1M10B

Crystal structure of the complex of glycoprotein ib alpha and the von willebrand factor a1 domain
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
267
structure length
267
Chain Sequence
HPICEVSKVASHLEVNCDKRQLTALPPDLPKDTTILHLSENLLYTFSLATLMPYTRLTQLNLDRCELTKLQVDGTLPVLGTLDLSHNQLQSLPLLGQTLPALTVLDVSFNRLTSLPLGALRGLGELQELYLKGNELKTLPPGLLTPTPKLEKLSLANNQLTELPAGLLNGLENLDTLLLQENSLYTIPKGFFGSHLLPFAFLHGNPWLCNCEILYFRRWLQDNAENVYVWKQGVDVKAVTSNVASVQCDNSDKFPVYKYPGKGCPTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Blood clotting
molecule keywords von Willebrand Factor
publication title Structures of glycoprotein Ibalpha and its complex with von Willebrand factor A1 domain.
pubmed doi rcsb
source organism Homo sapiens
total genus 66
structure length 267
sequence length 267
ec nomenclature
pdb deposition date 2002-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01462 LRRNT Leucine rich repeat N-terminal domain
B PF13855 LRR_8 Leucine rich repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 1m10B00
2P1MB 4QC0A 5GQRK 1IO0A 1LTXA 1XEUA 3BZ5A 2O6SA 4AW4A 3OJAB 1P9AG 1A9NA 4WYKA 5GMHA 4P8SA 5IJCA 1U0ND 3REZA 1M9SA 1P8TA 1O6TA 2ELLA 3RFJA 5GS2B 4YEBB 4AY9X 3KJ4A 3M19A 4BV4R 3WPDA 3UL9A 3G3AA 2WFHA 4NKGA 1DS9A 4IM6A 4CC4A 3E4GA 4V2CA 5HZLB 4FMZA 1XWDC 1OTMA 3G06A 4LSCA 1H6UA 5AWDA 2R9UA 4R6AA 3WPBA 5AWBA 1FT8A 3TSRE 3WPCA 4XGOA 4P91A 1OTNA 1OTOA 2P1QB 1JL5A 2Z7XB 5AWCA 4CNMA 5LFNA 5B0TA 4R08A 3W3LA 3UN9A 2OMUA 3RGXA 4LI1A 2O6QA 3ULAA 1XKUA 3VQ1A 4FS7A 3ZYNA 3W3KA 5GS0A 2Z65A 3O6NA 1KOOA 4V2EA 4U06A 1YRGA 2RR6A 5CMPA 1OGQA 4V2DA 2P1OB 4U7LA 4M7EA 5IYXC 4XOSA 4Q3IA 3G3BA 4Z79A 1QYYA 3RFEA 4Q3GA 3ULUA 4LSXC 3E2JA 2Z81A 5FTTB 3UL7A 1XECA 2JQDA 3VQ2A 1O6SA 2WQWA 2XOTA 2Z62A 3OGKB 4PQ8A 5B0NA 1XCDA 3W3MA 1DFJI 4KNGA 4TZHA 2JE1A 4GLPA 3E6JA 4PEQB 2UZYA 5IJBA 3P72A 3O53A 5CMNA 1O6VA 4LSAA 1WWLA 1PGVA 2Q4GW 3ULVA 4K17A 3C6PB 2RA8A 3DZEA 2V9SA 1K5DC 4RWTC 4I6JB 3PMHG 4L3FA 3OJAA 4CNCA 3WN4A 2OMXA 3WPEA 2XWTC 1SQ0B 4EZGA 1FO1A 1OOKG 3OGLB 2Z63A 5B4PA 4H09A 1M0ZA 1G9UA 4BSSA 4HQ1A 3WPHA 4L3AA 3RW7A 3RIZA 2P1PB 1FS2A 3WPFA 5A5CA 4R58A 4ECNA 2JE0A 3RJ0A 4PSJA 1K5GC 4BSRA 4Z64C 3ZYOA 4XSQA 4R0AA 2BNHA 3M18A 3CIGA 3RW6A 5AZ5A 4FCGA 2ASSB 2Z7XA 1M10B 5GMGA 5HDHA 4R5DA 1KOHA 2OMZA 4LI2A 3CVRA 4KXFB 4C2AB 1FQVA 3OGMB 4R6JA 4MN8B 4LXSA 4Z61C 4FD0A 3RFSA 4R6GA 4WP6A 4PERA 4M7EC 4GT6A 3ZYJA 4J4LA 1P8VA 2Z82A 1M9LA 3W3GA 5GMFA 4ARRA 4U09A 3ZYIA 3WPGA 2WQVA 4B8CD 4CP6A 3FXIA 5IJDA 4J0MA 1D0BA 4KT1A 4U08A 3JB9j 2V9TB 2ID5A 2WQUA 1Z7XW 4Z8GA 2CA6A 2UZXA 2WQXA 4ARNA 2A0ZA 4CILA 4PKIG 4ECOA 3C6OB 3G39A 1W8AA 3C6NB 4FHOA 2IFGA 2ASTB 3SB4A 1A4YA 2FT3A 4CC4C 2O6RA 4Y61B 3G04C 2V70A 1ZIWA 2OMWA 4NKHA 4FDWA 4G8AA 2OMVA 4BSUA 3UL8A 4QXEA 4RCAB 4MQWX 4OQTA 5AWAA 3W3NA 4LSXA 2P1NB 4Z94G 2OMYA 4RCWA 2Z64A 3CIYA 3E3ZA 5D3IA 3WPIA 2OMTA 3W3JA 4R6FA 4UFRA 1DCEA 4Q62A 2Z66A 4LXRA 1GWBA 4C2BB 2BEXA 2Y5QA 4R5CA 3A79B 4QBZA 4R07A 4R09A 3RGZA 3GOZA 1OZNA 1H6TA
chains in the Genus database with same CATH superfamily
2P1MB 4QC0A 5GQRK 1IO0A 1LTXA 1XEUA 3BZ5A 2O6SA 4AW4A 3OJAB 1P9AG 1A9NA 4WYKA 5GMHA 4P8SA 5IJCA 1U0ND 3REZA 4NZTM 1M9SA 1P8TA 1O6TA 2ELLA 3RFJA 5GS2B 4YEBB 4AY9X 3KJ4A 3M19A 4BV4R 3WPDA 3UL9A 3G3AA 2WFHA 4NKGA 1DS9A 4IM6A 4CC4A 3E4GA 4V2CA 5HZLB 4FMZA 1XWDC 1OTMA 3G06A 4LSCA 1H6UA 5AWDA 2R9UA 4R6AA 3WPBA 5AWBA 1FT8A 3TSRE 3WPCA 4XGOA 4P91A 1OTNA 1OTOA 2P1QB 1JL5A 2Z7XB 5AWCA 4CNMA 5LFNA 5B0TA 4R08A 3W3LA 3UN9A 2OMUA 3RGXA 4LI1A 2O6QA 3ULAA 1XKUA 3VQ1A 4FS7A 3ZYNA 3W3KA 5GS0A 2Z65A 3O6NA 1KOOA 4V2EA 4U06A 1YRGA 2RR6A 5CMPA 1OGQA 4V2DA 2P1OB 4U7LA 4M7EA 5IYXC 4XOSA 4Q3IA 3G3BA 4Z79A 1QYYA 3RFEA 4Q3GA 3ULUA 4LSXC 3E2JA 2Z81A 5FTTB 3UL7A 1XECA 2JQDA 3VQ2A 1O6SA 2WQWA 2XOTA 2Z62A 3OGKB 4PQ8A 5B0NA 1XCDA 3W3MA 1DFJI 4KNGA 4TZHA 2JE1A 4GLPA 3E6JA 4PEQB 2UZYA 5IJBA 3P72A 3O53A 5CMNA 1O6VA 4LSAA 1WWLA 1PGVA 2Q4GW 3ULVA 4K17A 3C6PB 2RA8A 3DZEA 2V9SA 1K5DC 4RWTC 4I6JB 3PMHG 4L3FA 3OJAA 4CNCA 3WN4A 2OMXA 3WPEA 2XWTC 1SQ0B 4EZGA 1FO1A 1OOKG 3OGLB 2Z63A 5B4PA 4H09A 1M0ZA 1G9UA 4BSSA 4HQ1A 3WPHA 4L3AA 3RW7A 3RIZA 2P1PB 1FS2A 3WPFA 5A5CA 4R58A 4ECNA 2JE0A 3RJ0A 4PSJA 1K5GC 4BSRA 4Z64C 3ZYOA 4XSQA 4R0AA 2BNHA 3M18A 3CIGA 3RW6A 5AZ5A 4FCGA 2ASSB 2Z7XA 1M10B 5GMGA 5HDHA 4R5DA 1KOHA 2OMZA 4LI2A 3CVRA 4KXFB 4C2AB 1FQVA 3OGMB 4R6JA 4MN8B 4LXSA 4Z61C 4FD0A 3RFSA 4R6GA 4WP6A 4PERA 4M7EC 4GT6A 3ZYJA 4J4LA 1P8VA 2Z82A 1M9LA 3W3GA 5GMFA 4ARRA 4U09A 3ZYIA 3WPGA 2WQVA 4B8CD 4CP6A 3FXIA 5IJDA 4J0MA 1D0BA 4KT1A 4U08A 3JB9j 2V9TB 2ID5A 2WQUA 1Z7XW 4Z8GA 2CA6A 2UZXA 2WQXA 4ARNA 2A0ZA 4CILA 4PKIG 4ECOA 3C6OB 3G39A 1W8AA 3C6NB 4FHOA 2IFGA 2ASTB 3SB4A 1A4YA 2FT3A 4CC4C 2O6RA 4Y61B 3G04C 2V70A 1ZIWA 2OMWA 4NKHA 4FDWA 4G8AA 2OMVA 4BSUA 3UL8A 4QXEA 4RCAB 4MQWX 4OQTA 5AWAA 3W3NA 4LSXA 2P1NB 4Z94G 2OMYA 4RCWA 2Z64A 3CIYA 3E3ZA 5D3IA 3WPIA 2OMTA 3W3JA 4R6FA 4UFRA 1DCEA 4Q62A 2Z66A 4LXRA 1GWBA 4C2BB 2BEXA 2Y5QA 4R5CA 3A79B 4QBZA 4R07A 4R09A 3RGZA 3GOZA 4NZRM 1OZNA 1H6TA
chains in the Genus database with same CATH topology
2P1MB 4QC0A 5GQRK 1IO0A 1LTXA 1XEUA 3BZ5A 2O6SA 4AW4A 3OJAB 1P9AG 1A9NA 4WYKA 5GMHA 4P8SA 5IJCA 1U0ND 3REZA 1M9SA 1P8TA 1O6TA 2ELLA 3RFJA 5GS2B 4YEBB 4AY9X 3KJ4A 3M19A 4BV4R 3WPDA 3UL9A 3G3AA 2WFHA 4NKGA 1DS9A 4IM6A 4CC4A 3E4GA 4V2CA 5HZLB 4FMZA 1XWDC 1OTMA 3G06A 4LSCA 1H6UA 5AWDA 2R9UA 4R6AA 3WPBA 5AWBA 1FT8A 3TSRE 3WPCA 4XGOA 4P91A 1OTNA 1OTOA 2P1QB 1JL5A 2Z7XB 5AWCA 4CNMA 5LFNA 5B0TA 4R08A 3W3LA 3UN9A 2OMUA 3RGXA 4LI1A 2O6QA 3ULAA 1XKUA 3VQ1A 4FS7A 3ZYNA 3W3KA 5GS0A 2Z65A 3O6NA 1KOOA 4V2EA 4U06A 1YRGA 2RR6A 5CMPA 1OGQA 4V2DA 2P1OB 4U7LA 4M7EA 5IYXC 4XOSA 4Q3IA 3G3BA 4Z79A 1QYYA 3RFEA 4Q3GA 3ULUA 4LSXC 3E2JA 2Z81A 5FTTB 3UL7A 1XECA 2JQDA 3VQ2A 1O6SA 2WQWA 2XOTA 2Z62A 3OGKB 4PQ8A 5B0NA 1XCDA 3W3MA 1DFJI 4KNGA 4TZHA 2JE1A 4GLPA 3E6JA 4PEQB 2UZYA 5IJBA 3P72A 3O53A 5CMNA 1O6VA 4LSAA 1WWLA 1PGVA 2Q4GW 3ULVA 4K17A 3C6PB 2RA8A 3DZEA 2V9SA 1K5DC 4RWTC 4I6JB 3PMHG 4L3FA 3OJAA 4CNCA 3WN4A 2OMXA 3WPEA 2XWTC 1SQ0B 4EZGA 1FO1A 1OOKG 3OGLB 2Z63A 5B4PA 4H09A 1M0ZA 1G9UA 4BSSA 4HQ1A 3WPHA 4L3AA 3RW7A 3RIZA 2P1PB 1FS2A 3WPFA 5A5CA 4R58A 4ECNA 2JE0A 3RJ0A 4PSJA 1K5GC 4BSRA 4Z64C 3ZYOA 4XSQA 4R0AA 2BNHA 3M18A 3CIGA 3RW6A 5AZ5A 4FCGA 2ASSB 2Z7XA 1M10B 5GMGA 5HDHA 4R5DA 1KOHA 2OMZA 4LI2A 3CVRA 4KXFB 4C2AB 1FQVA 3OGMB 4R6JA 4MN8B 4LXSA 4Z61C 4FD0A 3RFSA 4R6GA 4WP6A 4PERA 4M7EC 4GT6A 3ZYJA 4J4LA 1P8VA 2Z82A 1M9LA 3W3GA 5GMFA 4ARRA 4U09A 3ZYIA 3WPGA 2WQVA 4B8CD 4CP6A 3FXIA 5IJDA 4J0MA 1D0BA 4KT1A 4U08A 3JB9j 2V9TB 2ID5A 2WQUA 1Z7XW 4Z8GA 2CA6A 2UZXA 2WQXA 4ARNA 2A0ZA 4CILA 4PKIG 4ECOA 3C6OB 3G39A 1W8AA 3C6NB 4FHOA 2IFGA 2ASTB 3SB4A 1A4YA 2FT3A 4CC4C 2O6RA 4Y61B 3G04C 2V70A 1ZIWA 2OMWA 4NKHA 4FDWA 4G8AA 2OMVA 4BSUA 3UL8A 4QXEA 4RCAB 4MQWX 4OQTA 5AWAA 3W3NA 4LSXA 2P1NB 4Z94G 2OMYA 4RCWA 2Z64A 3CIYA 3E3ZA 5D3IA 3WPIA 2OMTA 3W3JA 4R6FA 4UFRA 1DCEA 4Q62A 2Z66A 4LXRA 1GWBA 4C2BB 2BEXA 2Y5QA 4R5CA 3A79B 4QBZA 4R07A 4R09A 3RGZA 3GOZA 1OZNA 1H6TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P1M B;  4QC0 A;  5GQR K;  1IO0 A;  1LTX A;  1XEU A;  3BZ5 A;  2O6S A;  4AW4 A;  3OJA B;  1P9A G;  1A9N A;  4WYK A;  5GMH A;  4P8S A;  5IJC A;  1U0N D;  3REZ A;  1M9S A;  1P8T A;  1O6T A;  2ELL A;  3RFJ A;  5GS2 B;  4YEB B;  4AY9 X;  3KJ4 A;  3M19 A;  4BV4 R;  3WPD A;  3UL9 A;  3G3A A;  2WFH A;  4NKG A;  1DS9 A;  4IM6 A;  4CC4 A;  3E4G A;  4V2C A;  5HZL B;  4FMZ A;  1XWD C;  1OTM A;  3G06 A;  4LSC A;  1H6U A;  5AWD A;  2R9U A;  4R6A A;  3WPB A;  5AWB A;  1FT8 A;  3TSR E;  3WPC A;  4XGO A;  4P91 A;  1OTN A;  1OTO A;  2P1Q B;  1JL5 A;  2Z7X B;  5AWC A;  4CNM A;  5LFN A;  5B0T A;  4R08 A;  3W3L A;  3UN9 A;  2OMU A;  3RGX A;  4LI1 A;  2O6Q A;  3ULA A;  1XKU A;  3VQ1 A;  4FS7 A;  3ZYN A;  3W3K A;  5GS0 A;  2Z65 A;  3O6N A;  1KOO A;  4V2E A;  4U06 A;  1YRG A;  2RR6 A;  5CMP A;  1OGQ A;  4V2D A;  2P1O B;  4U7L A;  4M7E A;  5IYX C;  4XOS A;  4Q3I A;  3G3B A;  4Z79 A;  1QYY A;  3RFE A;  4Q3G A;  3ULU A;  4LSX C;  3E2J A;  2Z81 A;  5FTT B;  3UL7 A;  1XEC A;  2JQD A;  3VQ2 A;  1O6S A;  2WQW A;  2XOT A;  2Z62 A;  3OGK B;  4PQ8 A;  5B0N A;  1XCD A;  3W3M A;  1DFJ I;  4KNG A;  4TZH A;  2JE1 A;  4GLP A;  3E6J A;  4PEQ B;  2UZY A;  5IJB A;  3P72 A;  3O53 A;  5CMN A;  1O6V A;  4LSA A;  1WWL A;  1PGV A;  2Q4G W;  3ULV A;  4K17 A;  3C6P B;  2RA8 A;  3DZE A;  2V9S A;  1K5D C;  4RWT C;  4I6J B;  3PMH G;  4L3F A;  3OJA A;  4CNC A;  3WN4 A;  2OMX A;  3WPE A;  2XWT C;  1SQ0 B;  4EZG A;  1FO1 A;  1OOK G;  3OGL B;  2Z63 A;  5B4P A;  4H09 A;  1M0Z A;  1G9U A;  4BSS A;  4HQ1 A;  3WPH A;  4L3A A;  3RW7 A;  3RIZ A;  2P1P B;  1FS2 A;  3WPF A;  5A5C A;  4R58 A;  4ECN A;  2JE0 A;  3RJ0 A;  4PSJ A;  1K5G C;  4BSR A;  4Z64 C;  3ZYO A;  4XSQ A;  4R0A A;  2BNH A;  3M18 A;  3CIG A;  3RW6 A;  5AZ5 A;  4FCG A;  2ASS B;  2Z7X A;  1M10 B;  5GMG A;  5HDH A;  4R5D A;  1KOH A;  2OMZ A;  4LI2 A;  3CVR A;  4KXF B;  4C2A B;  1FQV A;  3OGM B;  4R6J A;  4MN8 B;  4LXS A;  4Z61 C;  4FD0 A;  3RFS A;  4R6G A;  4WP6 A;  4PER A;  4M7E C;  4GT6 A;  3ZYJ A;  4J4L A;  1P8V A;  2Z82 A;  1M9L A;  3W3G A;  5GMF A;  4ARR A;  4U09 A;  3ZYI A;  3WPG A;  2WQV A;  4B8C D;  4CP6 A;  3FXI A;  5IJD A;  4J0M A;  1D0B A;  4KT1 A;  4U08 A;  3JB9 j;  2V9T B;  2ID5 A;  2WQU A;  1Z7X W;  4Z8G A;  2CA6 A;  2UZX A;  2WQX A;  4ARN A;  2A0Z A;  4CIL A;  4PKI G;  4ECO A;  3C6O B;  3G39 A;  1W8A A;  3C6N B;  4FHO A;  2IFG A;  2AST B;  3SB4 A;  1A4Y A;  2FT3 A;  4CC4 C;  2O6R A;  4Y61 B;  3G04 C;  2V70 A;  1ZIW A;  2OMW A;  4NKH A;  4FDW A;  4G8A A;  2OMV A;  4BSU A;  3UL8 A;  4QXE A;  4RCA B;  4MQW X;  4OQT A;  5AWA A;  3W3N A;  4LSX A;  2P1N B;  4Z94 G;  2OMY A;  4RCW A;  2Z64 A;  3CIY A;  3E3Z A;  5D3I A;  3WPI A;  2OMT A;  3W3J A;  4R6F A;  4UFR A;  1DCE A;  4Q62 A;  2Z66 A;  4LXR A;  1GWB A;  4C2B B;  2BEX A;  2Y5Q A;  4R5C A;  3A79 B;  4QBZ A;  4R07 A;  4R09 A;  3RGZ A;  3GOZ A;  1OZN A;  1H6T A; 
#chains in the Genus database with same CATH topology
 2P1M B;  4QC0 A;  5GQR K;  1IO0 A;  1LTX A;  1XEU A;  3BZ5 A;  2O6S A;  4AW4 A;  3OJA B;  1P9A G;  1A9N A;  4WYK A;  5GMH A;  4P8S A;  5IJC A;  1U0N D;  3REZ A;  4NZT M;  1M9S A;  1P8T A;  1O6T A;  2ELL A;  3RFJ A;  5GS2 B;  4YEB B;  4AY9 X;  3KJ4 A;  3M19 A;  4BV4 R;  3WPD A;  3UL9 A;  3G3A A;  2WFH A;  4NKG A;  1DS9 A;  4IM6 A;  4CC4 A;  3E4G A;  4V2C A;  5HZL B;  4FMZ A;  1XWD C;  1OTM A;  3G06 A;  4LSC A;  1H6U A;  5AWD A;  2R9U A;  4R6A A;  3WPB A;  5AWB A;  1FT8 A;  3TSR E;  3WPC A;  4XGO A;  4P91 A;  1OTN A;  1OTO A;  2P1Q B;  1JL5 A;  2Z7X B;  5AWC A;  4CNM A;  5LFN A;  5B0T A;  4R08 A;  3W3L A;  3UN9 A;  2OMU A;  3RGX A;  4LI1 A;  2O6Q A;  3ULA A;  1XKU A;  3VQ1 A;  4FS7 A;  3ZYN A;  3W3K A;  5GS0 A;  2Z65 A;  3O6N A;  1KOO A;  4V2E A;  4U06 A;  1YRG A;  2RR6 A;  5CMP A;  1OGQ A;  4V2D A;  2P1O B;  4U7L A;  4M7E A;  5IYX C;  4XOS A;  4Q3I A;  3G3B A;  4Z79 A;  1QYY A;  3RFE A;  4Q3G A;  3ULU A;  4LSX C;  3E2J A;  2Z81 A;  5FTT B;  3UL7 A;  1XEC A;  2JQD A;  3VQ2 A;  1O6S A;  2WQW A;  2XOT A;  2Z62 A;  3OGK B;  4PQ8 A;  5B0N A;  1XCD A;  3W3M A;  1DFJ I;  4KNG A;  4TZH A;  2JE1 A;  4GLP A;  3E6J A;  4PEQ B;  2UZY A;  5IJB A;  3P72 A;  3O53 A;  5CMN A;  1O6V A;  4LSA A;  1WWL A;  1PGV A;  2Q4G W;  3ULV A;  4K17 A;  3C6P B;  2RA8 A;  3DZE A;  2V9S A;  1K5D C;  4RWT C;  4I6J B;  3PMH G;  4L3F A;  3OJA A;  4CNC A;  3WN4 A;  2OMX A;  3WPE A;  2XWT C;  1SQ0 B;  4EZG A;  1FO1 A;  1OOK G;  3OGL B;  2Z63 A;  5B4P A;  4H09 A;  1M0Z A;  1G9U A;  4BSS A;  4HQ1 A;  3WPH A;  4L3A A;  3RW7 A;  3RIZ A;  2P1P B;  1FS2 A;  3WPF A;  5A5C A;  4R58 A;  4ECN A;  2JE0 A;  3RJ0 A;  4PSJ A;  1K5G C;  4BSR A;  4Z64 C;  3ZYO A;  4XSQ A;  4R0A A;  2BNH A;  3M18 A;  3CIG A;  3RW6 A;  5AZ5 A;  4FCG A;  2ASS B;  2Z7X A;  1M10 B;  5GMG A;  5HDH A;  4R5D A;  1KOH A;  2OMZ A;  4LI2 A;  3CVR A;  4KXF B;  4C2A B;  1FQV A;  3OGM B;  4R6J A;  4MN8 B;  4LXS A;  4Z61 C;  4FD0 A;  3RFS A;  4R6G A;  4WP6 A;  4PER A;  4M7E C;  4GT6 A;  3ZYJ A;  4J4L A;  1P8V A;  2Z82 A;  1M9L A;  3W3G A;  5GMF A;  4ARR A;  4U09 A;  3ZYI A;  3WPG A;  2WQV A;  4B8C D;  4CP6 A;  3FXI A;  5IJD A;  4J0M A;  1D0B A;  4KT1 A;  4U08 A;  3JB9 j;  2V9T B;  2ID5 A;  2WQU A;  1Z7X W;  4Z8G A;  2CA6 A;  2UZX A;  2WQX A;  4ARN A;  2A0Z A;  4CIL A;  4PKI G;  4ECO A;  3C6O B;  3G39 A;  1W8A A;  3C6N B;  4FHO A;  2IFG A;  2AST B;  3SB4 A;  1A4Y A;  2FT3 A;  4CC4 C;  2O6R A;  4Y61 B;  3G04 C;  2V70 A;  1ZIW A;  2OMW A;  4NKH A;  4FDW A;  4G8A A;  2OMV A;  4BSU A;  3UL8 A;  4QXE A;  4RCA B;  4MQW X;  4OQT A;  5AWA A;  3W3N A;  4LSX A;  2P1N B;  4Z94 G;  2OMY A;  4RCW A;  2Z64 A;  3CIY A;  3E3Z A;  5D3I A;  3WPI A;  2OMT A;  3W3J A;  4R6F A;  4UFR A;  1DCE A;  4Q62 A;  2Z66 A;  4LXR A;  1GWB A;  4C2B B;  2BEX A;  2Y5Q A;  4R5C A;  3A79 B;  4QBZ A;  4R07 A;  4R09 A;  3RGZ A;  3GOZ A;  4NZR M;  1OZN A;  1H6T A; 
#chains in the Genus database with same CATH homology
 2P1M B;  4QC0 A;  5GQR K;  1IO0 A;  1LTX A;  1XEU A;  3BZ5 A;  2O6S A;  4AW4 A;  3OJA B;  1P9A G;  1A9N A;  4WYK A;  5GMH A;  4P8S A;  5IJC A;  1U0N D;  3REZ A;  1M9S A;  1P8T A;  1O6T A;  2ELL A;  3RFJ A;  5GS2 B;  4YEB B;  4AY9 X;  3KJ4 A;  3M19 A;  4BV4 R;  3WPD A;  3UL9 A;  3G3A A;  2WFH A;  4NKG A;  1DS9 A;  4IM6 A;  4CC4 A;  3E4G A;  4V2C A;  5HZL B;  4FMZ A;  1XWD C;  1OTM A;  3G06 A;  4LSC A;  1H6U A;  5AWD A;  2R9U A;  4R6A A;  3WPB A;  5AWB A;  1FT8 A;  3TSR E;  3WPC A;  4XGO A;  4P91 A;  1OTN A;  1OTO A;  2P1Q B;  1JL5 A;  2Z7X B;  5AWC A;  4CNM A;  5LFN A;  5B0T A;  4R08 A;  3W3L A;  3UN9 A;  2OMU A;  3RGX A;  4LI1 A;  2O6Q A;  3ULA A;  1XKU A;  3VQ1 A;  4FS7 A;  3ZYN A;  3W3K A;  5GS0 A;  2Z65 A;  3O6N A;  1KOO A;  4V2E A;  4U06 A;  1YRG A;  2RR6 A;  5CMP A;  1OGQ A;  4V2D A;  2P1O B;  4U7L A;  4M7E A;  5IYX C;  4XOS A;  4Q3I A;  3G3B A;  4Z79 A;  1QYY A;  3RFE A;  4Q3G A;  3ULU A;  4LSX C;  3E2J A;  2Z81 A;  5FTT B;  3UL7 A;  1XEC A;  2JQD A;  3VQ2 A;  1O6S A;  2WQW A;  2XOT A;  2Z62 A;  3OGK B;  4PQ8 A;  5B0N A;  1XCD A;  3W3M A;  1DFJ I;  4KNG A;  4TZH A;  2JE1 A;  4GLP A;  3E6J A;  4PEQ B;  2UZY A;  5IJB A;  3P72 A;  3O53 A;  5CMN A;  1O6V A;  4LSA A;  1WWL A;  1PGV A;  2Q4G W;  3ULV A;  4K17 A;  3C6P B;  2RA8 A;  3DZE A;  2V9S A;  1K5D C;  4RWT C;  4I6J B;  3PMH G;  4L3F A;  3OJA A;  4CNC A;  3WN4 A;  2OMX A;  3WPE A;  2XWT C;  1SQ0 B;  4EZG A;  1FO1 A;  1OOK G;  3OGL B;  2Z63 A;  5B4P A;  4H09 A;  1M0Z A;  1G9U A;  4BSS A;  4HQ1 A;  3WPH A;  4L3A A;  3RW7 A;  3RIZ A;  2P1P B;  1FS2 A;  3WPF A;  5A5C A;  4R58 A;  4ECN A;  2JE0 A;  3RJ0 A;  4PSJ A;  1K5G C;  4BSR A;  4Z64 C;  3ZYO A;  4XSQ A;  4R0A A;  2BNH A;  3M18 A;  3CIG A;  3RW6 A;  5AZ5 A;  4FCG A;  2ASS B;  2Z7X A;  1M10 B;  5GMG A;  5HDH A;  4R5D A;  1KOH A;  2OMZ A;  4LI2 A;  3CVR A;  4KXF B;  4C2A B;  1FQV A;  3OGM B;  4R6J A;  4MN8 B;  4LXS A;  4Z61 C;  4FD0 A;  3RFS A;  4R6G A;  4WP6 A;  4PER A;  4M7E C;  4GT6 A;  3ZYJ A;  4J4L A;  1P8V A;  2Z82 A;  1M9L A;  3W3G A;  5GMF A;  4ARR A;  4U09 A;  3ZYI A;  3WPG A;  2WQV A;  4B8C D;  4CP6 A;  3FXI A;  5IJD A;  4J0M A;  1D0B A;  4KT1 A;  4U08 A;  3JB9 j;  2V9T B;  2ID5 A;  2WQU A;  1Z7X W;  4Z8G A;  2CA6 A;  2UZX A;  2WQX A;  4ARN A;  2A0Z A;  4CIL A;  4PKI G;  4ECO A;  3C6O B;  3G39 A;  1W8A A;  3C6N B;  4FHO A;  2IFG A;  2AST B;  3SB4 A;  1A4Y A;  2FT3 A;  4CC4 C;  2O6R A;  4Y61 B;  3G04 C;  2V70 A;  1ZIW A;  2OMW A;  4NKH A;  4FDW A;  4G8A A;  2OMV A;  4BSU A;  3UL8 A;  4QXE A;  4RCA B;  4MQW X;  4OQT A;  5AWA A;  3W3N A;  4LSX A;  2P1N B;  4Z94 G;  2OMY A;  4RCW A;  2Z64 A;  3CIY A;  3E3Z A;  5D3I A;  3WPI A;  2OMT A;  3W3J A;  4R6F A;  4UFR A;  1DCE A;  4Q62 A;  2Z66 A;  4LXR A;  1GWB A;  4C2B B;  2BEX A;  2Y5Q A;  4R5C A;  3A79 B;  4QBZ A;  4R07 A;  4R09 A;  3RGZ A;  3GOZ A;  1OZN A;  1H6T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...