1M0ZA

Crystal structure of the von willebrand factor binding domain of glycoprotein ib alpha
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
266
structure length
259
Chain Sequence
HPICEVSKHLEVNCDKRQLTALPPDLPKDTTILHLSENLLYTFSLATLMPYTRLTQLNLDRCELTKLQVDGTLPVLGTLDLSHNQLQSLPLLGQTLPALTVLDVSFNRLTSLPLGALRGLGELQELYLKGNELKTLPPGLLTPTPKLEKLSLANNQLTELPAGLLNGLENLDTLLLQENSLYTIPKGFFGSHLLPFAFLHGNPWLCNCEILYFRRWLQDNAENVYVWKQGVMTSNVASVQCDNSDKFPVYKYPGKGCPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Blood clotting
molecule keywords Glycoprotein Ib alpha
publication title Structures of glycoprotein Ibalpha and its complex with von Willebrand factor A1 domain.
pubmed doi rcsb
source organism Homo sapiens
total genus 79
structure length 259
sequence length 266
chains with identical sequence B
ec nomenclature
pdb deposition date 2002-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01462 LRRNT Leucine rich repeat N-terminal domain
A PF13855 LRR_8 Leucine rich repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 1m0zA00
4LI2A 4XSQA 4R09A 1P8TA 5B0NA 1H6UA 2P1PB 4FMZA 4Z94G 2Z65A 3P72A 3OGMB 3CIYA 3C6OB 4HQ1A 3G3AA 4FCGA 4LSCA 4Q62A 4ECOA 3OJAB 4MQWX 4Z64C 4CC4C 5AWBA 4AY9X 2Z7XB 3ULAA 3VQ1A 2WFHA 3DZEA 2V70A 3E6JA 4Q3GA 5AWAA 4EZGA 1H6TA 2BNHA 2OMXA 4ARNA 4BSSA 4RCWA 2P1OB 4V2EA 4BV4R 4OQTA 1DS9A 4Q3IA 4Z61C 1P9AG 2V9TB 1QYYA 4C2BB 3UL7A 3O53A 5B4PA 3WPEA 2Y5QA 2RA8A 2UZXA 3OGKB 4J0MA 4MN8B 2A0ZA 3O6NA 2OMTA 4KNGA 4V2CA 1M0ZA 4R07A 1OOKG 2P1MB 4RCAB 1PGVA 5D3IA 2R9UA 4V2DA 4CNMA 4K17A 1DFJI 4L3AA 5A5CA 1Z7XW 3CIGA 2WQUA 1OTNA 4R58A 2P1NB 3ZYJA 4L3FA 4M7EC 4U08A 3W3GA 3G04C 4QBZA 1K5GC 3ZYOA 3C6PB 4LSXA 3A79B 4PEQB 1JL5A 3G06A 4U09A 1XWDC 4I6JB 5CMNA 3RIZA 2Z82A 1M10B 1U0ND 3OGLB 4H09A 4WP6A 4J4LA 2ELLA 4C2AB 3JB9j 5IJCA 1FT8A 4R6FA 1KOOA 5GMGA 3RW7A 4LXRA 2Z66A 3UN9A 4CNCA 4P8SA 3ZYNA 2WQVA 4R6AA 4FD0A 4R0AA 3G39A 3E3ZA 2JQDA 4PERA 2Z81A 4NKHA 4U7LA 1DCEA 4KT1A 4KXFB 5CMPA 1G9UA 2ASSB 1XCDA 4AW4A 4NKGA 2O6QA 3W3JA 5LFNA 4UFRA 3OJAA 1ZIWA 4ECNA 5GQRK 2OMYA 4FHOA 1KOHA 1XEUA 4QXEA 2Z7XA 2JE0A 3RW6A 3UL8A 2CA6A 2Z62A 2FT3A 4Z79A 3WPDA 5GS0A 1P8VA 2IFGA 3RFSA 1A4YA 3WPGA 4FDWA 3W3MA 1SQ0B 3W3NA 5GMFA 5IYXC 5AZ5A 3RFJA 3REZA 2O6RA 4BSUA 1K5DC 1O6TA 3GOZA 4IM6A 1GWBA 4CC4A 3ZYIA 3BZ5A 3WPIA 5HDHA 1A9NA 4XOSA 4U06A 1YRGA 2BEXA 1D0BA 3CVRA 3UL9A 3W3KA 5IJDA 4R5CA 1M9LA 4PQ8A 1W8AA 1LTXA 2Z64A 3WPFA 5GMHA 1OZNA 2OMUA 3VQ2A 4CP6A 4GT6A 2OMWA 5FTTB 4G8AA 3PMHG 3M18A 1WWLA 2RR6A 2P1QB 3C6NB 3WPBA 4LSAA 3M19A 4CILA 2XOTA 3WPCA 4LSXC 2O6SA 3SB4A 2JE1A 2WQWA 4PSJA 1OTMA 4FS7A 3FXIA 4GLPA 4BSRA 3KJ4A 1IO0A 4QC0A 4PKIG 3E4GA 3WN4A 4M7EA 4Y61B 1FS2A 5B0TA 3RJ0A 5HZLB 1XECA 4XGOA 2Z63A 3WPHA 2WQXA 3W3LA 2XWTC 4LXSA 1M9SA 3RFEA 1XKUA 1FQVA 2Q4GW 2ASTB 1FO1A 3ULUA 2V9SA 5GS2B 4LI1A 4YEBB 3RGXA 5AWDA 4R6GA 2UZYA 1OTOA 4ARRA 2ID5A 5IJBA 4R5DA 1O6SA 4Z8GA 4WYKA 4RWTC 3TSRE 4TZHA 4R08A 4P91A 3RGZA 4R6JA 4B8CD 3E2JA 2OMZA 1OGQA 3ULVA 3G3BA 2OMVA 5AWCA 1O6VA
chains in the Genus database with same CATH superfamily
4LI2A 4XSQA 4R09A 1P8TA 5B0NA 1H6UA 2P1PB 4FMZA 4Z94G 2Z65A 3P72A 3OGMB 3CIYA 3C6OB 4HQ1A 3G3AA 4FCGA 4LSCA 4Q62A 4ECOA 3OJAB 4MQWX 4Z64C 4CC4C 5AWBA 4AY9X 2Z7XB 3ULAA 3VQ1A 2WFHA 3DZEA 2V70A 3E6JA 4Q3GA 5AWAA 4EZGA 1H6TA 2BNHA 2OMXA 4ARNA 4BSSA 4RCWA 2P1OB 4V2EA 4BV4R 4OQTA 1DS9A 4Q3IA 4Z61C 1P9AG 2V9TB 1QYYA 4C2BB 3UL7A 3O53A 5B4PA 3WPEA 2Y5QA 2RA8A 2UZXA 3OGKB 4J0MA 4MN8B 2A0ZA 3O6NA 2OMTA 4KNGA 4V2CA 1M0ZA 4R07A 1OOKG 2P1MB 4RCAB 1PGVA 5D3IA 2R9UA 4V2DA 4CNMA 4K17A 1DFJI 4L3AA 5A5CA 1Z7XW 3CIGA 2WQUA 1OTNA 4R58A 2P1NB 3ZYJA 4L3FA 4M7EC 4U08A 3W3GA 3G04C 4QBZA 1K5GC 3ZYOA 3C6PB 4LSXA 3A79B 4PEQB 1JL5A 3G06A 4U09A 1XWDC 4I6JB 5CMNA 3RIZA 2Z82A 1M10B 1U0ND 3OGLB 4H09A 4WP6A 4J4LA 2ELLA 4C2AB 3JB9j 5IJCA 1FT8A 4R6FA 1KOOA 5GMGA 3RW7A 4LXRA 2Z66A 3UN9A 4CNCA 4P8SA 3ZYNA 2WQVA 4R6AA 4FD0A 4R0AA 3G39A 3E3ZA 2JQDA 4PERA 2Z81A 4NKHA 4U7LA 1DCEA 4KT1A 4KXFB 5CMPA 1G9UA 2ASSB 1XCDA 4AW4A 4NKGA 2O6QA 3W3JA 5LFNA 4UFRA 3OJAA 1ZIWA 4ECNA 5GQRK 2OMYA 4FHOA 1KOHA 1XEUA 4QXEA 2Z7XA 2JE0A 3RW6A 3UL8A 2CA6A 2Z62A 2FT3A 4Z79A 3WPDA 5GS0A 1P8VA 2IFGA 3RFSA 1A4YA 3WPGA 4FDWA 3W3MA 1SQ0B 3W3NA 5GMFA 5IYXC 5AZ5A 3RFJA 3REZA 2O6RA 4BSUA 1K5DC 1O6TA 3GOZA 4IM6A 1GWBA 4CC4A 3ZYIA 3BZ5A 3WPIA 5HDHA 1A9NA 4XOSA 4U06A 1YRGA 2BEXA 1D0BA 3CVRA 3UL9A 3W3KA 5IJDA 4R5CA 1M9LA 4PQ8A 1W8AA 1LTXA 2Z64A 3WPFA 5GMHA 1OZNA 2OMUA 3VQ2A 4CP6A 4GT6A 2OMWA 5FTTB 4G8AA 3PMHG 3M18A 1WWLA 2RR6A 2P1QB 3C6NB 3WPBA 4LSAA 3M19A 4CILA 2XOTA 3WPCA 4LSXC 2O6SA 3SB4A 2JE1A 2WQWA 4PSJA 1OTMA 4FS7A 3FXIA 4GLPA 4BSRA 3KJ4A 1IO0A 4QC0A 4PKIG 3E4GA 3WN4A 4NZTM 4M7EA 4Y61B 1FS2A 5B0TA 3RJ0A 5HZLB 1XECA 4XGOA 4NZRM 2Z63A 3WPHA 2WQXA 3W3LA 2XWTC 4LXSA 1M9SA 3RFEA 1XKUA 1FQVA 2Q4GW 2ASTB 1FO1A 3ULUA 2V9SA 5GS2B 4LI1A 4YEBB 3RGXA 5AWDA 4R6GA 2UZYA 1OTOA 4ARRA 2ID5A 5IJBA 4R5DA 1O6SA 4Z8GA 4WYKA 4RWTC 3TSRE 4TZHA 4R08A 4P91A 3RGZA 4R6JA 4B8CD 3E2JA 2OMZA 1OGQA 3ULVA 3G3BA 2OMVA 5AWCA 1O6VA
chains in the Genus database with same CATH topology
4LI2A 4XSQA 4R09A 1P8TA 5B0NA 1H6UA 2P1PB 4FMZA 4Z94G 2Z65A 3P72A 3OGMB 3CIYA 3C6OB 4HQ1A 3G3AA 4FCGA 4LSCA 4Q62A 4ECOA 3OJAB 4MQWX 4Z64C 4CC4C 5AWBA 4AY9X 2Z7XB 3ULAA 3VQ1A 2WFHA 3DZEA 2V70A 3E6JA 4Q3GA 5AWAA 4EZGA 1H6TA 2BNHA 2OMXA 4ARNA 4BSSA 4RCWA 2P1OB 4V2EA 4BV4R 4OQTA 1DS9A 4Q3IA 4Z61C 1P9AG 2V9TB 1QYYA 4C2BB 3UL7A 3O53A 5B4PA 3WPEA 2Y5QA 2RA8A 2UZXA 3OGKB 4J0MA 4MN8B 2A0ZA 3O6NA 2OMTA 4KNGA 4V2CA 1M0ZA 4R07A 1OOKG 2P1MB 4RCAB 1PGVA 5D3IA 2R9UA 4V2DA 4CNMA 4K17A 1DFJI 4L3AA 5A5CA 1Z7XW 3CIGA 2WQUA 1OTNA 4R58A 2P1NB 3ZYJA 4L3FA 4M7EC 4U08A 3W3GA 3G04C 4QBZA 1K5GC 3ZYOA 3C6PB 4LSXA 3A79B 4PEQB 1JL5A 3G06A 4U09A 1XWDC 4I6JB 5CMNA 3RIZA 2Z82A 1M10B 1U0ND 3OGLB 4H09A 4WP6A 4J4LA 2ELLA 4C2AB 3JB9j 5IJCA 1FT8A 4R6FA 1KOOA 5GMGA 3RW7A 4LXRA 2Z66A 3UN9A 4CNCA 4P8SA 3ZYNA 2WQVA 4R6AA 4FD0A 4R0AA 3G39A 3E3ZA 2JQDA 4PERA 2Z81A 4NKHA 4U7LA 1DCEA 4KT1A 4KXFB 5CMPA 1G9UA 2ASSB 1XCDA 4AW4A 4NKGA 2O6QA 3W3JA 5LFNA 4UFRA 3OJAA 1ZIWA 4ECNA 5GQRK 2OMYA 4FHOA 1KOHA 1XEUA 4QXEA 2Z7XA 2JE0A 3RW6A 3UL8A 2CA6A 2Z62A 2FT3A 4Z79A 3WPDA 5GS0A 1P8VA 2IFGA 3RFSA 1A4YA 3WPGA 4FDWA 3W3MA 1SQ0B 3W3NA 5GMFA 5IYXC 5AZ5A 3RFJA 3REZA 2O6RA 4BSUA 1K5DC 1O6TA 3GOZA 4IM6A 1GWBA 4CC4A 3ZYIA 3BZ5A 3WPIA 5HDHA 1A9NA 4XOSA 4U06A 1YRGA 2BEXA 1D0BA 3CVRA 3UL9A 3W3KA 5IJDA 4R5CA 1M9LA 4PQ8A 1W8AA 1LTXA 2Z64A 3WPFA 5GMHA 1OZNA 2OMUA 3VQ2A 4CP6A 4GT6A 2OMWA 5FTTB 4G8AA 3PMHG 3M18A 1WWLA 2RR6A 2P1QB 3C6NB 3WPBA 4LSAA 3M19A 4CILA 2XOTA 3WPCA 4LSXC 2O6SA 3SB4A 2JE1A 2WQWA 4PSJA 1OTMA 4FS7A 3FXIA 4GLPA 4BSRA 3KJ4A 1IO0A 4QC0A 4PKIG 3E4GA 3WN4A 4M7EA 4Y61B 1FS2A 5B0TA 3RJ0A 5HZLB 1XECA 4XGOA 2Z63A 3WPHA 2WQXA 3W3LA 2XWTC 4LXSA 1M9SA 3RFEA 1XKUA 1FQVA 2Q4GW 2ASTB 1FO1A 3ULUA 2V9SA 5GS2B 4LI1A 4YEBB 3RGXA 5AWDA 4R6GA 2UZYA 1OTOA 4ARRA 2ID5A 5IJBA 4R5DA 1O6SA 4Z8GA 4WYKA 4RWTC 3TSRE 4TZHA 4R08A 4P91A 3RGZA 4R6JA 4B8CD 3E2JA 2OMZA 1OGQA 3ULVA 3G3BA 2OMVA 5AWCA 1O6VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LI2 A;  4XSQ A;  4R09 A;  1P8T A;  5B0N A;  1H6U A;  2P1P B;  4FMZ A;  4Z94 G;  2Z65 A;  3P72 A;  3OGM B;  3CIY A;  3C6O B;  4HQ1 A;  3G3A A;  4FCG A;  4LSC A;  4Q62 A;  4ECO A;  3OJA B;  4MQW X;  4Z64 C;  4CC4 C;  5AWB A;  4AY9 X;  2Z7X B;  3ULA A;  3VQ1 A;  2WFH A;  3DZE A;  2V70 A;  3E6J A;  4Q3G A;  5AWA A;  4EZG A;  1H6T A;  2BNH A;  2OMX A;  4ARN A;  4BSS A;  4RCW A;  2P1O B;  4V2E A;  4BV4 R;  4OQT A;  1DS9 A;  4Q3I A;  4Z61 C;  1P9A G;  2V9T B;  1QYY A;  4C2B B;  3UL7 A;  3O53 A;  5B4P A;  3WPE A;  2Y5Q A;  2RA8 A;  2UZX A;  3OGK B;  4J0M A;  4MN8 B;  2A0Z A;  3O6N A;  2OMT A;  4KNG A;  4V2C A;  1M0Z A;  4R07 A;  1OOK G;  2P1M B;  4RCA B;  1PGV A;  5D3I A;  2R9U A;  4V2D A;  4CNM A;  4K17 A;  1DFJ I;  4L3A A;  5A5C A;  1Z7X W;  3CIG A;  2WQU A;  1OTN A;  4R58 A;  2P1N B;  3ZYJ A;  4L3F A;  4M7E C;  4U08 A;  3W3G A;  3G04 C;  4QBZ A;  1K5G C;  3ZYO A;  3C6P B;  4LSX A;  3A79 B;  4PEQ B;  1JL5 A;  3G06 A;  4U09 A;  1XWD C;  4I6J B;  5CMN A;  3RIZ A;  2Z82 A;  1M10 B;  1U0N D;  3OGL B;  4H09 A;  4WP6 A;  4J4L A;  2ELL A;  4C2A B;  3JB9 j;  5IJC A;  1FT8 A;  4R6F A;  1KOO A;  5GMG A;  3RW7 A;  4LXR A;  2Z66 A;  3UN9 A;  4CNC A;  4P8S A;  3ZYN A;  2WQV A;  4R6A A;  4FD0 A;  4R0A A;  3G39 A;  3E3Z A;  2JQD A;  4PER A;  2Z81 A;  4NKH A;  4U7L A;  1DCE A;  4KT1 A;  4KXF B;  5CMP A;  1G9U A;  2ASS B;  1XCD A;  4AW4 A;  4NKG A;  2O6Q A;  3W3J A;  5LFN A;  4UFR A;  3OJA A;  1ZIW A;  4ECN A;  5GQR K;  2OMY A;  4FHO A;  1KOH A;  1XEU A;  4QXE A;  2Z7X A;  2JE0 A;  3RW6 A;  3UL8 A;  2CA6 A;  2Z62 A;  2FT3 A;  4Z79 A;  3WPD A;  5GS0 A;  1P8V A;  2IFG A;  3RFS A;  1A4Y A;  3WPG A;  4FDW A;  3W3M A;  1SQ0 B;  3W3N A;  5GMF A;  5IYX C;  5AZ5 A;  3RFJ A;  3REZ A;  2O6R A;  4BSU A;  1K5D C;  1O6T A;  3GOZ A;  4IM6 A;  1GWB A;  4CC4 A;  3ZYI A;  3BZ5 A;  3WPI A;  5HDH A;  1A9N A;  4XOS A;  4U06 A;  1YRG A;  2BEX A;  1D0B A;  3CVR A;  3UL9 A;  3W3K A;  5IJD A;  4R5C A;  1M9L A;  4PQ8 A;  1W8A A;  1LTX A;  2Z64 A;  3WPF A;  5GMH A;  1OZN A;  2OMU A;  3VQ2 A;  4CP6 A;  4GT6 A;  2OMW A;  5FTT B;  4G8A A;  3PMH G;  3M18 A;  1WWL A;  2RR6 A;  2P1Q B;  3C6N B;  3WPB A;  4LSA A;  3M19 A;  4CIL A;  2XOT A;  3WPC A;  4LSX C;  2O6S A;  3SB4 A;  2JE1 A;  2WQW A;  4PSJ A;  1OTM A;  4FS7 A;  3FXI A;  4GLP A;  4BSR A;  3KJ4 A;  1IO0 A;  4QC0 A;  4PKI G;  3E4G A;  3WN4 A;  4M7E A;  4Y61 B;  1FS2 A;  5B0T A;  3RJ0 A;  5HZL B;  1XEC A;  4XGO A;  2Z63 A;  3WPH A;  2WQX A;  3W3L A;  2XWT C;  4LXS A;  1M9S A;  3RFE A;  1XKU A;  1FQV A;  2Q4G W;  2AST B;  1FO1 A;  3ULU A;  2V9S A;  5GS2 B;  4LI1 A;  4YEB B;  3RGX A;  5AWD A;  4R6G A;  2UZY A;  1OTO A;  4ARR A;  2ID5 A;  5IJB A;  4R5D A;  1O6S A;  4Z8G A;  4WYK A;  4RWT C;  3TSR E;  4TZH A;  4R08 A;  4P91 A;  3RGZ A;  4R6J A;  4B8C D;  3E2J A;  2OMZ A;  1OGQ A;  3ULV A;  3G3B A;  2OMV A;  5AWC A;  1O6V A; 
#chains in the Genus database with same CATH topology
 4LI2 A;  4XSQ A;  4R09 A;  1P8T A;  5B0N A;  1H6U A;  2P1P B;  4FMZ A;  4Z94 G;  2Z65 A;  3P72 A;  3OGM B;  3CIY A;  3C6O B;  4HQ1 A;  3G3A A;  4FCG A;  4LSC A;  4Q62 A;  4ECO A;  3OJA B;  4MQW X;  4Z64 C;  4CC4 C;  5AWB A;  4AY9 X;  2Z7X B;  3ULA A;  3VQ1 A;  2WFH A;  3DZE A;  2V70 A;  3E6J A;  4Q3G A;  5AWA A;  4EZG A;  1H6T A;  2BNH A;  2OMX A;  4ARN A;  4BSS A;  4RCW A;  2P1O B;  4V2E A;  4BV4 R;  4OQT A;  1DS9 A;  4Q3I A;  4Z61 C;  1P9A G;  2V9T B;  1QYY A;  4C2B B;  3UL7 A;  3O53 A;  5B4P A;  3WPE A;  2Y5Q A;  2RA8 A;  2UZX A;  3OGK B;  4J0M A;  4MN8 B;  2A0Z A;  3O6N A;  2OMT A;  4KNG A;  4V2C A;  1M0Z A;  4R07 A;  1OOK G;  2P1M B;  4RCA B;  1PGV A;  5D3I A;  2R9U A;  4V2D A;  4CNM A;  4K17 A;  1DFJ I;  4L3A A;  5A5C A;  1Z7X W;  3CIG A;  2WQU A;  1OTN A;  4R58 A;  2P1N B;  3ZYJ A;  4L3F A;  4M7E C;  4U08 A;  3W3G A;  3G04 C;  4QBZ A;  1K5G C;  3ZYO A;  3C6P B;  4LSX A;  3A79 B;  4PEQ B;  1JL5 A;  3G06 A;  4U09 A;  1XWD C;  4I6J B;  5CMN A;  3RIZ A;  2Z82 A;  1M10 B;  1U0N D;  3OGL B;  4H09 A;  4WP6 A;  4J4L A;  2ELL A;  4C2A B;  3JB9 j;  5IJC A;  1FT8 A;  4R6F A;  1KOO A;  5GMG A;  3RW7 A;  4LXR A;  2Z66 A;  3UN9 A;  4CNC A;  4P8S A;  3ZYN A;  2WQV A;  4R6A A;  4FD0 A;  4R0A A;  3G39 A;  3E3Z A;  2JQD A;  4PER A;  2Z81 A;  4NKH A;  4U7L A;  1DCE A;  4KT1 A;  4KXF B;  5CMP A;  1G9U A;  2ASS B;  1XCD A;  4AW4 A;  4NKG A;  2O6Q A;  3W3J A;  5LFN A;  4UFR A;  3OJA A;  1ZIW A;  4ECN A;  5GQR K;  2OMY A;  4FHO A;  1KOH A;  1XEU A;  4QXE A;  2Z7X A;  2JE0 A;  3RW6 A;  3UL8 A;  2CA6 A;  2Z62 A;  2FT3 A;  4Z79 A;  3WPD A;  5GS0 A;  1P8V A;  2IFG A;  3RFS A;  1A4Y A;  3WPG A;  4FDW A;  3W3M A;  1SQ0 B;  3W3N A;  5GMF A;  5IYX C;  5AZ5 A;  3RFJ A;  3REZ A;  2O6R A;  4BSU A;  1K5D C;  1O6T A;  3GOZ A;  4IM6 A;  1GWB A;  4CC4 A;  3ZYI A;  3BZ5 A;  3WPI A;  5HDH A;  1A9N A;  4XOS A;  4U06 A;  1YRG A;  2BEX A;  1D0B A;  3CVR A;  3UL9 A;  3W3K A;  5IJD A;  4R5C A;  1M9L A;  4PQ8 A;  1W8A A;  1LTX A;  2Z64 A;  3WPF A;  5GMH A;  1OZN A;  2OMU A;  3VQ2 A;  4CP6 A;  4GT6 A;  2OMW A;  5FTT B;  4G8A A;  3PMH G;  3M18 A;  1WWL A;  2RR6 A;  2P1Q B;  3C6N B;  3WPB A;  4LSA A;  3M19 A;  4CIL A;  2XOT A;  3WPC A;  4LSX C;  2O6S A;  3SB4 A;  2JE1 A;  2WQW A;  4PSJ A;  1OTM A;  4FS7 A;  3FXI A;  4GLP A;  4BSR A;  3KJ4 A;  1IO0 A;  4QC0 A;  4PKI G;  3E4G A;  3WN4 A;  4NZT M;  4M7E A;  4Y61 B;  1FS2 A;  5B0T A;  3RJ0 A;  5HZL B;  1XEC A;  4XGO A;  4NZR M;  2Z63 A;  3WPH A;  2WQX A;  3W3L A;  2XWT C;  4LXS A;  1M9S A;  3RFE A;  1XKU A;  1FQV A;  2Q4G W;  2AST B;  1FO1 A;  3ULU A;  2V9S A;  5GS2 B;  4LI1 A;  4YEB B;  3RGX A;  5AWD A;  4R6G A;  2UZY A;  1OTO A;  4ARR A;  2ID5 A;  5IJB A;  4R5D A;  1O6S A;  4Z8G A;  4WYK A;  4RWT C;  3TSR E;  4TZH A;  4R08 A;  4P91 A;  3RGZ A;  4R6J A;  4B8C D;  3E2J A;  2OMZ A;  1OGQ A;  3ULV A;  3G3B A;  2OMV A;  5AWC A;  1O6V A; 
#chains in the Genus database with same CATH homology
 4LI2 A;  4XSQ A;  4R09 A;  1P8T A;  5B0N A;  1H6U A;  2P1P B;  4FMZ A;  4Z94 G;  2Z65 A;  3P72 A;  3OGM B;  3CIY A;  3C6O B;  4HQ1 A;  3G3A A;  4FCG A;  4LSC A;  4Q62 A;  4ECO A;  3OJA B;  4MQW X;  4Z64 C;  4CC4 C;  5AWB A;  4AY9 X;  2Z7X B;  3ULA A;  3VQ1 A;  2WFH A;  3DZE A;  2V70 A;  3E6J A;  4Q3G A;  5AWA A;  4EZG A;  1H6T A;  2BNH A;  2OMX A;  4ARN A;  4BSS A;  4RCW A;  2P1O B;  4V2E A;  4BV4 R;  4OQT A;  1DS9 A;  4Q3I A;  4Z61 C;  1P9A G;  2V9T B;  1QYY A;  4C2B B;  3UL7 A;  3O53 A;  5B4P A;  3WPE A;  2Y5Q A;  2RA8 A;  2UZX A;  3OGK B;  4J0M A;  4MN8 B;  2A0Z A;  3O6N A;  2OMT A;  4KNG A;  4V2C A;  1M0Z A;  4R07 A;  1OOK G;  2P1M B;  4RCA B;  1PGV A;  5D3I A;  2R9U A;  4V2D A;  4CNM A;  4K17 A;  1DFJ I;  4L3A A;  5A5C A;  1Z7X W;  3CIG A;  2WQU A;  1OTN A;  4R58 A;  2P1N B;  3ZYJ A;  4L3F A;  4M7E C;  4U08 A;  3W3G A;  3G04 C;  4QBZ A;  1K5G C;  3ZYO A;  3C6P B;  4LSX A;  3A79 B;  4PEQ B;  1JL5 A;  3G06 A;  4U09 A;  1XWD C;  4I6J B;  5CMN A;  3RIZ A;  2Z82 A;  1M10 B;  1U0N D;  3OGL B;  4H09 A;  4WP6 A;  4J4L A;  2ELL A;  4C2A B;  3JB9 j;  5IJC A;  1FT8 A;  4R6F A;  1KOO A;  5GMG A;  3RW7 A;  4LXR A;  2Z66 A;  3UN9 A;  4CNC A;  4P8S A;  3ZYN A;  2WQV A;  4R6A A;  4FD0 A;  4R0A A;  3G39 A;  3E3Z A;  2JQD A;  4PER A;  2Z81 A;  4NKH A;  4U7L A;  1DCE A;  4KT1 A;  4KXF B;  5CMP A;  1G9U A;  2ASS B;  1XCD A;  4AW4 A;  4NKG A;  2O6Q A;  3W3J A;  5LFN A;  4UFR A;  3OJA A;  1ZIW A;  4ECN A;  5GQR K;  2OMY A;  4FHO A;  1KOH A;  1XEU A;  4QXE A;  2Z7X A;  2JE0 A;  3RW6 A;  3UL8 A;  2CA6 A;  2Z62 A;  2FT3 A;  4Z79 A;  3WPD A;  5GS0 A;  1P8V A;  2IFG A;  3RFS A;  1A4Y A;  3WPG A;  4FDW A;  3W3M A;  1SQ0 B;  3W3N A;  5GMF A;  5IYX C;  5AZ5 A;  3RFJ A;  3REZ A;  2O6R A;  4BSU A;  1K5D C;  1O6T A;  3GOZ A;  4IM6 A;  1GWB A;  4CC4 A;  3ZYI A;  3BZ5 A;  3WPI A;  5HDH A;  1A9N A;  4XOS A;  4U06 A;  1YRG A;  2BEX A;  1D0B A;  3CVR A;  3UL9 A;  3W3K A;  5IJD A;  4R5C A;  1M9L A;  4PQ8 A;  1W8A A;  1LTX A;  2Z64 A;  3WPF A;  5GMH A;  1OZN A;  2OMU A;  3VQ2 A;  4CP6 A;  4GT6 A;  2OMW A;  5FTT B;  4G8A A;  3PMH G;  3M18 A;  1WWL A;  2RR6 A;  2P1Q B;  3C6N B;  3WPB A;  4LSA A;  3M19 A;  4CIL A;  2XOT A;  3WPC A;  4LSX C;  2O6S A;  3SB4 A;  2JE1 A;  2WQW A;  4PSJ A;  1OTM A;  4FS7 A;  3FXI A;  4GLP A;  4BSR A;  3KJ4 A;  1IO0 A;  4QC0 A;  4PKI G;  3E4G A;  3WN4 A;  4M7E A;  4Y61 B;  1FS2 A;  5B0T A;  3RJ0 A;  5HZL B;  1XEC A;  4XGO A;  2Z63 A;  3WPH A;  2WQX A;  3W3L A;  2XWT C;  4LXS A;  1M9S A;  3RFE A;  1XKU A;  1FQV A;  2Q4G W;  2AST B;  1FO1 A;  3ULU A;  2V9S A;  5GS2 B;  4LI1 A;  4YEB B;  3RGX A;  5AWD A;  4R6G A;  2UZY A;  1OTO A;  4ARR A;  2ID5 A;  5IJB A;  4R5D A;  1O6S A;  4Z8G A;  4WYK A;  4RWT C;  3TSR E;  4TZH A;  4R08 A;  4P91 A;  3RGZ A;  4R6J A;  4B8C D;  3E2J A;  2OMZ A;  1OGQ A;  3ULV A;  3G3B A;  2OMV A;  5AWC A;  1O6V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...