  5IJD A;  2Q4G W;  4M7E C;  2ASS B;  2WQU A;  3UL8 A;  2XOT A;  2Z64 A;  3C6O B;  2OMT A;  5B4P A;  5CMP A;  3ULV A;  4J0M A;  2R9U A;  4Q3G A;  3E6J A;  3G04 C;  1QYY A;  1Z7X W;  3BZ5 A;  1G9U A;  5IJC A;  3KJ4 A;  4KT1 A;  4CP6 A;  3VQ1 A;  4BSU A;  1OTO A;  4OQT A;  3WN4 A;  4YEB B;  2BNH A;  1M10 B;  4GLP A;  2OMY A;  1DS9 A;  4P8S A;  1ZIW A;  1O6S A;  2P1M B;  4LSX A;  3ZYN A;  1OTM A;  4B8C D;  4J4L A;  4ECN A; 
#chains in the Genus database with same CATH topology
 1KOO A;  1OTN A;  5HZL B;  3RJ0 A;  4EZG A;  3CIG A;  1WWL A;  3UL7 A;  4G8A A;  4WYK A;  5AWA A;  3G3B A;  3ZYO A;  4LSA A;  3JB9 j;  3C6P B;  3RIZ A;  2XWT C;  4R5D A;  4MN8 B;  4PQ8 A;  1YRG A;  4Z94 G;  5AZ5 A;  4U7L A;  5B0T A;  2O6Q A;  2Y5Q A;  3WPH A;  2Z7X B;  2O6R A;  4CC4 A;  5A5C A;  4IM6 A;  4FMZ A;  5GS0 A;  4C2A B;  4R08 A;  2CA6 A;  3RFS A;  3OJA B;  3RW6 A;  4AY9 X;  2WQW A;  2RA8 A;  2UZX A;  4L3A A;  1O6V A;  1U0N D;  3RFE A;  5AWB A;  2O6S A;  1A4Y A;  3O6N A;  4RCA B;  4M7E A;  4RWT C;  2OMU A;  3WPC A;  2Z63 A;  1IO0 A;  3A79 B;  2JE0 A;  4K17 A;  4PKI G;  4Z8G A;  2Z81 A;  4PEQ B;  2V70 A;  3OJA A;  1XKU A;  4KXF B;  4Q62 A;  1O6T A;  4LXR A;  5HDH A;  1P8V A;  4I6J B;  3G3A A;  2P1N B;  1P8T A;  4V2C A;  3VQ2 A;  4ARN A;  2A0Z A;  3WPG A;  4AW4 A;  3M19 A;  4KNG A;  5GS2 B;  4QC0 A;  4C2B B;  4R58 A;  3E3Z A;  5D3I A;  3W3L A;  4XSQ A;  4NZT M;  1H6T A;  3UL9 A;  1FO1 A;  1XCD A;  3G39 A;  4CNM A;  2ID5 A;  4LI1 A;  3TSR E;  4NZR M;  2FT3 A;  3RGZ A;  4QXE A;  4XOS A;  3CVR A;  4MQW X;  1M9L A;  1FQV A;  1DFJ I;  4R5C A;  4RCW A;  3ULU A;  4R6F A;  4V2D A;  1DCE A;  4R0A A;  4R07 A;  1OOK G;  1GWB A;  4BSS A;  5LFN A;  2WQX A;  4R09 A;  1LTX A;  4FCG A;  5GQR K;  5B0N A;  2V9S A;  2AST B;  2OMX A;  1H6U A;  2JQD A;  4P91 A;  3RW7 A;  3ZYJ A;  3M18 A;  3FXI A;  2P1Q B;  4NKG A;  3CIY A;  1M9S A;  1OZN A;  2IFG A;  2RR6 A;  4R6G A;  5AWD A;  5IJB A;  4H09 A;  3DZE A;  4R6J A;  1K5D C;  4BSR A;  2BEX A;  4TZH A;  1K5G C;  4BV4 R;  4Z64 C;  2Z7X A;  3E4G A;  1P9A G;  4LXS A;  4FS7 A;  3GOZ A;  1SQ0 B;  3UN9 A;  4Z61 C;  1A9N A;  4FD0 A;  1M0Z A;  1OGQ A;  2ELL A;  3WPF A;  3OGM B;  4HQ1 A;  4LSC A;  3REZ A;  3W3M A;  3ULA A;  4ARR A;  4CIL A;  1XEC A;  5FTT B;  2OMZ A;  2P1P B;  3WPI A;  4XGO A;  4Y61 B;  4R6A A;  2WFH A;  4CNC A;  4Q3I A;  4U08 A;  3C6N B;  2JE1 A;  2OMW A;  3W3N A;  4LSX C;  4ECO A;  1JL5 A;  5GMH A;  4NKH A;  4U06 A;  2Z62 A;  3W3K A;  4V2E A;  2Z66 A;  2WQV A;  3OGL B;  1W8A A;  1PGV A;  4UFR A;  5GMF A;  4FHO A;  3E2J A;  3RGX A;  2UZY A;  3W3G A;  1XWD C;  3WPD A;  1FS2 A;  4LI2 A;  3W3J A;  3OGK B;  4L3F A;  5AWC A;  1KOH A;  4FDW A;  4PER A;  2Z65 A;  1D0B A;  3RFJ A;  4GT6 A;  3PMH G;  4PSJ A;  5CMN A;  4QBZ A;  3WPB A;  5GMG A;  2P1O B;  1XEU A;  3O53 A;  4Z79 A;  3ZYI A;  3P72 A;  5IYX C;  4CC4 C;  2V9T B;  1FT8 A;  3WPE A;  3G06 A;  2Z82 A;  4U09 A;  3SB4 A;  4WP6 A;  2OMV A;  5IJD A;  2Q4G W;  4M7E C;  2ASS B;  2WQU A;  3UL8 A;  2XOT A;  2Z64 A;  3C6O B;  2OMT A;  5B4P A;  5CMP A;  3ULV A;  4J0M A;  2R9U A;  4Q3G A;  3E6J A;  3G04 C;  1QYY A;  1Z7X W;  3BZ5 A;  1G9U A;  5IJC A;  3KJ4 A;  4KT1 A;  4CP6 A;  3VQ1 A;  4BSU A;  1OTO A;  4OQT A;  3WN4 A;  4YEB B;  2BNH A;  1M10 B;  4GLP A;  2OMY A;  1DS9 A;  4P8S A;  1ZIW A;  1O6S A;  2P1M B;  4LSX A;  3ZYN A;  1OTM A;  4B8C D;  4J4L A;  4ECN A; 
#chains in the Genus database with same CATH homology
 1KOO A;  1OTN A;  5HZL B;  3RJ0 A;  4EZG A;  3CIG A;  1WWL A;  3UL7 A;  4G8A A;  4WYK A;  5AWA A;  3G3B A;  3ZYO A;  4LSA A;  3JB9 j;  3C6P B;  3RIZ A;  2XWT C;  4R5D A;  4MN8 B;  4PQ8 A;  1YRG A;  4Z94 G;  5AZ5 A;  4U7L A;  5B0T A;  2O6Q A;  2Y5Q A;  3WPH A;  2Z7X B;  2O6R A;  4CC4 A;  5A5C A;  4IM6 A;  4FMZ A;  5GS0 A;  4C2A B;  4R08 A;  2CA6 A;  3RFS A;  3OJA B;  3RW6 A;  4AY9 X;  2WQW A;  2RA8 A;  2UZX A;  4L3A A;  1O6V A;  1U0N D;  3RFE A;  5AWB A;  2O6S A;  1A4Y A;  3O6N A;  4RCA B;  4M7E A;  4RWT C;  2OMU A;  3WPC A;  2Z63 A;  1IO0 A;  3A79 B;  2JE0 A;  4K17 A;  4PKI G;  4Z8G A;  2Z81 A;  4PEQ B;  2V70 A;  3OJA A;  1XKU A;  4KXF B;  4Q62 A;  1O6T A;  4LXR A;  5HDH A;  1P8V A;  4I6J B;  3G3A A;  2P1N B;  1P8T A;  4V2C A;  3VQ2 A;  4ARN A;  2A0Z A;  3WPG A;  4AW4 A;  3M19 A;  4KNG A;  5GS2 B;  4QC0 A;  4C2B B;  4R58 A;  3E3Z A;  5D3I A;  3W3L A;  4XSQ A;  1H6T A;  3UL9 A;  1FO1 A;  1XCD A;  3G39 A;  4CNM A;  2ID5 A;  4LI1 A;  3TSR E;  2FT3 A;  3RGZ A;  4QXE A;  4XOS A;  3CVR A;  4MQW X;  1M9L A;  1FQV A;  1DFJ I;  4R5C A;  4RCW A;  3ULU A;  4R6F A;  4V2D A;  1DCE A;  4R0A A;  4R07 A;  1OOK G;  1GWB A;  4BSS A;  5LFN A;  2WQX A;  4R09 A;  1LTX A;  4FCG A;  5GQR K;  5B0N A;  2V9S A;  2AST B;  2OMX A;  1H6U A;  2JQD A;  4P91 A;  3RW7 A;  3ZYJ A;  3M18 A;  3FXI A;  2P1Q B;  4NKG A;  3CIY A;  1M9S A;  1OZN A;  2IFG A;  2RR6 A;  4R6G A;  5AWD A;  5IJB A;  4H09 A;  3DZE A;  4R6J A;  1K5D C;  4BSR A;  2BEX A;  4TZH A;  1K5G C;  4BV4 R;  4Z64 C;  2Z7X A;  3E4G A;  1P9A G;  4LXS A;  4FS7 A;  3GOZ A;  1SQ0 B;  3UN9 A;  4Z61 C;  1A9N A;  4FD0 A;  1M0Z A;  1OGQ A;  2ELL A;  3WPF A;  3OGM B;  4HQ1 A;  4LSC A;  3REZ A;  3W3M A;  3ULA A;  4ARR A;  4CIL A;  1XEC A;  5FTT B;  2OMZ A;  2P1P B;  3WPI A;  4XGO A;  4Y61 B;  4R6A A;  2WFH A;  4CNC A;  4Q3I A;  4U08 A;  3C6N B;  2JE1 A;  2OMW A;  3W3N A;  4LSX C;  4ECO A;  1JL5 A;  5GMH A;  4NKH A;  4U06 A;  2Z62 A;  3W3K A;  4V2E A;  2Z66 A;  2WQV A;  3OGL B;  1W8A A;  1PGV A;  4UFR A;  5GMF A;  4FHO A;  3E2J A;  3RGX A;  2UZY A;  3W3G A;  1XWD C;  3WPD A;  1FS2 A;  4LI2 A;  3W3J A;  3OGK B;  4L3F A;  5AWC A;  1KOH A;  4FDW A;  4PER A;  2Z65 A;  1D0B A;  3RFJ A;  4GT6 A;  3PMH G;  4PSJ A;  5CMN A;  4QBZ A;  3WPB A;  5GMG A;  2P1O B;  1XEU A;  3O53 A;  4Z79 A;  3ZYI A;  3P72 A;  5IYX C;  4CC4 C;  2V9T B;  1FT8 A;  3WPE A;  3G06 A;  2Z82 A;  4U09 A;  3SB4 A;  4WP6 A;  2OMV A;  5IJD A;  2Q4G W;  4M7E C;  2ASS B;  2WQU A;  3UL8 A;  2XOT A;  2Z64 A;  3C6O B;  2OMT A;  5B4P A;  5CMP A;  3ULV A;  4J0M A;  2R9U A;  4Q3G A;  3E6J A;  3G04 C;  1QYY A;  1Z7X W;  3BZ5 A;  1G9U A;  5IJC A;  3KJ4 A;  4KT1 A;  4CP6 A;  3VQ1 A;  4BSU A;  1OTO A;  4OQT A;  3WN4 A;  4YEB B;  2BNH A;  1M10 B;  4GLP A;  2OMY A;  1DS9 A;  4P8S A;  1ZIW A;  1O6S A;  2P1M B;  4LSX A;  3ZYN A;  1OTM A;  4B8C D;  4J4L A;  4ECN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...