4KT1A

Complex of r-spondin 1 with lgr4 extracellular domain
Total Genus 148
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
148
sequence length
504
structure length
461
Chain Sequence
PPLCAAPCSCDGDRRVDCSGKGLTAVPEGLSAFTQALDISMNNITQLPEDAFKNFPFLEELQLAGNDLSFIHPKALSGLKELKVLTLQNNQLKTVPSEAIRGLSALQSLRLDANHITSVPEDSFEGLVQLRHLWLDDNSLTEVPVHPLSNLPTLQALTLALNKISSIPDFAFTNLSSLVVLHLHNNKIRSLSQHCFDGLDNLETLDLNYNNLGEFPQAIKALPSLKELGFHSNSISVIPDGAFDGNPLLRTIHLYDNPLSFVGNSAFHNLSDLHSLVIRGASMVQQFPNLTGTVHLESLTLTGTKISSIPNNLCQEQKMLRTLDLSYNNIRDLPSFNGCHALEEISLQRNQIYQIKEGTFQGLISLRILDLSRNLIHEIHSRAFATLGPITNLDVSFNELTSFPTEGLNGLNQLKLVGNFKLKEALAAKDFVNLRSLSVPYAYQCCAFWGCIHCTPSTGHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hormone receptor/cell adhesion
molecule keywords Leucine-rich repeat-containing G-protein coupled receptor 4
publication title Structural basis for R-spondin recognition by LGR4/5/6 receptors
pubmed doi rcsb
source organism Homo sapiens
total genus 148
structure length 461
sequence length 504
ec nomenclature
pdb deposition date 2013-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01462 LRRNT Leucine rich repeat N-terminal domain
A PF13855 LRR_8 Leucine rich repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 4kt1A01
4CNCA 4ARNA 3REZA 3C6OB 4RWTC 3E4GA 4MN8B 4J0MA 3RFJA 2Z64A 3RW6A 4PSJA 4Z61C 1KOHA 3C6NB 4YEBB 3ZYIA 5HZLB 3E6JA 1WWLA 3WPGA 4HQ1A 4B8CD 4L3FA 4XGOA 4PQ8A 2IFGA 4U7LA 1FO1A 4U09A 3ZYJA 1O6TA 4Y61B 2Z81A 4LI1A 2OMTA 2Z7XA 5CMNA 4BSUA 1QYYA 3O53A 1K5DC 5IJBA 1PGVA 4XSQA 2CA6A 4RCAB 4IM6A 4ECOA 3UL8A 4R0AA 4G8AA 3C6PB 2WQWA 4KT1A 3WPCA 4PKIG 3WPFA 2JE0A 2OMUA 2Z82A 4LSCA 3M18A 3OGLB 2O6QA 5AWBA 2V9TB 2JE1A 1O6VA 2ID5A 5FTTB 1LTXA 1JL5A 2OMVA 4Q62A 4P91A 4FMZA 2BNHA 4WYKA 3O6NA 4U08A 3TSRE 1KOOA 4GLPA 1D0BA 4R5CA 1Z7XW 4MQWX 5AWCA 2Q4GW 1DS9A 2RA8A 3RGXA 2O6RA 2XOTA 2XWTC 3WPEA 5HDHA 4R6FA 3VQ1A 4R58A 3OJAA 5D3IA 4R6JA 5B0TA 2RR6A 3WN4A 1P9AG 2JQDA 3WPDA 4ECNA 4R6AA 1FQVA 4R09A 4J4LA 4CNMA 2WQVA 4PERA 5AWDA 4NKHA 4Z64C 1OOKG 4U06A 3DZEA 4Z8GA 1FT8A 4BSSA 3RW7A 4RCWA 2OMZA 4V2EA 2WFHA 4C2AB 2OMYA 3UN9A 1ZIWA 4Q3GA 2R9UA 2P1PB 5IJDA 5AWAA 3WPBA 5IJCA 2OMWA 4NKGA 2Z62A 2Z7XB 4ARRA 5GS2B 4CILA 3OGKB 1XECA 2BEXA 3RGZA 2P1NB 1M9SA 4LXRA 4LI2A 1A9NA 3SB4A 1XCDA 4QXEA 4LSAA 4R08A 2ASTB 3UL9A 4LXSA 4WP6A 5IYXC 4R07A 3G06A 3E2JA 3UL7A 1P8TA 3BZ5A 3G04C 4FCGA 3GOZA 3W3MA 4CC4A 4Q3IA 1FS2A 3W3GA 4EZGA 4AW4A 3W3KA 1OTNA 4AY9X 1M10B 3OGMB 3ULAA 1M9LA 3ZYNA 3CIYA 4KNGA 1DFJI 1DCEA 3PMHG 1OZNA 5B4PA 5LFNA 4XOSA 4TZHA 4QBZA 4M7EC 3WPHA 4FS7A 1OTMA 2V9SA 3CVRA 1A4YA 1P8VA 4FHOA 2UZXA 1OTOA 1SQ0B 2Z65A 4I6JB 4M7EA 2P1MB 2WQXA 4OQTA 2Y5QA 4UFRA 3RFSA 3WPIA 4LSXA 3FXIA 3ULVA 4Z94G 2P1OB 3A79B 2WQUA 5A5CA 5AZ5A 5GQRK 4BV4R 4K17A 2O6SA 5B0NA 3ZYOA 1U0ND 1XWDC 2A0ZA 1O6SA 5GMFA 1M0ZA 1H6UA 3P72A 4QC0A 4FD0A 2Z66A 2P1QB 3CIGA 2ELLA 3VQ2A 2V70A 1G9UA 1H6TA 4V2CA 1OGQA 5GS0A 4P8SA 4CC4C 3E3ZA 3W3LA 2OMXA 5CMPA 4V2DA 3M19A 1GWBA 4R5DA 4FDWA 1K5GC 4CP6A 1YRGA 1XKUA 3RIZA 3G39A 4R6GA 2FT3A 4H09A 4PEQB 3G3BA 2ASSB 3KJ4A 3JB9j 3RJ0A 4Z79A 3W3NA 2Z63A 3G3AA 3ULUA 4KXFB 5GMHA 4C2BB 4LSXC 3OJAB 1W8AA 4GT6A 1XEUA 4L3AA 3W3JA 1IO0A 3RFEA 2UZYA 5GMGA 4BSRA
chains in the Genus database with same CATH superfamily
4CNCA 4ARNA 3REZA 3C6OB 4RWTC 3E4GA 4MN8B 4J0MA 3RFJA 2Z64A 3RW6A 4PSJA 4Z61C 1KOHA 3C6NB 4YEBB 3ZYIA 5HZLB 3E6JA 1WWLA 3WPGA 4HQ1A 4B8CD 4L3FA 4XGOA 4PQ8A 2IFGA 4U7LA 1FO1A 4U09A 3ZYJA 1O6TA 4Y61B 2Z81A 4LI1A 2OMTA 2Z7XA 5CMNA 4BSUA 1QYYA 3O53A 1K5DC 5IJBA 1PGVA 4XSQA 2CA6A 4RCAB 4IM6A 4ECOA 3UL8A 4R0AA 4G8AA 3C6PB 2WQWA 4KT1A 3WPCA 4PKIG 3WPFA 2JE0A 2OMUA 2Z82A 4LSCA 3M18A 3OGLB 2O6QA 5AWBA 2V9TB 2JE1A 1O6VA 2ID5A 5FTTB 1LTXA 1JL5A 2OMVA 4Q62A 4P91A 4FMZA 2BNHA 4WYKA 3O6NA 4U08A 3TSRE 1KOOA 4GLPA 1D0BA 4R5CA 1Z7XW 4MQWX 5AWCA 2Q4GW 1DS9A 2RA8A 3RGXA 2O6RA 2XOTA 2XWTC 3WPEA 5HDHA 4R6FA 3VQ1A 4R58A 3OJAA 5D3IA 4R6JA 5B0TA 2RR6A 3WN4A 1P9AG 2JQDA 3WPDA 4ECNA 4R6AA 1FQVA 4R09A 4J4LA 4CNMA 2WQVA 4PERA 5AWDA 4NKHA 4Z64C 1OOKG 4U06A 3DZEA 4Z8GA 1FT8A 4BSSA 3RW7A 4RCWA 2OMZA 4V2EA 2WFHA 4C2AB 2OMYA 3UN9A 1ZIWA 4Q3GA 2R9UA 2P1PB 5IJDA 5AWAA 3WPBA 5IJCA 2OMWA 4NKGA 2Z62A 2Z7XB 4ARRA 5GS2B 4CILA 3OGKB 1XECA 2BEXA 3RGZA 2P1NB 1M9SA 4NZTM 4LXRA 4LI2A 1A9NA 3SB4A 1XCDA 4QXEA 4LSAA 4R08A 2ASTB 3UL9A 4LXSA 4WP6A 5IYXC 4R07A 3G06A 3E2JA 3UL7A 4NZRM 1P8TA 3BZ5A 3G04C 4FCGA 3GOZA 3W3MA 4CC4A 4Q3IA 1FS2A 3W3GA 4EZGA 4AW4A 3W3KA 1OTNA 4AY9X 1M10B 3OGMB 3ULAA 1M9LA 3ZYNA 3CIYA 4KNGA 1DFJI 1DCEA 3PMHG 1OZNA 5B4PA 5LFNA 4XOSA 4TZHA 4QBZA 4M7EC 3WPHA 4FS7A 1OTMA 2V9SA 3CVRA 1A4YA 1P8VA 4FHOA 2UZXA 1OTOA 1SQ0B 2Z65A 4I6JB 4M7EA 2P1MB 2WQXA 4OQTA 2Y5QA 4UFRA 3RFSA 3WPIA 4LSXA 3FXIA 3ULVA 4Z94G 2P1OB 3A79B 2WQUA 5A5CA 5AZ5A 5GQRK 4BV4R 4K17A 2O6SA 5B0NA 3ZYOA 1U0ND 1XWDC 2A0ZA 1O6SA 5GMFA 1M0ZA 1H6UA 3P72A 4QC0A 4FD0A 2Z66A 2P1QB 3CIGA 2ELLA 3VQ2A 2V70A 1G9UA 1H6TA 4V2CA 1OGQA 5GS0A 4P8SA 4CC4C 3E3ZA 3W3LA 2OMXA 5CMPA 4V2DA 3M19A 1GWBA 4R5DA 4FDWA 1K5GC 4CP6A 1YRGA 1XKUA 3RIZA 3G39A 4R6GA 2FT3A 4H09A 4PEQB 3G3BA 2ASSB 3KJ4A 3JB9j 3RJ0A 4Z79A 3W3NA 2Z63A 3G3AA 3ULUA 4KXFB 5GMHA 4C2BB 4LSXC 3OJAB 1W8AA 4GT6A 1XEUA 4L3AA 3W3JA 1IO0A 3RFEA 2UZYA 5GMGA 4BSRA
chains in the Genus database with same CATH topology
4CNCA 4ARNA 3REZA 3C6OB 4RWTC 3E4GA 4MN8B 4J0MA 3RFJA 2Z64A 3RW6A 4PSJA 4Z61C 1KOHA 3C6NB 4YEBB 3ZYIA 5HZLB 3E6JA 1WWLA 3WPGA 4HQ1A 4B8CD 4L3FA 4XGOA 4PQ8A 2IFGA 4U7LA 1FO1A 4U09A 3ZYJA 1O6TA 4Y61B 2Z81A 4LI1A 2OMTA 2Z7XA 5CMNA 4BSUA 1QYYA 3O53A 1K5DC 5IJBA 1PGVA 4XSQA 2CA6A 4RCAB 4IM6A 4ECOA 3UL8A 4R0AA 4G8AA 3C6PB 2WQWA 4KT1A 3WPCA 4PKIG 3WPFA 2JE0A 2OMUA 2Z82A 4LSCA 3M18A 3OGLB 2O6QA 5AWBA 2V9TB 2JE1A 1O6VA 2ID5A 5FTTB 1LTXA 1JL5A 2OMVA 4Q62A 4P91A 4FMZA 2BNHA 4WYKA 3O6NA 4U08A 3TSRE 1KOOA 4GLPA 1D0BA 4R5CA 1Z7XW 4MQWX 5AWCA 2Q4GW 1DS9A 2RA8A 3RGXA 2O6RA 2XOTA 2XWTC 3WPEA 5HDHA 4R6FA 3VQ1A 4R58A 3OJAA 5D3IA 4R6JA 5B0TA 2RR6A 3WN4A 1P9AG 2JQDA 3WPDA 4ECNA 4R6AA 1FQVA 4R09A 4J4LA 4CNMA 2WQVA 4PERA 5AWDA 4NKHA 4Z64C 1OOKG 4U06A 3DZEA 4Z8GA 1FT8A 4BSSA 3RW7A 4RCWA 2OMZA 4V2EA 2WFHA 4C2AB 2OMYA 3UN9A 1ZIWA 4Q3GA 2R9UA 2P1PB 5IJDA 5AWAA 3WPBA 5IJCA 2OMWA 4NKGA 2Z62A 2Z7XB 4ARRA 5GS2B 4CILA 3OGKB 1XECA 2BEXA 3RGZA 2P1NB 1M9SA 4LXRA 4LI2A 1A9NA 3SB4A 1XCDA 4QXEA 4LSAA 4R08A 2ASTB 3UL9A 4LXSA 4WP6A 5IYXC 4R07A 3G06A 3E2JA 3UL7A 1P8TA 3BZ5A 3G04C 4FCGA 3GOZA 3W3MA 4CC4A 4Q3IA 1FS2A 3W3GA 4EZGA 4AW4A 3W3KA 1OTNA 4AY9X 1M10B 3OGMB 3ULAA 1M9LA 3ZYNA 3CIYA 4KNGA 1DFJI 1DCEA 3PMHG 1OZNA 5B4PA 5LFNA 4XOSA 4TZHA 4QBZA 4M7EC 3WPHA 4FS7A 1OTMA 2V9SA 3CVRA 1A4YA 1P8VA 4FHOA 2UZXA 1OTOA 1SQ0B 2Z65A 4I6JB 4M7EA 2P1MB 2WQXA 4OQTA 2Y5QA 4UFRA 3RFSA 3WPIA 4LSXA 3FXIA 3ULVA 4Z94G 2P1OB 3A79B 2WQUA 5A5CA 5AZ5A 5GQRK 4BV4R 4K17A 2O6SA 5B0NA 3ZYOA 1U0ND 1XWDC 2A0ZA 1O6SA 5GMFA 1M0ZA 1H6UA 3P72A 4QC0A 4FD0A 2Z66A 2P1QB 3CIGA 2ELLA 3VQ2A 2V70A 1G9UA 1H6TA 4V2CA 1OGQA 5GS0A 4P8SA 4CC4C 3E3ZA 3W3LA 2OMXA 5CMPA 4V2DA 3M19A 1GWBA 4R5DA 4FDWA 1K5GC 4CP6A 1YRGA 1XKUA 3RIZA 3G39A 4R6GA 2FT3A 4H09A 4PEQB 3G3BA 2ASSB 3KJ4A 3JB9j 3RJ0A 4Z79A 3W3NA 2Z63A 3G3AA 3ULUA 4KXFB 5GMHA 4C2BB 4LSXC 3OJAB 1W8AA 4GT6A 1XEUA 4L3AA 3W3JA 1IO0A 3RFEA 2UZYA 5GMGA 4BSRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CNC A;  4ARN A;  3REZ A;  3C6O B;  4RWT C;  3E4G A;  4MN8 B;  4J0M A;  3RFJ A;  2Z64 A;  3RW6 A;  4PSJ A;  4Z61 C;  1KOH A;  3C6N B;  4YEB B;  3ZYI A;  5HZL B;  3E6J A;  1WWL A;  3WPG A;  4HQ1 A;  4B8C D;  4L3F A;  4XGO A;  4PQ8 A;  2IFG A;  4U7L A;  1FO1 A;  4U09 A;  3ZYJ A;  1O6T A;  4Y61 B;  2Z81 A;  4LI1 A;  2OMT A;  2Z7X A;  5CMN A;  4BSU A;  1QYY A;  3O53 A;  1K5D C;  5IJB A;  1PGV A;  4XSQ A;  2CA6 A;  4RCA B;  4IM6 A;  4ECO A;  3UL8 A;  4R0A A;  4G8A A;  3C6P B;  2WQW A;  4KT1 A;  3WPC A;  4PKI G;  3WPF A;  2JE0 A;  2OMU A;  2Z82 A;  4LSC A;  3M18 A;  3OGL B;  2O6Q A;  5AWB A;  2V9T B;  2JE1 A;  1O6V A;  2ID5 A;  5FTT B;  1LTX A;  1JL5 A;  2OMV A;  4Q62 A;  4P91 A;  4FMZ A;  2BNH A;  4WYK A;  3O6N A;  4U08 A;  3TSR E;  1KOO A;  4GLP A;  1D0B A;  4R5C A;  1Z7X W;  4MQW X;  5AWC A;  2Q4G W;  1DS9 A;  2RA8 A;  3RGX A;  2O6R A;  2XOT A;  2XWT C;  3WPE A;  5HDH A;  4R6F A;  3VQ1 A;  4R58 A;  3OJA A;  5D3I A;  4R6J A;  5B0T A;  2RR6 A;  3WN4 A;  1P9A G;  2JQD A;  3WPD A;  4ECN A;  4R6A A;  1FQV A;  4R09 A;  4J4L A;  4CNM A;  2WQV A;  4PER A;  5AWD A;  4NKH A;  4Z64 C;  1OOK G;  4U06 A;  3DZE A;  4Z8G A;  1FT8 A;  4BSS A;  3RW7 A;  4RCW A;  2OMZ A;  4V2E A;  2WFH A;  4C2A B;  2OMY A;  3UN9 A;  1ZIW A;  4Q3G A;  2R9U A;  2P1P B;  5IJD A;  5AWA A;  3WPB A;  5IJC A;  2OMW A;  4NKG A;  2Z62 A;  2Z7X B;  4ARR A;  5GS2 B;  4CIL A;  3OGK B;  1XEC A;  2BEX A;  3RGZ A;  2P1N B;  1M9S A;  4LXR A;  4LI2 A;  1A9N A;  3SB4 A;  1XCD A;  4QXE A;  4LSA A;  4R08 A;  2AST B;  3UL9 A;  4LXS A;  4WP6 A;  5IYX C;  4R07 A;  3G06 A;  3E2J A;  3UL7 A;  1P8T A;  3BZ5 A;  3G04 C;  4FCG A;  3GOZ A;  3W3M A;  4CC4 A;  4Q3I A;  1FS2 A;  3W3G A;  4EZG A;  4AW4 A;  3W3K A;  1OTN A;  4AY9 X;  1M10 B;  3OGM B;  3ULA A;  1M9L A;  3ZYN A;  3CIY A;  4KNG A;  1DFJ I;  1DCE A;  3PMH G;  1OZN A;  5B4P A;  5LFN A;  4XOS A;  4TZH A;  4QBZ A;  4M7E C;  3WPH A;  4FS7 A;  1OTM A;  2V9S A;  3CVR A;  1A4Y A;  1P8V A;  4FHO A;  2UZX A;  1OTO A;  1SQ0 B;  2Z65 A;  4I6J B;  4M7E A;  2P1M B;  2WQX A;  4OQT A;  2Y5Q A;  4UFR A;  3RFS A;  3WPI A;  4LSX A;  3FXI A;  3ULV A;  4Z94 G;  2P1O B;  3A79 B;  2WQU A;  5A5C A;  5AZ5 A;  5GQR K;  4BV4 R;  4K17 A;  2O6S A;  5B0N A;  3ZYO A;  1U0N D;  1XWD C;  2A0Z A;  1O6S A;  5GMF A;  1M0Z A;  1H6U A;  3P72 A;  4QC0 A;  4FD0 A;  2Z66 A;  2P1Q B;  3CIG A;  2ELL A;  3VQ2 A;  2V70 A;  1G9U A;  1H6T A;  4V2C A;  1OGQ A;  5GS0 A;  4P8S A;  4CC4 C;  3E3Z A;  3W3L A;  2OMX A;  5CMP A;  4V2D A;  3M19 A;  1GWB A;  4R5D A;  4FDW A;  1K5G C;  4CP6 A;  1YRG A;  1XKU A;  3RIZ A;  3G39 A;  4R6G A;  2FT3 A;  4H09 A;  4PEQ B;  3G3B A;  2ASS B;  3KJ4 A;  3JB9 j;  3RJ0 A;  4Z79 A;  3W3N A;  2Z63 A;  3G3A A;  3ULU A;  4KXF B;  5GMH A;  4C2B B;  4LSX C;  3OJA B;  1W8A A;  4GT6 A;  1XEU A;  4L3A A;  3W3J A;  1IO0 A;  3RFE A;  2UZY A;  5GMG A;  4BSR A; 
#chains in the Genus database with same CATH topology
 4CNC A;  4ARN A;  3REZ A;  3C6O B;  4RWT C;  3E4G A;  4MN8 B;  4J0M A;  3RFJ A;  2Z64 A;  3RW6 A;  4PSJ A;  4Z61 C;  1KOH A;  3C6N B;  4YEB B;  3ZYI A;  5HZL B;  3E6J A;  1WWL A;  3WPG A;  4HQ1 A;  4B8C D;  4L3F A;  4XGO A;  4PQ8 A;  2IFG A;  4U7L A;  1FO1 A;  4U09 A;  3ZYJ A;  1O6T A;  4Y61 B;  2Z81 A;  4LI1 A;  2OMT A;  2Z7X A;  5CMN A;  4BSU A;  1QYY A;  3O53 A;  1K5D C;  5IJB A;  1PGV A;  4XSQ A;  2CA6 A;  4RCA B;  4IM6 A;  4ECO A;  3UL8 A;  4R0A A;  4G8A A;  3C6P B;  2WQW A;  4KT1 A;  3WPC A;  4PKI G;  3WPF A;  2JE0 A;  2OMU A;  2Z82 A;  4LSC A;  3M18 A;  3OGL B;  2O6Q A;  5AWB A;  2V9T B;  2JE1 A;  1O6V A;  2ID5 A;  5FTT B;  1LTX A;  1JL5 A;  2OMV A;  4Q62 A;  4P91 A;  4FMZ A;  2BNH A;  4WYK A;  3O6N A;  4U08 A;  3TSR E;  1KOO A;  4GLP A;  1D0B A;  4R5C A;  1Z7X W;  4MQW X;  5AWC A;  2Q4G W;  1DS9 A;  2RA8 A;  3RGX A;  2O6R A;  2XOT A;  2XWT C;  3WPE A;  5HDH A;  4R6F A;  3VQ1 A;  4R58 A;  3OJA A;  5D3I A;  4R6J A;  5B0T A;  2RR6 A;  3WN4 A;  1P9A G;  2JQD A;  3WPD A;  4ECN A;  4R6A A;  1FQV A;  4R09 A;  4J4L A;  4CNM A;  2WQV A;  4PER A;  5AWD A;  4NKH A;  4Z64 C;  1OOK G;  4U06 A;  3DZE A;  4Z8G A;  1FT8 A;  4BSS A;  3RW7 A;  4RCW A;  2OMZ A;  4V2E A;  2WFH A;  4C2A B;  2OMY A;  3UN9 A;  1ZIW A;  4Q3G A;  2R9U A;  2P1P B;  5IJD A;  5AWA A;  3WPB A;  5IJC A;  2OMW A;  4NKG A;  2Z62 A;  2Z7X B;  4ARR A;  5GS2 B;  4CIL A;  3OGK B;  1XEC A;  2BEX A;  3RGZ A;  2P1N B;  1M9S A;  4NZT M;  4LXR A;  4LI2 A;  1A9N A;  3SB4 A;  1XCD A;  4QXE A;  4LSA A;  4R08 A;  2AST B;  3UL9 A;  4LXS A;  4WP6 A;  5IYX C;  4R07 A;  3G06 A;  3E2J A;  3UL7 A;  4NZR M;  1P8T A;  3BZ5 A;  3G04 C;  4FCG A;  3GOZ A;  3W3M A;  4CC4 A;  4Q3I A;  1FS2 A;  3W3G A;  4EZG A;  4AW4 A;  3W3K A;  1OTN A;  4AY9 X;  1M10 B;  3OGM B;  3ULA A;  1M9L A;  3ZYN A;  3CIY A;  4KNG A;  1DFJ I;  1DCE A;  3PMH G;  1OZN A;  5B4P A;  5LFN A;  4XOS A;  4TZH A;  4QBZ A;  4M7E C;  3WPH A;  4FS7 A;  1OTM A;  2V9S A;  3CVR A;  1A4Y A;  1P8V A;  4FHO A;  2UZX A;  1OTO A;  1SQ0 B;  2Z65 A;  4I6J B;  4M7E A;  2P1M B;  2WQX A;  4OQT A;  2Y5Q A;  4UFR A;  3RFS A;  3WPI A;  4LSX A;  3FXI A;  3ULV A;  4Z94 G;  2P1O B;  3A79 B;  2WQU A;  5A5C A;  5AZ5 A;  5GQR K;  4BV4 R;  4K17 A;  2O6S A;  5B0N A;  3ZYO A;  1U0N D;  1XWD C;  2A0Z A;  1O6S A;  5GMF A;  1M0Z A;  1H6U A;  3P72 A;  4QC0 A;  4FD0 A;  2Z66 A;  2P1Q B;  3CIG A;  2ELL A;  3VQ2 A;  2V70 A;  1G9U A;  1H6T A;  4V2C A;  1OGQ A;  5GS0 A;  4P8S A;  4CC4 C;  3E3Z A;  3W3L A;  2OMX A;  5CMP A;  4V2D A;  3M19 A;  1GWB A;  4R5D A;  4FDW A;  1K5G C;  4CP6 A;  1YRG A;  1XKU A;  3RIZ A;  3G39 A;  4R6G A;  2FT3 A;  4H09 A;  4PEQ B;  3G3B A;  2ASS B;  3KJ4 A;  3JB9 j;  3RJ0 A;  4Z79 A;  3W3N A;  2Z63 A;  3G3A A;  3ULU A;  4KXF B;  5GMH A;  4C2B B;  4LSX C;  3OJA B;  1W8A A;  4GT6 A;  1XEU A;  4L3A A;  3W3J A;  1IO0 A;  3RFE A;  2UZY A;  5GMG A;  4BSR A; 
#chains in the Genus database with same CATH homology
 4CNC A;  4ARN A;  3REZ A;  3C6O B;  4RWT C;  3E4G A;  4MN8 B;  4J0M A;  3RFJ A;  2Z64 A;  3RW6 A;  4PSJ A;  4Z61 C;  1KOH A;  3C6N B;  4YEB B;  3ZYI A;  5HZL B;  3E6J A;  1WWL A;  3WPG A;  4HQ1 A;  4B8C D;  4L3F A;  4XGO A;  4PQ8 A;  2IFG A;  4U7L A;  1FO1 A;  4U09 A;  3ZYJ A;  1O6T A;  4Y61 B;  2Z81 A;  4LI1 A;  2OMT A;  2Z7X A;  5CMN A;  4BSU A;  1QYY A;  3O53 A;  1K5D C;  5IJB A;  1PGV A;  4XSQ A;  2CA6 A;  4RCA B;  4IM6 A;  4ECO A;  3UL8 A;  4R0A A;  4G8A A;  3C6P B;  2WQW A;  4KT1 A;  3WPC A;  4PKI G;  3WPF A;  2JE0 A;  2OMU A;  2Z82 A;  4LSC A;  3M18 A;  3OGL B;  2O6Q A;  5AWB A;  2V9T B;  2JE1 A;  1O6V A;  2ID5 A;  5FTT B;  1LTX A;  1JL5 A;  2OMV A;  4Q62 A;  4P91 A;  4FMZ A;  2BNH A;  4WYK A;  3O6N A;  4U08 A;  3TSR E;  1KOO A;  4GLP A;  1D0B A;  4R5C A;  1Z7X W;  4MQW X;  5AWC A;  2Q4G W;  1DS9 A;  2RA8 A;  3RGX A;  2O6R A;  2XOT A;  2XWT C;  3WPE A;  5HDH A;  4R6F A;  3VQ1 A;  4R58 A;  3OJA A;  5D3I A;  4R6J A;  5B0T A;  2RR6 A;  3WN4 A;  1P9A G;  2JQD A;  3WPD A;  4ECN A;  4R6A A;  1FQV A;  4R09 A;  4J4L A;  4CNM A;  2WQV A;  4PER A;  5AWD A;  4NKH A;  4Z64 C;  1OOK G;  4U06 A;  3DZE A;  4Z8G A;  1FT8 A;  4BSS A;  3RW7 A;  4RCW A;  2OMZ A;  4V2E A;  2WFH A;  4C2A B;  2OMY A;  3UN9 A;  1ZIW A;  4Q3G A;  2R9U A;  2P1P B;  5IJD A;  5AWA A;  3WPB A;  5IJC A;  2OMW A;  4NKG A;  2Z62 A;  2Z7X B;  4ARR A;  5GS2 B;  4CIL A;  3OGK B;  1XEC A;  2BEX A;  3RGZ A;  2P1N B;  1M9S A;  4LXR A;  4LI2 A;  1A9N A;  3SB4 A;  1XCD A;  4QXE A;  4LSA A;  4R08 A;  2AST B;  3UL9 A;  4LXS A;  4WP6 A;  5IYX C;  4R07 A;  3G06 A;  3E2J A;  3UL7 A;  1P8T A;  3BZ5 A;  3G04 C;  4FCG A;  3GOZ A;  3W3M A;  4CC4 A;  4Q3I A;  1FS2 A;  3W3G A;  4EZG A;  4AW4 A;  3W3K A;  1OTN A;  4AY9 X;  1M10 B;  3OGM B;  3ULA A;  1M9L A;  3ZYN A;  3CIY A;  4KNG A;  1DFJ I;  1DCE A;  3PMH G;  1OZN A;  5B4P A;  5LFN A;  4XOS A;  4TZH A;  4QBZ A;  4M7E C;  3WPH A;  4FS7 A;  1OTM A;  2V9S A;  3CVR A;  1A4Y A;  1P8V A;  4FHO A;  2UZX A;  1OTO A;  1SQ0 B;  2Z65 A;  4I6J B;  4M7E A;  2P1M B;  2WQX A;  4OQT A;  2Y5Q A;  4UFR A;  3RFS A;  3WPI A;  4LSX A;  3FXI A;  3ULV A;  4Z94 G;  2P1O B;  3A79 B;  2WQU A;  5A5C A;  5AZ5 A;  5GQR K;  4BV4 R;  4K17 A;  2O6S A;  5B0N A;  3ZYO A;  1U0N D;  1XWD C;  2A0Z A;  1O6S A;  5GMF A;  1M0Z A;  1H6U A;  3P72 A;  4QC0 A;  4FD0 A;  2Z66 A;  2P1Q B;  3CIG A;  2ELL A;  3VQ2 A;  2V70 A;  1G9U A;  1H6T A;  4V2C A;  1OGQ A;  5GS0 A;  4P8S A;  4CC4 C;  3E3Z A;  3W3L A;  2OMX A;  5CMP A;  4V2D A;  3M19 A;  1GWB A;  4R5D A;  4FDW A;  1K5G C;  4CP6 A;  1YRG A;  1XKU A;  3RIZ A;  3G39 A;  4R6G A;  2FT3 A;  4H09 A;  4PEQ B;  3G3B A;  2ASS B;  3KJ4 A;  3JB9 j;  3RJ0 A;  4Z79 A;  3W3N A;  2Z63 A;  3G3A A;  3ULU A;  4KXF B;  5GMH A;  4C2B B;  4LSX C;  3OJA B;  1W8A A;  4GT6 A;  1XEU A;  4L3A A;  3W3J A;  1IO0 A;  3RFE A;  2UZY A;  5GMG A;  4BSR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...