4KT1A

Complex of r-spondin 1 with lgr4 extracellular domain
Total Genus 148
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
148
sequence length
504
structure length
461
Chain Sequence
PPLCAAPCSCDGDRRVDCSGKGLTAVPEGLSAFTQALDISMNNITQLPEDAFKNFPFLEELQLAGNDLSFIHPKALSGLKELKVLTLQNNQLKTVPSEAIRGLSALQSLRLDANHITSVPEDSFEGLVQLRHLWLDDNSLTEVPVHPLSNLPTLQALTLALNKISSIPDFAFTNLSSLVVLHLHNNKIRSLSQHCFDGLDNLETLDLNYNNLGEFPQAIKALPSLKELGFHSNSISVIPDGAFDGNPLLRTIHLYDNPLSFVGNSAFHNLSDLHSLVIRGASMVQQFPNLTGTVHLESLTLTGTKISSIPNNLCQEQKMLRTLDLSYNNIRDLPSFNGCHALEEISLQRNQIYQIKEGTFQGLISLRILDLSRNLIHEIHSRAFATLGPITNLDVSFNELTSFPTEGLNGLNQLKLVGNFKLKEALAAKDFVNLRSLSVPYAYQCCAFWGCIHCTPSTGHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Leucine-rich repeat-containing G-protein coupled receptor 4
publication title Structural basis for R-spondin recognition by LGR4/5/6 receptors
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hormone receptor/cell adhesion
total genus 148
structure length 461
sequence length 504
ec nomenclature
pdb deposition date 2013-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01462 LRRNT Leucine rich repeat N-terminal domain
A PF13855 LRR_8 Leucine rich repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 4kt1A01
4UFRA 4U7LA 2JQDA 4FD0A 4LI2A 4PERA 4FDWA 4R58A 4MN8B 3WPBA 5IYXC 4PKIG 5GS0A 4LSXC 5B0TA 1OTMA 3W3JA 3RW6A 4LI1A 3OJAB 3W3GA 4Q62A 3PMHG 4R5CA 4ARNA 5GMHA 4GLPA 2CA6A 1K5GC 4XSQA 3WN4A 3RFEA 5AZ5A 4LSXA 4Z8GA 2Z7XB 4G8AA 3RGZA 5AWBA 3OGKB 4FHOA 4V2DA 3VQ1A 4QXEA 3CVRA 3WPEA 4R6AA 4FCGA 3ZYOA 4MQWX 2ASSB 2R9UA 3C6NB 3E3ZA 4KNGA 1Z7XW 2UZXA 3WPFA 2O6SA 1DS9A 3E2JA 3JB9j 4RWTC 3O6NA 1KOHA 4BSRA 1XECA 2BNHA 2Y5QA 4Q3GA 5IJDA 1GWBA 1XCDA 4ECOA 3ULVA 3RW7A 2O6QA 4AY9X 4XGOA 3RFSA 3SB4A 1SQ0B 2JE0A 1XEUA 5LFNA 2RR6A 3DZEA 4WP6A 4V2CA 4HQ1A 3M18A 4XOSA 4CILA 2Z66A 3UN9A 5GS2B 3A79B 1LTXA 4R0AA 1OTNA 4KXFB 2WQXA 3RIZA 1D0BA 4R09A 3CIGA 4LXSA 3WPCA 4R6FA 4M7EC 3E4GA 4EZGA 2FT3A 4H09A 1O6VA 4ECNA 4RCAB 1A4YA 3WPHA 4LSAA 2P1OB 3G06A 4L3AA 1P8VA 3ZYIA 4Z94G 4Z61C 1DCEA 2P1PB 4M7EA 2RA8A 4K17A 5GMGA 2OMZA 3G39A 1M9SA 1OGQA 1OOKG 4I6JB 2OMXA 4L3FA 3REZA 1H6TA 4Q3IA 3WPDA 1IO0A 2ASTB 2Z62A 3UL8A 3O53A 3CIYA 4LXRA 2Z64A 2ID5A 5HDHA 4AW4A 2XOTA 4BV4R 2JE1A 5D3IA 4R6GA 3W3LA 1FT8A 4U06A 4RCWA 4U08A 4V2EA 4Z64C 3UL9A 2Z63A 1H6UA 5CMPA 3G3AA 2P1MB 4CC4C 4J4LA 4Y61B 3W3NA 1ZIWA 4IM6A 5AWAA 5GQRK 4R08A 3M19A 4J0MA 3C6OB 4U09A 4FS7A 3FXIA 3G04C 5AWDA 1XKUA 2V9SA 1FQVA 5B0NA 1OTOA 3W3KA 4B8CD 1PGVA 2WQVA 4CC4A 3GOZA 2OMYA 4Z79A 1O6TA 3ZYJA 2P1QB 4QBZA 4CP6A 4P91A 2OMVA 3RFJA 5IJCA 4ARRA 3ULAA 1OZNA 2Z81A 4GT6A 1FO1A 4NKHA 2Z82A 3OGLB 2WQUA 4PQ8A 2P1NB 3W3MA 3ZYNA 2V70A 1KOOA 1M9LA 1U0ND 2Z65A 1YRGA 2IFGA 1G9UA 3C6PB 4R07A 4FMZA 4KT1A 3BZ5A 1P9AG 4LSCA 2OMUA 4TZHA 5CMNA 4CNMA 1M0ZA 3E6JA 2XWTC 1XWDC 4BSUA 4OQTA 5FTTB 4QC0A 3WPIA 4CNCA 3RJ0A 3ULUA 4R6JA 2Q4GW 1W8AA 2A0ZA 5A5CA 4C2BB 1K5DC 4BSSA 3G3BA 2O6RA 2BEXA 5AWCA 4YEBB 3RGXA 4PSJA 3OJAA 1DFJI 4PEQB 4WYKA 1WWLA 4C2AB 2OMWA 5HZLB 3KJ4A 4NKGA 3VQ2A 1QYYA 5GMFA 3UL7A 2WQWA 1FS2A 3OGMB 4P8SA 1M10B 5IJBA 1JL5A 1A9NA 2Z7XA 2ELLA 3TSRE 1O6SA 2UZYA 4R5DA 3WPGA 3P72A 2OMTA 2WFHA 2V9TB 5B4PA 1P8TA
chains in the Genus database with same CATH superfamily
4UFRA 4U7LA 2JQDA 4FD0A 4LI2A 4PERA 4FDWA 4R58A 4MN8B 3WPBA 5IYXC 4PKIG 5GS0A 4LSXC 5B0TA 1OTMA 3W3JA 3RW6A 4LI1A 3OJAB 3W3GA 4Q62A 3PMHG 4R5CA 4ARNA 5GMHA 4GLPA 2CA6A 1K5GC 4XSQA 3WN4A 3RFEA 5AZ5A 4LSXA 4Z8GA 2Z7XB 4G8AA 3RGZA 5AWBA 3OGKB 4FHOA 4V2DA 3VQ1A 4QXEA 3CVRA 3WPEA 4R6AA 4FCGA 3ZYOA 4MQWX 2ASSB 2R9UA 3C6NB 3E3ZA 4KNGA 1Z7XW 2UZXA 3WPFA 2O6SA 1DS9A 3E2JA 3JB9j 4RWTC 3O6NA 1KOHA 4BSRA 1XECA 2BNHA 2Y5QA 4Q3GA 5IJDA 4NZRM 1GWBA 1XCDA 4ECOA 3ULVA 3RW7A 2O6QA 4AY9X 4XGOA 3RFSA 3SB4A 1SQ0B 2JE0A 1XEUA 5LFNA 2RR6A 3DZEA 4WP6A 4V2CA 4HQ1A 3M18A 4XOSA 4CILA 2Z66A 3UN9A 5GS2B 3A79B 1LTXA 4R0AA 1OTNA 4KXFB 2WQXA 3RIZA 1D0BA 4R09A 3CIGA 4LXSA 3WPCA 4R6FA 4M7EC 3E4GA 4EZGA 2FT3A 4H09A 1O6VA 4ECNA 4RCAB 1A4YA 3WPHA 4LSAA 2P1OB 3G06A 4L3AA 1P8VA 3ZYIA 4Z94G 4Z61C 1DCEA 2P1PB 4M7EA 2RA8A 4K17A 5GMGA 2OMZA 3G39A 1M9SA 1OGQA 1OOKG 4I6JB 2OMXA 4L3FA 3REZA 1H6TA 4Q3IA 3WPDA 1IO0A 2ASTB 2Z62A 3UL8A 3O53A 3CIYA 4LXRA 2Z64A 2ID5A 5HDHA 4AW4A 4NZTM 2XOTA 4BV4R 2JE1A 5D3IA 4R6GA 3W3LA 1FT8A 4U06A 4RCWA 4U08A 4V2EA 4Z64C 3UL9A 2Z63A 1H6UA 5CMPA 3G3AA 2P1MB 4CC4C 4J4LA 4Y61B 3W3NA 1ZIWA 4IM6A 5AWAA 5GQRK 4R08A 3M19A 4J0MA 3C6OB 4U09A 4FS7A 3FXIA 3G04C 5AWDA 1XKUA 2V9SA 1FQVA 5B0NA 1OTOA 3W3KA 4B8CD 1PGVA 2WQVA 4CC4A 3GOZA 2OMYA 4Z79A 1O6TA 3ZYJA 2P1QB 4QBZA 4CP6A 4P91A 2OMVA 3RFJA 5IJCA 4ARRA 3ULAA 1OZNA 2Z81A 4GT6A 1FO1A 4NKHA 2Z82A 3OGLB 2WQUA 4PQ8A 2P1NB 3W3MA 3ZYNA 2V70A 1KOOA 1M9LA 1U0ND 2Z65A 1YRGA 2IFGA 1G9UA 3C6PB 4R07A 4FMZA 4KT1A 3BZ5A 1P9AG 4LSCA 2OMUA 4TZHA 5CMNA 4CNMA 1M0ZA 3E6JA 2XWTC 1XWDC 4BSUA 4OQTA 5FTTB 4QC0A 3WPIA 4CNCA 3RJ0A 3ULUA 4R6JA 2Q4GW 1W8AA 2A0ZA 5A5CA 4C2BB 1K5DC 4BSSA 3G3BA 2O6RA 2BEXA 5AWCA 4YEBB 3RGXA 4PSJA 3OJAA 1DFJI 4PEQB 4WYKA 1WWLA 4C2AB 2OMWA 5HZLB 3KJ4A 4NKGA 3VQ2A 1QYYA 5GMFA 3UL7A 2WQWA 1FS2A 3OGMB 4P8SA 1M10B 5IJBA 1JL5A 1A9NA 2Z7XA 2ELLA 3TSRE 1O6SA 2UZYA 4R5DA 3WPGA 3P72A 2OMTA 2WFHA 2V9TB 5B4PA 1P8TA
chains in the Genus database with same CATH topology
4UFRA 4U7LA 2JQDA 4FD0A 4LI2A 4PERA 4FDWA 4R58A 4MN8B 3WPBA 5IYXC 4PKIG 5GS0A 4LSXC 5B0TA 1OTMA 3W3JA 3RW6A 4LI1A 3OJAB 3W3GA 4Q62A 3PMHG 4R5CA 4ARNA 5GMHA 4GLPA 2CA6A 1K5GC 4XSQA 3WN4A 3RFEA 5AZ5A 4LSXA 4Z8GA 2Z7XB 4G8AA 3RGZA 5AWBA 3OGKB 4FHOA 4V2DA 3VQ1A 4QXEA 3CVRA 3WPEA 4R6AA 4FCGA 3ZYOA 4MQWX 2ASSB 2R9UA 3C6NB 3E3ZA 4KNGA 1Z7XW 2UZXA 3WPFA 2O6SA 1DS9A 3E2JA 3JB9j 4RWTC 3O6NA 1KOHA 4BSRA 1XECA 2BNHA 2Y5QA 4Q3GA 5IJDA 1GWBA 1XCDA 4ECOA 3ULVA 3RW7A 2O6QA 4AY9X 4XGOA 3RFSA 3SB4A 1SQ0B 2JE0A 1XEUA 5LFNA 2RR6A 3DZEA 4WP6A 4V2CA 4HQ1A 3M18A 4XOSA 4CILA 2Z66A 3UN9A 5GS2B 3A79B 1LTXA 4R0AA 1OTNA 4KXFB 2WQXA 3RIZA 1D0BA 4R09A 3CIGA 4LXSA 3WPCA 4R6FA 4M7EC 3E4GA 4EZGA 2FT3A 4H09A 1O6VA 4ECNA 4RCAB 1A4YA 3WPHA 4LSAA 2P1OB 3G06A 4L3AA 1P8VA 3ZYIA 4Z94G 4Z61C 1DCEA 2P1PB 4M7EA 2RA8A 4K17A 5GMGA 2OMZA 3G39A 1M9SA 1OGQA 1OOKG 4I6JB 2OMXA 4L3FA 3REZA 1H6TA 4Q3IA 3WPDA 1IO0A 2ASTB 2Z62A 3UL8A 3O53A 3CIYA 4LXRA 2Z64A 2ID5A 5HDHA 4AW4A 2XOTA 4BV4R 2JE1A 5D3IA 4R6GA 3W3LA 1FT8A 4U06A 4RCWA 4U08A 4V2EA 4Z64C 3UL9A 2Z63A 1H6UA 5CMPA 3G3AA 2P1MB 4CC4C 4J4LA 4Y61B 3W3NA 1ZIWA 4IM6A 5AWAA 5GQRK 4R08A 3M19A 4J0MA 3C6OB 4U09A 4FS7A 3FXIA 3G04C 5AWDA 1XKUA 2V9SA 1FQVA 5B0NA 1OTOA 3W3KA 4B8CD 1PGVA 2WQVA 4CC4A 3GOZA 2OMYA 4Z79A 1O6TA 3ZYJA 2P1QB 4QBZA 4CP6A 4P91A 2OMVA 3RFJA 5IJCA 4ARRA 3ULAA 1OZNA 2Z81A 4GT6A 1FO1A 4NKHA 2Z82A 3OGLB 2WQUA 4PQ8A 2P1NB 3W3MA 3ZYNA 2V70A 1KOOA 1M9LA 1U0ND 2Z65A 1YRGA 2IFGA 1G9UA 3C6PB 4R07A 4FMZA 4KT1A 3BZ5A 1P9AG 4LSCA 2OMUA 4TZHA 5CMNA 4CNMA 1M0ZA 3E6JA 2XWTC 1XWDC 4BSUA 4OQTA 5FTTB 4QC0A 3WPIA 4CNCA 3RJ0A 3ULUA 4R6JA 2Q4GW 1W8AA 2A0ZA 5A5CA 4C2BB 1K5DC 4BSSA 3G3BA 2O6RA 2BEXA 5AWCA 4YEBB 3RGXA 4PSJA 3OJAA 1DFJI 4PEQB 4WYKA 1WWLA 4C2AB 2OMWA 5HZLB 3KJ4A 4NKGA 3VQ2A 1QYYA 5GMFA 3UL7A 2WQWA 1FS2A 3OGMB 4P8SA 1M10B 5IJBA 1JL5A 1A9NA 2Z7XA 2ELLA 3TSRE 1O6SA 2UZYA 4R5DA 3WPGA 3P72A 2OMTA 2WFHA 2V9TB 5B4PA 1P8TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UFR A;  4U7L A;  2JQD A;  4FD0 A;  4LI2 A;  4PER A;  4FDW A;  4R58 A;  4MN8 B;  3WPB A;  5IYX C;  4PKI G;  5GS0 A;  4LSX C;  5B0T A;  1OTM A;  3W3J A;  3RW6 A;  4LI1 A;  3OJA B;  3W3G A;  4Q62 A;  3PMH G;  4R5C A;  4ARN A;  5GMH A;  4GLP A;  2CA6 A;  1K5G C;  4XSQ A;  3WN4 A;  3RFE A;  5AZ5 A;  4LSX A;  4Z8G A;  2Z7X B;  4G8A A;  3RGZ A;  5AWB A;  3OGK B;  4FHO A;  4V2D A;  3VQ1 A;  4QXE A;  3CVR A;  3WPE A;  4R6A A;  4FCG A;  3ZYO A;  4MQW X;  2ASS B;  2R9U A;  3C6N B;  3E3Z A;  4KNG A;  1Z7X W;  2UZX A;  3WPF A;  2O6S A;  1DS9 A;  3E2J A;  3JB9 j;  4RWT C;  3O6N A;  1KOH A;  4BSR A;  1XEC A;  2BNH A;  2Y5Q A;  4Q3G A;  5IJD A;  1GWB A;  1XCD A;  4ECO A;  3ULV A;  3RW7 A;  2O6Q A;  4AY9 X;  4XGO A;  3RFS A;  3SB4 A;  1SQ0 B;  2JE0 A;  1XEU A;  5LFN A;  2RR6 A;  3DZE A;  4WP6 A;  4V2C A;  4HQ1 A;  3M18 A;  4XOS A;  4CIL A;  2Z66 A;  3UN9 A;  5GS2 B;  3A79 B;  1LTX A;  4R0A A;  1OTN A;  4KXF B;  2WQX A;  3RIZ A;  1D0B A;  4R09 A;  3CIG A;  4LXS A;  3WPC A;  4R6F A;  4M7E C;  3E4G A;  4EZG A;  2FT3 A;  4H09 A;  1O6V A;  4ECN A;  4RCA B;  1A4Y A;  3WPH A;  4LSA A;  2P1O B;  3G06 A;  4L3A A;  1P8V A;  3ZYI A;  4Z94 G;  4Z61 C;  1DCE A;  2P1P B;  4M7E A;  2RA8 A;  4K17 A;  5GMG A;  2OMZ A;  3G39 A;  1M9S A;  1OGQ A;  1OOK G;  4I6J B;  2OMX A;  4L3F A;  3REZ A;  1H6T A;  4Q3I A;  3WPD A;  1IO0 A;  2AST B;  2Z62 A;  3UL8 A;  3O53 A;  3CIY A;  4LXR A;  2Z64 A;  2ID5 A;  5HDH A;  4AW4 A;  2XOT A;  4BV4 R;  2JE1 A;  5D3I A;  4R6G A;  3W3L A;  1FT8 A;  4U06 A;  4RCW A;  4U08 A;  4V2E A;  4Z64 C;  3UL9 A;  2Z63 A;  1H6U A;  5CMP A;  3G3A A;  2P1M B;  4CC4 C;  4J4L A;  4Y61 B;  3W3N A;  1ZIW A;  4IM6 A;  5AWA A;  5GQR K;  4R08 A;  3M19 A;  4J0M A;  3C6O B;  4U09 A;  4FS7 A;  3FXI A;  3G04 C;  5AWD A;  1XKU A;  2V9S A;  1FQV A;  5B0N A;  1OTO A;  3W3K A;  4B8C D;  1PGV A;  2WQV A;  4CC4 A;  3GOZ A;  2OMY A;  4Z79 A;  1O6T A;  3ZYJ A;  2P1Q B;  4QBZ A;  4CP6 A;  4P91 A;  2OMV A;  3RFJ A;  5IJC A;  4ARR A;  3ULA A;  1OZN A;  2Z81 A;  4GT6 A;  1FO1 A;  4NKH A;  2Z82 A;  3OGL B;  2WQU A;  4PQ8 A;  2P1N B;  3W3M A;  3ZYN A;  2V70 A;  1KOO A;  1M9L A;  1U0N D;  2Z65 A;  1YRG A;  2IFG A;  1G9U A;  3C6P B;  4R07 A;  4FMZ A;  4KT1 A;  3BZ5 A;  1P9A G;  4LSC A;  2OMU A;  4TZH A;  5CMN A;  4CNM A;  1M0Z A;  3E6J A;  2XWT C;  1XWD C;  4BSU A;  4OQT A;  5FTT B;  4QC0 A;  3WPI A;  4CNC A;  3RJ0 A;  3ULU A;  4R6J A;  2Q4G W;  1W8A A;  2A0Z A;  5A5C A;  4C2B B;  1K5D C;  4BSS A;  3G3B A;  2O6R A;  2BEX A;  5AWC A;  4YEB B;  3RGX A;  4PSJ A;  3OJA A;  1DFJ I;  4PEQ B;  4WYK A;  1WWL A;  4C2A B;  2OMW A;  5HZL B;  3KJ4 A;  4NKG A;  3VQ2 A;  1QYY A;  5GMF A;  3UL7 A;  2WQW A;  1FS2 A;  3OGM B;  4P8S A;  1M10 B;  5IJB A;  1JL5 A;  1A9N A;  2Z7X A;  2ELL A;  3TSR E;  1O6S A;  2UZY A;  4R5D A;  3WPG A;  3P72 A;  2OMT A;  2WFH A;  2V9T B;  5B4P A;  1P8T A; 
#chains in the Genus database with same CATH topology
 4UFR A;  4U7L A;  2JQD A;  4FD0 A;  4LI2 A;  4PER A;  4FDW A;  4R58 A;  4MN8 B;  3WPB A;  5IYX C;  4PKI G;  5GS0 A;  4LSX C;  5B0T A;  1OTM A;  3W3J A;  3RW6 A;  4LI1 A;  3OJA B;  3W3G A;  4Q62 A;  3PMH G;  4R5C A;  4ARN A;  5GMH A;  4GLP A;  2CA6 A;  1K5G C;  4XSQ A;  3WN4 A;  3RFE A;  5AZ5 A;  4LSX A;  4Z8G A;  2Z7X B;  4G8A A;  3RGZ A;  5AWB A;  3OGK B;  4FHO A;  4V2D A;  3VQ1 A;  4QXE A;  3CVR A;  3WPE A;  4R6A A;  4FCG A;  3ZYO A;  4MQW X;  2ASS B;  2R9U A;  3C6N B;  3E3Z A;  4KNG A;  1Z7X W;  2UZX A;  3WPF A;  2O6S A;  1DS9 A;  3E2J A;  3JB9 j;  4RWT C;  3O6N A;  1KOH A;  4BSR A;  1XEC A;  2BNH A;  2Y5Q A;  4Q3G A;  5IJD A;  4NZR M;  1GWB A;  1XCD A;  4ECO A;  3ULV A;  3RW7 A;  2O6Q A;  4AY9 X;  4XGO A;  3RFS A;  3SB4 A;  1SQ0 B;  2JE0 A;  1XEU A;  5LFN A;  2RR6 A;  3DZE A;  4WP6 A;  4V2C A;  4HQ1 A;  3M18 A;  4XOS A;  4CIL A;  2Z66 A;  3UN9 A;  5GS2 B;  3A79 B;  1LTX A;  4R0A A;  1OTN A;  4KXF B;  2WQX A;  3RIZ A;  1D0B A;  4R09 A;  3CIG A;  4LXS A;  3WPC A;  4R6F A;  4M7E C;  3E4G A;  4EZG A;  2FT3 A;  4H09 A;  1O6V A;  4ECN A;  4RCA B;  1A4Y A;  3WPH A;  4LSA A;  2P1O B;  3G06 A;  4L3A A;  1P8V A;  3ZYI A;  4Z94 G;  4Z61 C;  1DCE A;  2P1P B;  4M7E A;  2RA8 A;  4K17 A;  5GMG A;  2OMZ A;  3G39 A;  1M9S A;  1OGQ A;  1OOK G;  4I6J B;  2OMX A;  4L3F A;  3REZ A;  1H6T A;  4Q3I A;  3WPD A;  1IO0 A;  2AST B;  2Z62 A;  3UL8 A;  3O53 A;  3CIY A;  4LXR A;  2Z64 A;  2ID5 A;  5HDH A;  4AW4 A;  4NZT M;  2XOT A;  4BV4 R;  2JE1 A;  5D3I A;  4R6G A;  3W3L A;  1FT8 A;  4U06 A;  4RCW A;  4U08 A;  4V2E A;  4Z64 C;  3UL9 A;  2Z63 A;  1H6U A;  5CMP A;  3G3A A;  2P1M B;  4CC4 C;  4J4L A;  4Y61 B;  3W3N A;  1ZIW A;  4IM6 A;  5AWA A;  5GQR K;  4R08 A;  3M19 A;  4J0M A;  3C6O B;  4U09 A;  4FS7 A;  3FXI A;  3G04 C;  5AWD A;  1XKU A;  2V9S A;  1FQV A;  5B0N A;  1OTO A;  3W3K A;  4B8C D;  1PGV A;  2WQV A;  4CC4 A;  3GOZ A;  2OMY A;  4Z79 A;  1O6T A;  3ZYJ A;  2P1Q B;  4QBZ A;  4CP6 A;  4P91 A;  2OMV A;  3RFJ A;  5IJC A;  4ARR A;  3ULA A;  1OZN A;  2Z81 A;  4GT6 A;  1FO1 A;  4NKH A;  2Z82 A;  3OGL B;  2WQU A;  4PQ8 A;  2P1N B;  3W3M A;  3ZYN A;  2V70 A;  1KOO A;  1M9L A;  1U0N D;  2Z65 A;  1YRG A;  2IFG A;  1G9U A;  3C6P B;  4R07 A;  4FMZ A;  4KT1 A;  3BZ5 A;  1P9A G;  4LSC A;  2OMU A;  4TZH A;  5CMN A;  4CNM A;  1M0Z A;  3E6J A;  2XWT C;  1XWD C;  4BSU A;  4OQT A;  5FTT B;  4QC0 A;  3WPI A;  4CNC A;  3RJ0 A;  3ULU A;  4R6J A;  2Q4G W;  1W8A A;  2A0Z A;  5A5C A;  4C2B B;  1K5D C;  4BSS A;  3G3B A;  2O6R A;  2BEX A;  5AWC A;  4YEB B;  3RGX A;  4PSJ A;  3OJA A;  1DFJ I;  4PEQ B;  4WYK A;  1WWL A;  4C2A B;  2OMW A;  5HZL B;  3KJ4 A;  4NKG A;  3VQ2 A;  1QYY A;  5GMF A;  3UL7 A;  2WQW A;  1FS2 A;  3OGM B;  4P8S A;  1M10 B;  5IJB A;  1JL5 A;  1A9N A;  2Z7X A;  2ELL A;  3TSR E;  1O6S A;  2UZY A;  4R5D A;  3WPG A;  3P72 A;  2OMT A;  2WFH A;  2V9T B;  5B4P A;  1P8T A; 
#chains in the Genus database with same CATH homology
 4UFR A;  4U7L A;  2JQD A;  4FD0 A;  4LI2 A;  4PER A;  4FDW A;  4R58 A;  4MN8 B;  3WPB A;  5IYX C;  4PKI G;  5GS0 A;  4LSX C;  5B0T A;  1OTM A;  3W3J A;  3RW6 A;  4LI1 A;  3OJA B;  3W3G A;  4Q62 A;  3PMH G;  4R5C A;  4ARN A;  5GMH A;  4GLP A;  2CA6 A;  1K5G C;  4XSQ A;  3WN4 A;  3RFE A;  5AZ5 A;  4LSX A;  4Z8G A;  2Z7X B;  4G8A A;  3RGZ A;  5AWB A;  3OGK B;  4FHO A;  4V2D A;  3VQ1 A;  4QXE A;  3CVR A;  3WPE A;  4R6A A;  4FCG A;  3ZYO A;  4MQW X;  2ASS B;  2R9U A;  3C6N B;  3E3Z A;  4KNG A;  1Z7X W;  2UZX A;  3WPF A;  2O6S A;  1DS9 A;  3E2J A;  3JB9 j;  4RWT C;  3O6N A;  1KOH A;  4BSR A;  1XEC A;  2BNH A;  2Y5Q A;  4Q3G A;  5IJD A;  1GWB A;  1XCD A;  4ECO A;  3ULV A;  3RW7 A;  2O6Q A;  4AY9 X;  4XGO A;  3RFS A;  3SB4 A;  1SQ0 B;  2JE0 A;  1XEU A;  5LFN A;  2RR6 A;  3DZE A;  4WP6 A;  4V2C A;  4HQ1 A;  3M18 A;  4XOS A;  4CIL A;  2Z66 A;  3UN9 A;  5GS2 B;  3A79 B;  1LTX A;  4R0A A;  1OTN A;  4KXF B;  2WQX A;  3RIZ A;  1D0B A;  4R09 A;  3CIG A;  4LXS A;  3WPC A;  4R6F A;  4M7E C;  3E4G A;  4EZG A;  2FT3 A;  4H09 A;  1O6V A;  4ECN A;  4RCA B;  1A4Y A;  3WPH A;  4LSA A;  2P1O B;  3G06 A;  4L3A A;  1P8V A;  3ZYI A;  4Z94 G;  4Z61 C;  1DCE A;  2P1P B;  4M7E A;  2RA8 A;  4K17 A;  5GMG A;  2OMZ A;  3G39 A;  1M9S A;  1OGQ A;  1OOK G;  4I6J B;  2OMX A;  4L3F A;  3REZ A;  1H6T A;  4Q3I A;  3WPD A;  1IO0 A;  2AST B;  2Z62 A;  3UL8 A;  3O53 A;  3CIY A;  4LXR A;  2Z64 A;  2ID5 A;  5HDH A;  4AW4 A;  2XOT A;  4BV4 R;  2JE1 A;  5D3I A;  4R6G A;  3W3L A;  1FT8 A;  4U06 A;  4RCW A;  4U08 A;  4V2E A;  4Z64 C;  3UL9 A;  2Z63 A;  1H6U A;  5CMP A;  3G3A A;  2P1M B;  4CC4 C;  4J4L A;  4Y61 B;  3W3N A;  1ZIW A;  4IM6 A;  5AWA A;  5GQR K;  4R08 A;  3M19 A;  4J0M A;  3C6O B;  4U09 A;  4FS7 A;  3FXI A;  3G04 C;  5AWD A;  1XKU A;  2V9S A;  1FQV A;  5B0N A;  1OTO A;  3W3K A;  4B8C D;  1PGV A;  2WQV A;  4CC4 A;  3GOZ A;  2OMY A;  4Z79 A;  1O6T A;  3ZYJ A;  2P1Q B;  4QBZ A;  4CP6 A;  4P91 A;  2OMV A;  3RFJ A;  5IJC A;  4ARR A;  3ULA A;  1OZN A;  2Z81 A;  4GT6 A;  1FO1 A;  4NKH A;  2Z82 A;  3OGL B;  2WQU A;  4PQ8 A;  2P1N B;  3W3M A;  3ZYN A;  2V70 A;  1KOO A;  1M9L A;  1U0N D;  2Z65 A;  1YRG A;  2IFG A;  1G9U A;  3C6P B;  4R07 A;  4FMZ A;  4KT1 A;  3BZ5 A;  1P9A G;  4LSC A;  2OMU A;  4TZH A;  5CMN A;  4CNM A;  1M0Z A;  3E6J A;  2XWT C;  1XWD C;  4BSU A;  4OQT A;  5FTT B;  4QC0 A;  3WPI A;  4CNC A;  3RJ0 A;  3ULU A;  4R6J A;  2Q4G W;  1W8A A;  2A0Z A;  5A5C A;  4C2B B;  1K5D C;  4BSS A;  3G3B A;  2O6R A;  2BEX A;  5AWC A;  4YEB B;  3RGX A;  4PSJ A;  3OJA A;  1DFJ I;  4PEQ B;  4WYK A;  1WWL A;  4C2A B;  2OMW A;  5HZL B;  3KJ4 A;  4NKG A;  3VQ2 A;  1QYY A;  5GMF A;  3UL7 A;  2WQW A;  1FS2 A;  3OGM B;  4P8S A;  1M10 B;  5IJB A;  1JL5 A;  1A9N A;  2Z7X A;  2ELL A;  3TSR E;  1O6S A;  2UZY A;  4R5D A;  3WPG A;  3P72 A;  2OMT A;  2WFH A;  2V9T B;  5B4P A;  1P8T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...