4KT1A

Complex of r-spondin 1 with lgr4 extracellular domain
Total Genus 148
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
148
sequence length
504
structure length
461
Chain Sequence
PPLCAAPCSCDGDRRVDCSGKGLTAVPEGLSAFTQALDISMNNITQLPEDAFKNFPFLEELQLAGNDLSFIHPKALSGLKELKVLTLQNNQLKTVPSEAIRGLSALQSLRLDANHITSVPEDSFEGLVQLRHLWLDDNSLTEVPVHPLSNLPTLQALTLALNKISSIPDFAFTNLSSLVVLHLHNNKIRSLSQHCFDGLDNLETLDLNYNNLGEFPQAIKALPSLKELGFHSNSISVIPDGAFDGNPLLRTIHLYDNPLSFVGNSAFHNLSDLHSLVIRGASMVQQFPNLTGTVHLESLTLTGTKISSIPNNLCQEQKMLRTLDLSYNNIRDLPSFNGCHALEEISLQRNQIYQIKEGTFQGLISLRILDLSRNLIHEIHSRAFATLGPITNLDVSFNELTSFPTEGLNGLNQLKLVGNFKLKEALAAKDFVNLRSLSVPYAYQCCAFWGCIHCTPSTGHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Leucine-rich repeat-containing G-protein coupled receptor 4
publication title Structural basis for R-spondin recognition by LGR4/5/6 receptors
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hormone receptor/cell adhesion
total genus 148
structure length 461
sequence length 504
ec nomenclature
pdb deposition date 2013-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01462 LRRNT Leucine rich repeat N-terminal domain
A PF13855 LRR_8 Leucine rich repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 4kt1A01
4H09A 1G9UA 3BZ5A 3WPHA 2JE1A 4ECOA 3C6PB 3C6OB 3OGLB 1U0ND 4RCWA 1DS9A 4FS7A 4QBZA 4WYKA 3RGXA 4FMZA 4HQ1A 4PEQB 3WPFA 3OGKB 2Z82A 4LXRA 4WP6A 5A5CA 4BSRA 4BSUA 4CP6A 3O6NA 4L3AA 1W8AA 4M7EC 2Z64A 4GT6A 3W3NA 1H6UA 4NKGA 4AW4A 4XGOA 1O6VA 1OOKG 1FT8A 2BEXA 4PKIG 1M9LA 3PMHG 2FT3A 5GS2B 3OJAB 4M7EA 1XEUA 3W3KA 5LFNA 4R08A 5AWDA 4Z8GA 4ARRA 3RIZA 2OMXA 4RCAB 2P1OB 4J0MA 4R6FA 4YEBB 2RA8A 2V9TB 1WWLA 3M18A 3P72A 4QXEA 3W3LA 1KOOA 3UN9A 1KOHA 2Z63A 4LSXC 5AWCA 4U09A 2P1MB 1JL5A 2XWTC 3RFJA 3RW7A 2R9UA 3ZYIA 2V70A 4LSCA 5FTTB 4PERA 4PSJA 5B0TA 4R58A 4LSXA 2OMTA 1M10B 2OMYA 3E3ZA 5HDHA 1A4YA 3GOZA 1FS2A 2CA6A 3KJ4A 3RGZA 4FDWA 4XSQA 4KXFB 4FD0A 3CIGA 5GMGA 5B4PA 3M19A 5GMFA 4P91A 4UFRA 5D3IA 3RJ0A 2O6QA 3JB9j 2WFHA 4FCGA 2ELLA 5GQRK 3E6JA 4CILA 1QYYA 5AWBA 1D0BA 2OMZA 4R07A 4Z79A 3TSRE 4Q62A 3ZYOA 4FHOA 4NKHA 4QC0A 4R6GA 1LTXA 3W3GA 4ECNA 5IJDA 4V2CA 3A79B 3ULVA 4LI1A 3VQ2A 3ULAA 3W3JA 1H6TA 2A0ZA 4R6JA 4KNGA 3G06A 2WQVA 3WPBA 4MQWX 2P1NB 4Z64C 3RFEA 1DCEA 5B0NA 2BNHA 4Z94G 2OMVA 2O6RA 3UL7A 2JQDA 4IM6A 4RWTC 4P8SA 3OJAA 3DZEA 4R0AA 5HZLB 3G3AA 2Z7XA 4L3FA 4OQTA 2Z62A 2IFGA 3WPEA 4J4LA 4Q3GA 2ID5A 5IYXC 5IJCA 1Z7XW 4ARNA 4LI2A 4PQ8A 3CVRA 1OGQA 1OTOA 2UZYA 3CIYA 3G04C 4GLPA 1ZIWA 4R6AA 3E4GA 1IO0A 4U06A 1A9NA 2XOTA 1O6SA 5AZ5A 2Q4GW 1YRGA 2UZXA 4G8AA 3RW6A 1SQ0B 3E2JA 4TZHA 2O6SA 1OTNA 4U7LA 4B8CD 1FQVA 1O6TA 1XKUA 3SB4A 2Z66A 2P1QB 1P9AG 4U08A 1PGVA 4V2DA 2ASTB 4R5CA 2JE0A 3O53A 4BV4R 1GWBA 2P1PB 4Y61B 4C2AB 5IJBA 3W3MA 3ULUA 1XECA 4CC4C 4AY9X 3VQ1A 2OMWA 4Q3IA 1XWDC 1M0ZA 2OMUA 1DFJI 4R09A 4CNCA 4CC4A 2Y5QA 4LXSA 4KT1A 4XOSA 3G3BA 3REZA 2Z7XB 2WQUA 4C2BB 3ZYJA 3OGMB 4I6JB 4V2EA 3WPDA 4BSSA 3UL8A 2ASSB 3ZYNA 5GS0A 4EZGA 3C6NB 3WN4A 1M9SA 5CMPA 1K5GC 3WPCA 3RFSA 5AWAA 2WQXA 3UL9A 3FXIA 5GMHA 2RR6A 1OZNA 1FO1A 2V9SA 3WPGA 2Z65A 5CMNA 4K17A 4CNMA 4R5DA 4MN8B 4LSAA 1P8TA 1K5DC 4Z61C 1OTMA 2WQWA 1P8VA 1XCDA 3G39A 2Z81A 3WPIA
chains in the Genus database with same CATH superfamily
4H09A 1G9UA 3BZ5A 3WPHA 2JE1A 4ECOA 3C6PB 3C6OB 3OGLB 1U0ND 4RCWA 1DS9A 4FS7A 4QBZA 4WYKA 3RGXA 4FMZA 4HQ1A 4PEQB 3WPFA 3OGKB 2Z82A 4LXRA 4WP6A 5A5CA 4BSRA 4BSUA 4CP6A 3O6NA 4L3AA 1W8AA 4M7EC 2Z64A 4GT6A 3W3NA 1H6UA 4NKGA 4AW4A 4XGOA 1O6VA 1OOKG 1FT8A 2BEXA 4PKIG 1M9LA 3PMHG 2FT3A 5GS2B 3OJAB 4M7EA 1XEUA 3W3KA 5LFNA 4R08A 5AWDA 4Z8GA 4ARRA 3RIZA 2OMXA 4RCAB 2P1OB 4NZRM 4J0MA 4R6FA 4YEBB 2RA8A 2V9TB 1WWLA 3M18A 3P72A 4QXEA 3W3LA 1KOOA 3UN9A 1KOHA 2Z63A 4LSXC 5AWCA 4U09A 2P1MB 1JL5A 2XWTC 3RFJA 3RW7A 2R9UA 3ZYIA 2V70A 4LSCA 5FTTB 4PERA 4PSJA 5B0TA 4R58A 4LSXA 2OMTA 1M10B 2OMYA 3E3ZA 5HDHA 1A4YA 3GOZA 1FS2A 2CA6A 3KJ4A 3RGZA 4FDWA 4XSQA 4KXFB 4NZTM 4FD0A 3CIGA 5GMGA 5B4PA 3M19A 5GMFA 4P91A 4UFRA 5D3IA 3RJ0A 2O6QA 3JB9j 2WFHA 4FCGA 2ELLA 5GQRK 3E6JA 4CILA 1QYYA 5AWBA 1D0BA 2OMZA 4R07A 4Z79A 3TSRE 4Q62A 3ZYOA 4FHOA 4NKHA 4QC0A 4R6GA 1LTXA 3W3GA 4ECNA 5IJDA 4V2CA 3A79B 3ULVA 4LI1A 3VQ2A 3ULAA 3W3JA 1H6TA 2A0ZA 4R6JA 4KNGA 3G06A 2WQVA 3WPBA 4MQWX 2P1NB 4Z64C 3RFEA 1DCEA 5B0NA 2BNHA 4Z94G 2OMVA 2O6RA 3UL7A 2JQDA 4IM6A 4RWTC 4P8SA 3OJAA 3DZEA 4R0AA 5HZLB 3G3AA 2Z7XA 4L3FA 4OQTA 2Z62A 2IFGA 3WPEA 4J4LA 4Q3GA 2ID5A 5IYXC 5IJCA 1Z7XW 4ARNA 4LI2A 4PQ8A 3CVRA 1OGQA 1OTOA 2UZYA 3CIYA 3G04C 4GLPA 1ZIWA 4R6AA 3E4GA 1IO0A 4U06A 1A9NA 2XOTA 1O6SA 5AZ5A 2Q4GW 1YRGA 2UZXA 4G8AA 3RW6A 1SQ0B 3E2JA 4TZHA 2O6SA 1OTNA 4U7LA 4B8CD 1FQVA 1O6TA 1XKUA 3SB4A 2Z66A 2P1QB 1P9AG 4U08A 1PGVA 4V2DA 2ASTB 4R5CA 2JE0A 3O53A 4BV4R 1GWBA 2P1PB 4Y61B 4C2AB 5IJBA 3W3MA 3ULUA 1XECA 4CC4C 4AY9X 3VQ1A 2OMWA 4Q3IA 1XWDC 1M0ZA 2OMUA 1DFJI 4R09A 4CNCA 4CC4A 2Y5QA 4LXSA 4KT1A 4XOSA 3G3BA 3REZA 2Z7XB 2WQUA 4C2BB 3ZYJA 3OGMB 4I6JB 4V2EA 3WPDA 4BSSA 3UL8A 2ASSB 3ZYNA 5GS0A 4EZGA 3C6NB 3WN4A 1M9SA 5CMPA 1K5GC 3WPCA 3RFSA 5AWAA 2WQXA 3UL9A 3FXIA 5GMHA 2RR6A 1OZNA 1FO1A 2V9SA 3WPGA 2Z65A 5CMNA 4K17A 4CNMA 4R5DA 4MN8B 4LSAA 1P8TA 1K5DC 4Z61C 1OTMA 2WQWA 1P8VA 1XCDA 3G39A 2Z81A 3WPIA
chains in the Genus database with same CATH topology
4H09A 1G9UA 3BZ5A 3WPHA 2JE1A 4ECOA 3C6PB 3C6OB 3OGLB 1U0ND 4RCWA 1DS9A 4FS7A 4QBZA 4WYKA 3RGXA 4FMZA 4HQ1A 4PEQB 3WPFA 3OGKB 2Z82A 4LXRA 4WP6A 5A5CA 4BSRA 4BSUA 4CP6A 3O6NA 4L3AA 1W8AA 4M7EC 2Z64A 4GT6A 3W3NA 1H6UA 4NKGA 4AW4A 4XGOA 1O6VA 1OOKG 1FT8A 2BEXA 4PKIG 1M9LA 3PMHG 2FT3A 5GS2B 3OJAB 4M7EA 1XEUA 3W3KA 5LFNA 4R08A 5AWDA 4Z8GA 4ARRA 3RIZA 2OMXA 4RCAB 2P1OB 4J0MA 4R6FA 4YEBB 2RA8A 2V9TB 1WWLA 3M18A 3P72A 4QXEA 3W3LA 1KOOA 3UN9A 1KOHA 2Z63A 4LSXC 5AWCA 4U09A 2P1MB 1JL5A 2XWTC 3RFJA 3RW7A 2R9UA 3ZYIA 2V70A 4LSCA 5FTTB 4PERA 4PSJA 5B0TA 4R58A 4LSXA 2OMTA 1M10B 2OMYA 3E3ZA 5HDHA 1A4YA 3GOZA 1FS2A 2CA6A 3KJ4A 3RGZA 4FDWA 4XSQA 4KXFB 4FD0A 3CIGA 5GMGA 5B4PA 3M19A 5GMFA 4P91A 4UFRA 5D3IA 3RJ0A 2O6QA 3JB9j 2WFHA 4FCGA 2ELLA 5GQRK 3E6JA 4CILA 1QYYA 5AWBA 1D0BA 2OMZA 4R07A 4Z79A 3TSRE 4Q62A 3ZYOA 4FHOA 4NKHA 4QC0A 4R6GA 1LTXA 3W3GA 4ECNA 5IJDA 4V2CA 3A79B 3ULVA 4LI1A 3VQ2A 3ULAA 3W3JA 1H6TA 2A0ZA 4R6JA 4KNGA 3G06A 2WQVA 3WPBA 4MQWX 2P1NB 4Z64C 3RFEA 1DCEA 5B0NA 2BNHA 4Z94G 2OMVA 2O6RA 3UL7A 2JQDA 4IM6A 4RWTC 4P8SA 3OJAA 3DZEA 4R0AA 5HZLB 3G3AA 2Z7XA 4L3FA 4OQTA 2Z62A 2IFGA 3WPEA 4J4LA 4Q3GA 2ID5A 5IYXC 5IJCA 1Z7XW 4ARNA 4LI2A 4PQ8A 3CVRA 1OGQA 1OTOA 2UZYA 3CIYA 3G04C 4GLPA 1ZIWA 4R6AA 3E4GA 1IO0A 4U06A 1A9NA 2XOTA 1O6SA 5AZ5A 2Q4GW 1YRGA 2UZXA 4G8AA 3RW6A 1SQ0B 3E2JA 4TZHA 2O6SA 1OTNA 4U7LA 4B8CD 1FQVA 1O6TA 1XKUA 3SB4A 2Z66A 2P1QB 1P9AG 4U08A 1PGVA 4V2DA 2ASTB 4R5CA 2JE0A 3O53A 4BV4R 1GWBA 2P1PB 4Y61B 4C2AB 5IJBA 3W3MA 3ULUA 1XECA 4CC4C 4AY9X 3VQ1A 2OMWA 4Q3IA 1XWDC 1M0ZA 2OMUA 1DFJI 4R09A 4CNCA 4CC4A 2Y5QA 4LXSA 4KT1A 4XOSA 3G3BA 3REZA 2Z7XB 2WQUA 4C2BB 3ZYJA 3OGMB 4I6JB 4V2EA 3WPDA 4BSSA 3UL8A 2ASSB 3ZYNA 5GS0A 4EZGA 3C6NB 3WN4A 1M9SA 5CMPA 1K5GC 3WPCA 3RFSA 5AWAA 2WQXA 3UL9A 3FXIA 5GMHA 2RR6A 1OZNA 1FO1A 2V9SA 3WPGA 2Z65A 5CMNA 4K17A 4CNMA 4R5DA 4MN8B 4LSAA 1P8TA 1K5DC 4Z61C 1OTMA 2WQWA 1P8VA 1XCDA 3G39A 2Z81A 3WPIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4H09 A;  1G9U A;  3BZ5 A;  3WPH A;  2JE1 A;  4ECO A;  3C6P B;  3C6O B;  3OGL B;  1U0N D;  4RCW A;  1DS9 A;  4FS7 A;  4QBZ A;  4WYK A;  3RGX A;  4FMZ A;  4HQ1 A;  4PEQ B;  3WPF A;  3OGK B;  2Z82 A;  4LXR A;  4WP6 A;  5A5C A;  4BSR A;  4BSU A;  4CP6 A;  3O6N A;  4L3A A;  1W8A A;  4M7E C;  2Z64 A;  4GT6 A;  3W3N A;  1H6U A;  4NKG A;  4AW4 A;  4XGO A;  1O6V A;  1OOK G;  1FT8 A;  2BEX A;  4PKI G;  1M9L A;  3PMH G;  2FT3 A;  5GS2 B;  3OJA B;  4M7E A;  1XEU A;  3W3K A;  5LFN A;  4R08 A;  5AWD A;  4Z8G A;  4ARR A;  3RIZ A;  2OMX A;  4RCA B;  2P1O B;  4J0M A;  4R6F A;  4YEB B;  2RA8 A;  2V9T B;  1WWL A;  3M18 A;  3P72 A;  4QXE A;  3W3L A;  1KOO A;  3UN9 A;  1KOH A;  2Z63 A;  4LSX C;  5AWC A;  4U09 A;  2P1M B;  1JL5 A;  2XWT C;  3RFJ A;  3RW7 A;  2R9U A;  3ZYI A;  2V70 A;  4LSC A;  5FTT B;  4PER A;  4PSJ A;  5B0T A;  4R58 A;  4LSX A;  2OMT A;  1M10 B;  2OMY A;  3E3Z A;  5HDH A;  1A4Y A;  3GOZ A;  1FS2 A;  2CA6 A;  3KJ4 A;  3RGZ A;  4FDW A;  4XSQ A;  4KXF B;  4FD0 A;  3CIG A;  5GMG A;  5B4P A;  3M19 A;  5GMF A;  4P91 A;  4UFR A;  5D3I A;  3RJ0 A;  2O6Q A;  3JB9 j;  2WFH A;  4FCG A;  2ELL A;  5GQR K;  3E6J A;  4CIL A;  1QYY A;  5AWB A;  1D0B A;  2OMZ A;  4R07 A;  4Z79 A;  3TSR E;  4Q62 A;  3ZYO A;  4FHO A;  4NKH A;  4QC0 A;  4R6G A;  1LTX A;  3W3G A;  4ECN A;  5IJD A;  4V2C A;  3A79 B;  3ULV A;  4LI1 A;  3VQ2 A;  3ULA A;  3W3J A;  1H6T A;  2A0Z A;  4R6J A;  4KNG A;  3G06 A;  2WQV A;  3WPB A;  4MQW X;  2P1N B;  4Z64 C;  3RFE A;  1DCE A;  5B0N A;  2BNH A;  4Z94 G;  2OMV A;  2O6R A;  3UL7 A;  2JQD A;  4IM6 A;  4RWT C;  4P8S A;  3OJA A;  3DZE A;  4R0A A;  5HZL B;  3G3A A;  2Z7X A;  4L3F A;  4OQT A;  2Z62 A;  2IFG A;  3WPE A;  4J4L A;  4Q3G A;  2ID5 A;  5IYX C;  5IJC A;  1Z7X W;  4ARN A;  4LI2 A;  4PQ8 A;  3CVR A;  1OGQ A;  1OTO A;  2UZY A;  3CIY A;  3G04 C;  4GLP A;  1ZIW A;  4R6A A;  3E4G A;  1IO0 A;  4U06 A;  1A9N A;  2XOT A;  1O6S A;  5AZ5 A;  2Q4G W;  1YRG A;  2UZX A;  4G8A A;  3RW6 A;  1SQ0 B;  3E2J A;  4TZH A;  2O6S A;  1OTN A;  4U7L A;  4B8C D;  1FQV A;  1O6T A;  1XKU A;  3SB4 A;  2Z66 A;  2P1Q B;  1P9A G;  4U08 A;  1PGV A;  4V2D A;  2AST B;  4R5C A;  2JE0 A;  3O53 A;  4BV4 R;  1GWB A;  2P1P B;  4Y61 B;  4C2A B;  5IJB A;  3W3M A;  3ULU A;  1XEC A;  4CC4 C;  4AY9 X;  3VQ1 A;  2OMW A;  4Q3I A;  1XWD C;  1M0Z A;  2OMU A;  1DFJ I;  4R09 A;  4CNC A;  4CC4 A;  2Y5Q A;  4LXS A;  4KT1 A;  4XOS A;  3G3B A;  3REZ A;  2Z7X B;  2WQU A;  4C2B B;  3ZYJ A;  3OGM B;  4I6J B;  4V2E A;  3WPD A;  4BSS A;  3UL8 A;  2ASS B;  3ZYN A;  5GS0 A;  4EZG A;  3C6N B;  3WN4 A;  1M9S A;  5CMP A;  1K5G C;  3WPC A;  3RFS A;  5AWA A;  2WQX A;  3UL9 A;  3FXI A;  5GMH A;  2RR6 A;  1OZN A;  1FO1 A;  2V9S A;  3WPG A;  2Z65 A;  5CMN A;  4K17 A;  4CNM A;  4R5D A;  4MN8 B;  4LSA A;  1P8T A;  1K5D C;  4Z61 C;  1OTM A;  2WQW A;  1P8V A;  1XCD A;  3G39 A;  2Z81 A;  3WPI A; 
#chains in the Genus database with same CATH topology
 4H09 A;  1G9U A;  3BZ5 A;  3WPH A;  2JE1 A;  4ECO A;  3C6P B;  3C6O B;  3OGL B;  1U0N D;  4RCW A;  1DS9 A;  4FS7 A;  4QBZ A;  4WYK A;  3RGX A;  4FMZ A;  4HQ1 A;  4PEQ B;  3WPF A;  3OGK B;  2Z82 A;  4LXR A;  4WP6 A;  5A5C A;  4BSR A;  4BSU A;  4CP6 A;  3O6N A;  4L3A A;  1W8A A;  4M7E C;  2Z64 A;  4GT6 A;  3W3N A;  1H6U A;  4NKG A;  4AW4 A;  4XGO A;  1O6V A;  1OOK G;  1FT8 A;  2BEX A;  4PKI G;  1M9L A;  3PMH G;  2FT3 A;  5GS2 B;  3OJA B;  4M7E A;  1XEU A;  3W3K A;  5LFN A;  4R08 A;  5AWD A;  4Z8G A;  4ARR A;  3RIZ A;  2OMX A;  4RCA B;  2P1O B;  4NZR M;  4J0M A;  4R6F A;  4YEB B;  2RA8 A;  2V9T B;  1WWL A;  3M18 A;  3P72 A;  4QXE A;  3W3L A;  1KOO A;  3UN9 A;  1KOH A;  2Z63 A;  4LSX C;  5AWC A;  4U09 A;  2P1M B;  1JL5 A;  2XWT C;  3RFJ A;  3RW7 A;  2R9U A;  3ZYI A;  2V70 A;  4LSC A;  5FTT B;  4PER A;  4PSJ A;  5B0T A;  4R58 A;  4LSX A;  2OMT A;  1M10 B;  2OMY A;  3E3Z A;  5HDH A;  1A4Y A;  3GOZ A;  1FS2 A;  2CA6 A;  3KJ4 A;  3RGZ A;  4FDW A;  4XSQ A;  4KXF B;  4NZT M;  4FD0 A;  3CIG A;  5GMG A;  5B4P A;  3M19 A;  5GMF A;  4P91 A;  4UFR A;  5D3I A;  3RJ0 A;  2O6Q A;  3JB9 j;  2WFH A;  4FCG A;  2ELL A;  5GQR K;  3E6J A;  4CIL A;  1QYY A;  5AWB A;  1D0B A;  2OMZ A;  4R07 A;  4Z79 A;  3TSR E;  4Q62 A;  3ZYO A;  4FHO A;  4NKH A;  4QC0 A;  4R6G A;  1LTX A;  3W3G A;  4ECN A;  5IJD A;  4V2C A;  3A79 B;  3ULV A;  4LI1 A;  3VQ2 A;  3ULA A;  3W3J A;  1H6T A;  2A0Z A;  4R6J A;  4KNG A;  3G06 A;  2WQV A;  3WPB A;  4MQW X;  2P1N B;  4Z64 C;  3RFE A;  1DCE A;  5B0N A;  2BNH A;  4Z94 G;  2OMV A;  2O6R A;  3UL7 A;  2JQD A;  4IM6 A;  4RWT C;  4P8S A;  3OJA A;  3DZE A;  4R0A A;  5HZL B;  3G3A A;  2Z7X A;  4L3F A;  4OQT A;  2Z62 A;  2IFG A;  3WPE A;  4J4L A;  4Q3G A;  2ID5 A;  5IYX C;  5IJC A;  1Z7X W;  4ARN A;  4LI2 A;  4PQ8 A;  3CVR A;  1OGQ A;  1OTO A;  2UZY A;  3CIY A;  3G04 C;  4GLP A;  1ZIW A;  4R6A A;  3E4G A;  1IO0 A;  4U06 A;  1A9N A;  2XOT A;  1O6S A;  5AZ5 A;  2Q4G W;  1YRG A;  2UZX A;  4G8A A;  3RW6 A;  1SQ0 B;  3E2J A;  4TZH A;  2O6S A;  1OTN A;  4U7L A;  4B8C D;  1FQV A;  1O6T A;  1XKU A;  3SB4 A;  2Z66 A;  2P1Q B;  1P9A G;  4U08 A;  1PGV A;  4V2D A;  2AST B;  4R5C A;  2JE0 A;  3O53 A;  4BV4 R;  1GWB A;  2P1P B;  4Y61 B;  4C2A B;  5IJB A;  3W3M A;  3ULU A;  1XEC A;  4CC4 C;  4AY9 X;  3VQ1 A;  2OMW A;  4Q3I A;  1XWD C;  1M0Z A;  2OMU A;  1DFJ I;  4R09 A;  4CNC A;  4CC4 A;  2Y5Q A;  4LXS A;  4KT1 A;  4XOS A;  3G3B A;  3REZ A;  2Z7X B;  2WQU A;  4C2B B;  3ZYJ A;  3OGM B;  4I6J B;  4V2E A;  3WPD A;  4BSS A;  3UL8 A;  2ASS B;  3ZYN A;  5GS0 A;  4EZG A;  3C6N B;  3WN4 A;  1M9S A;  5CMP A;  1K5G C;  3WPC A;  3RFS A;  5AWA A;  2WQX A;  3UL9 A;  3FXI A;  5GMH A;  2RR6 A;  1OZN A;  1FO1 A;  2V9S A;  3WPG A;  2Z65 A;  5CMN A;  4K17 A;  4CNM A;  4R5D A;  4MN8 B;  4LSA A;  1P8T A;  1K5D C;  4Z61 C;  1OTM A;  2WQW A;  1P8V A;  1XCD A;  3G39 A;  2Z81 A;  3WPI A; 
#chains in the Genus database with same CATH homology
 4H09 A;  1G9U A;  3BZ5 A;  3WPH A;  2JE1 A;  4ECO A;  3C6P B;  3C6O B;  3OGL B;  1U0N D;  4RCW A;  1DS9 A;  4FS7 A;  4QBZ A;  4WYK A;  3RGX A;  4FMZ A;  4HQ1 A;  4PEQ B;  3WPF A;  3OGK B;  2Z82 A;  4LXR A;  4WP6 A;  5A5C A;  4BSR A;  4BSU A;  4CP6 A;  3O6N A;  4L3A A;  1W8A A;  4M7E C;  2Z64 A;  4GT6 A;  3W3N A;  1H6U A;  4NKG A;  4AW4 A;  4XGO A;  1O6V A;  1OOK G;  1FT8 A;  2BEX A;  4PKI G;  1M9L A;  3PMH G;  2FT3 A;  5GS2 B;  3OJA B;  4M7E A;  1XEU A;  3W3K A;  5LFN A;  4R08 A;  5AWD A;  4Z8G A;  4ARR A;  3RIZ A;  2OMX A;  4RCA B;  2P1O B;  4J0M A;  4R6F A;  4YEB B;  2RA8 A;  2V9T B;  1WWL A;  3M18 A;  3P72 A;  4QXE A;  3W3L A;  1KOO A;  3UN9 A;  1KOH A;  2Z63 A;  4LSX C;  5AWC A;  4U09 A;  2P1M B;  1JL5 A;  2XWT C;  3RFJ A;  3RW7 A;  2R9U A;  3ZYI A;  2V70 A;  4LSC A;  5FTT B;  4PER A;  4PSJ A;  5B0T A;  4R58 A;  4LSX A;  2OMT A;  1M10 B;  2OMY A;  3E3Z A;  5HDH A;  1A4Y A;  3GOZ A;  1FS2 A;  2CA6 A;  3KJ4 A;  3RGZ A;  4FDW A;  4XSQ A;  4KXF B;  4FD0 A;  3CIG A;  5GMG A;  5B4P A;  3M19 A;  5GMF A;  4P91 A;  4UFR A;  5D3I A;  3RJ0 A;  2O6Q A;  3JB9 j;  2WFH A;  4FCG A;  2ELL A;  5GQR K;  3E6J A;  4CIL A;  1QYY A;  5AWB A;  1D0B A;  2OMZ A;  4R07 A;  4Z79 A;  3TSR E;  4Q62 A;  3ZYO A;  4FHO A;  4NKH A;  4QC0 A;  4R6G A;  1LTX A;  3W3G A;  4ECN A;  5IJD A;  4V2C A;  3A79 B;  3ULV A;  4LI1 A;  3VQ2 A;  3ULA A;  3W3J A;  1H6T A;  2A0Z A;  4R6J A;  4KNG A;  3G06 A;  2WQV A;  3WPB A;  4MQW X;  2P1N B;  4Z64 C;  3RFE A;  1DCE A;  5B0N A;  2BNH A;  4Z94 G;  2OMV A;  2O6R A;  3UL7 A;  2JQD A;  4IM6 A;  4RWT C;  4P8S A;  3OJA A;  3DZE A;  4R0A A;  5HZL B;  3G3A A;  2Z7X A;  4L3F A;  4OQT A;  2Z62 A;  2IFG A;  3WPE A;  4J4L A;  4Q3G A;  2ID5 A;  5IYX C;  5IJC A;  1Z7X W;  4ARN A;  4LI2 A;  4PQ8 A;  3CVR A;  1OGQ A;  1OTO A;  2UZY A;  3CIY A;  3G04 C;  4GLP A;  1ZIW A;  4R6A A;  3E4G A;  1IO0 A;  4U06 A;  1A9N A;  2XOT A;  1O6S A;  5AZ5 A;  2Q4G W;  1YRG A;  2UZX A;  4G8A A;  3RW6 A;  1SQ0 B;  3E2J A;  4TZH A;  2O6S A;  1OTN A;  4U7L A;  4B8C D;  1FQV A;  1O6T A;  1XKU A;  3SB4 A;  2Z66 A;  2P1Q B;  1P9A G;  4U08 A;  1PGV A;  4V2D A;  2AST B;  4R5C A;  2JE0 A;  3O53 A;  4BV4 R;  1GWB A;  2P1P B;  4Y61 B;  4C2A B;  5IJB A;  3W3M A;  3ULU A;  1XEC A;  4CC4 C;  4AY9 X;  3VQ1 A;  2OMW A;  4Q3I A;  1XWD C;  1M0Z A;  2OMU A;  1DFJ I;  4R09 A;  4CNC A;  4CC4 A;  2Y5Q A;  4LXS A;  4KT1 A;  4XOS A;  3G3B A;  3REZ A;  2Z7X B;  2WQU A;  4C2B B;  3ZYJ A;  3OGM B;  4I6J B;  4V2E A;  3WPD A;  4BSS A;  3UL8 A;  2ASS B;  3ZYN A;  5GS0 A;  4EZG A;  3C6N B;  3WN4 A;  1M9S A;  5CMP A;  1K5G C;  3WPC A;  3RFS A;  5AWA A;  2WQX A;  3UL9 A;  3FXI A;  5GMH A;  2RR6 A;  1OZN A;  1FO1 A;  2V9S A;  3WPG A;  2Z65 A;  5CMN A;  4K17 A;  4CNM A;  4R5D A;  4MN8 B;  4LSA A;  1P8T A;  1K5D C;  4Z61 C;  1OTM A;  2WQW A;  1P8V A;  1XCD A;  3G39 A;  2Z81 A;  3WPI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...