4QXEA

Crystal structure of lgr4 fused with hagfish vlr
Total Genus 144
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
144
sequence length
443
structure length
443
Chain Sequence
b'MDPLCAAPCSCDGDRRVDCSGKGLTAVPEGLSAFTQALDISMNNITQLPEGAFKNFPFLEELQLAGNDLSFIHPKALSGLKELKVLTLQNNQLKTVPSEAIRGLSALQSLRLDANHITSVPEDSFEGLVQLRHLWLDDNSLTEVPVHPLSNLPTLQALTLALNKISSIPDFAFTNLSSLVVLHLHNNKIRSLSQHCFDGLDNLETLDLNYNNLGEFPQAIKALPSLKELGFHSNSISVIPDGAFDGNPLLRTIHLYDNPLSFVGNSAFHNLSDLHSLVIRGASMVQQFPNLTGTVHLESLTLTGTKISSIPNNLCQEQKMLRTLDLSYNNIRDLPSFNGCHALEEISLQRNQIYQIKEGTFQGLISLRILDLASNQLKSVPDGIFDRLTSLQKIWLHTNPWDCSCPRIDYLSRWLNKNSQKEQGSAKCSGSGKPVRSIICPTL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Leucine-rich repeat-containing G-protein coupled receptor 4,
publication title Crystal structure of LGR4 fused with hagfish VLR
rcsb
source organism Homo sapiens
molecule tags Membrane protein
total genus 144
structure length 443
sequence length 443
ec nomenclature
pdb deposition date 2014-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01462 LRRNT Leucine rich repeat N-terminal domain
A PF13855 LRR_8 Leucine rich repeat
A PF01462 LRRNT Leucine rich repeat N-terminal domain
A PF13855 LRR_8 Leucine rich repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 4qxeA01
1M10B 5AWDA 3O53A 4TZHA 5FTTB 3WPCA 4QXEA 4PKIG 3ULUA 1LTXA 3REZA 4Z94G 4K17A 1P8VA 4BSUA 3JB9j 2WQXA 2OMWA 3PMHG 3E6JA 3W3GA 4U7LA 3CIGA 2OMVA 4MQWX 5CMNA 4R6JA 4CC4A 1G9UA 3A79B 2V9SA 4LSXC 5B4PA 5AWAA 3FXIA 4PEQB 4LSCA 2Z7XB 1KOHA 2XOTA 2Z82A 4L3AA 1U0ND 4V2EA 1A9NA 4ARRA 2P1QB 1GWBA 3WPFA 3E2JA 3RGXA 2JE1A 5D3IA 3M19A 5GQRK 3UN9A 5AWBA 4V2DA 3WPIA 2ID5A 3DZEA 2P1MB 4LSXA 4EZGA 2Z81A 2OMTA 5HZLB 3KJ4A 4GLPA 1O6VA 3RW7A 1XEUA 5IJBA 4OQTA 2RR6A 3W3LA 3G04C 3UL8A 4U09A 2Y5QA 2WQVA 1OTNA 4HQ1A 3E4GA 3ZYOA 4R58A 4G8AA 3G3BA 3C6PB 4RWTC 4U06A 3G3AA 2JE0A 4BSRA 2WQWA 5GMFA 3RFSA 2Z7XA 4NKGA 4R08A 2O6SA 4XGOA 1FT8A 1WWLA 5GS2B 1XKUA 1DFJI 4NKHA 2A0ZA 2BEXA 4KNGA 2O6RA 4WYKA 4R09A 4CC4C 1XWDC 4PSJA 4CNMA 4CILA 4J0MA 4RCAB 4M7EC 4MN8B 1KOOA 1XECA 3ULVA 4P8SA 4YEBB 1JL5A 2P1PB 2Z62A 1OZNA 4BV4R 5GS0A 4LXRA 3CVRA 4RCWA 3VQ2A 4LI2A 4FD0A 1FO1A 3BZ5A 3TSRE 4M7EA 1IO0A 4ECNA 3RFEA 2V9TB 3ZYIA 1M9SA 5AWCA 2O6QA 1OTMA 2XWTC 1ZIWA 1DCEA 1FQVA 4FCGA 4UFRA 1PGVA 3SB4A 2RA8A 4Y61B 3UL9A 3ULAA 2OMZA 4KT1A 4Z61C 4V2CA 3M18A 1H6UA 2CA6A 2Z65A 4B8CD 3OGKB 5HDHA 3WN4A 4Z8GA 4R0AA 1DS9A 2Z64A 4R6AA 4I6JB 1M0ZA 5LFNA 3RFJA 2JQDA 3O6NA 3VQ1A 3ZYJA 4XSQA 5GMHA 3P72A 1D0BA 1Z7XW 4AW4A 4FHOA 4QC0A 2UZYA 1QYYA 1OOKG 5IJCA 2Q4GW 4Q62A 3ZYNA 3WPDA 4R5DA 2OMXA 4LI1A 4H09A 3UL7A 4PERA 2P1OB 1XCDA 4U08A 4XOSA 4GT6A 3G06A 1K5DC 3W3JA 4FMZA 4Q3IA 1M9LA 1P9AG 1FS2A 4R5CA 3RJ0A 4AY9X 2IFGA 2Z66A 2WQUA 4ARNA 5GMGA 4LSAA 1K5GC 4Q3GA 5B0TA 5IJDA 2OMUA 5AZ5A 2WFHA 4LXSA 3W3MA 3RIZA 2ELLA 4R6GA 4Z64C 3OGMB 4Z79A 2UZXA 2BNHA 2V70A 2OMYA 3OJAB 3OGLB 5IYXC 4R6FA 2ASSB 1O6SA 2ASTB 3WPBA 3C6OB 4WP6A 3WPGA 5B0NA 2Z63A 3CIYA 4FS7A 3G39A 4CP6A 4KXFB 3WPEA 3RGZA 1YRGA 4ECOA 1P8TA 4C2BB 3E3ZA 4PQ8A 4R07A 4IM6A 4L3FA 5CMPA 4QBZA 4BSSA 4CNCA 3GOZA 4C2AB 3W3KA 3RW6A 1W8AA 1SQ0B 1O6TA 4P91A 4J4LA 3OJAA 1OTOA 1H6TA 5A5CA 2R9UA 3WPHA 2FT3A 3W3NA 3C6NB 1OGQA 2P1NB 4FDWA 1A4YA
chains in the Genus database with same CATH superfamily
1M10B 5AWDA 3O53A 4TZHA 5FTTB 3WPCA 4QXEA 4PKIG 3ULUA 1LTXA 3REZA 4Z94G 4K17A 1P8VA 4BSUA 3JB9j 2WQXA 2OMWA 3PMHG 3E6JA 3W3GA 4U7LA 3CIGA 2OMVA 4MQWX 5CMNA 4R6JA 4CC4A 1G9UA 3A79B 2V9SA 4LSXC 5B4PA 5AWAA 3FXIA 4PEQB 4LSCA 2Z7XB 1KOHA 2XOTA 2Z82A 4L3AA 1U0ND 4V2EA 1A9NA 4ARRA 2P1QB 1GWBA 3WPFA 3E2JA 3RGXA 2JE1A 5D3IA 3M19A 5GQRK 3UN9A 5AWBA 4V2DA 3WPIA 2ID5A 3DZEA 2P1MB 4NZRM 4LSXA 4EZGA 2Z81A 2OMTA 5HZLB 3KJ4A 4GLPA 1O6VA 3RW7A 1XEUA 5IJBA 4OQTA 2RR6A 3W3LA 3G04C 3UL8A 4U09A 2Y5QA 2WQVA 1OTNA 4HQ1A 3E4GA 3ZYOA 4R58A 4G8AA 3G3BA 3C6PB 4RWTC 4U06A 3G3AA 2JE0A 4BSRA 2WQWA 5GMFA 3RFSA 2Z7XA 4NKGA 4R08A 2O6SA 4XGOA 1FT8A 1WWLA 5GS2B 1XKUA 1DFJI 4NKHA 2A0ZA 2BEXA 4KNGA 2O6RA 4WYKA 4R09A 4CC4C 1XWDC 4PSJA 4CNMA 4CILA 4J0MA 4RCAB 4M7EC 4MN8B 1KOOA 1XECA 3ULVA 4P8SA 4YEBB 1JL5A 2P1PB 2Z62A 1OZNA 4BV4R 5GS0A 4LXRA 4NZTM 3CVRA 4RCWA 3VQ2A 4LI2A 4FD0A 1FO1A 3BZ5A 3TSRE 4M7EA 1IO0A 4ECNA 3RFEA 2V9TB 3ZYIA 1M9SA 5AWCA 2O6QA 1OTMA 2XWTC 1ZIWA 1DCEA 1FQVA 4FCGA 4UFRA 1PGVA 3SB4A 2RA8A 4Y61B 3UL9A 3ULAA 2OMZA 4KT1A 4Z61C 4V2CA 3M18A 1H6UA 2CA6A 2Z65A 4B8CD 3OGKB 5HDHA 3WN4A 4Z8GA 4R0AA 1DS9A 2Z64A 4R6AA 4I6JB 1M0ZA 5LFNA 3RFJA 2JQDA 3O6NA 3VQ1A 3ZYJA 4XSQA 5GMHA 3P72A 1D0BA 1Z7XW 4AW4A 4FHOA 4QC0A 2UZYA 1QYYA 1OOKG 5IJCA 2Q4GW 4Q62A 3ZYNA 3WPDA 4R5DA 2OMXA 4LI1A 4H09A 3UL7A 4PERA 2P1OB 1XCDA 4U08A 4XOSA 4GT6A 3G06A 1K5DC 3W3JA 4FMZA 4Q3IA 1M9LA 1P9AG 1FS2A 4R5CA 3RJ0A 4AY9X 2IFGA 2Z66A 2WQUA 4ARNA 5GMGA 4LSAA 1K5GC 4Q3GA 5B0TA 5IJDA 2OMUA 5AZ5A 2WFHA 4LXSA 3W3MA 3RIZA 2ELLA 4R6GA 4Z64C 3OGMB 4Z79A 2UZXA 2BNHA 2V70A 2OMYA 3OJAB 3OGLB 5IYXC 4R6FA 2ASSB 1O6SA 2ASTB 3WPBA 3C6OB 4WP6A 3WPGA 5B0NA 2Z63A 3CIYA 4FS7A 3G39A 4CP6A 4KXFB 3WPEA 3RGZA 1YRGA 4ECOA 1P8TA 4C2BB 3E3ZA 4PQ8A 4R07A 4IM6A 4L3FA 5CMPA 4QBZA 4BSSA 4CNCA 3GOZA 4C2AB 3W3KA 3RW6A 1W8AA 1SQ0B 1O6TA 4P91A 4J4LA 3OJAA 1OTOA 1H6TA 5A5CA 2R9UA 3WPHA 2FT3A 3W3NA 3C6NB 1OGQA 2P1NB 4FDWA 1A4YA
chains in the Genus database with same CATH topology
1M10B 5AWDA 3O53A 4TZHA 5FTTB 3WPCA 4QXEA 4PKIG 3ULUA 1LTXA 3REZA 4Z94G 4K17A 1P8VA 4BSUA 3JB9j 2WQXA 2OMWA 3PMHG 3E6JA 3W3GA 4U7LA 3CIGA 2OMVA 4MQWX 5CMNA 4R6JA 4CC4A 1G9UA 3A79B 2V9SA 4LSXC 5B4PA 5AWAA 3FXIA 4PEQB 4LSCA 2Z7XB 1KOHA 2XOTA 2Z82A 4L3AA 1U0ND 4V2EA 1A9NA 4ARRA 2P1QB 1GWBA 3WPFA 3E2JA 3RGXA 2JE1A 5D3IA 3M19A 5GQRK 3UN9A 5AWBA 4V2DA 3WPIA 2ID5A 3DZEA 2P1MB 4LSXA 4EZGA 2Z81A 2OMTA 5HZLB 3KJ4A 4GLPA 1O6VA 3RW7A 1XEUA 5IJBA 4OQTA 2RR6A 3W3LA 3G04C 3UL8A 4U09A 2Y5QA 2WQVA 1OTNA 4HQ1A 3E4GA 3ZYOA 4R58A 4G8AA 3G3BA 3C6PB 4RWTC 4U06A 3G3AA 2JE0A 4BSRA 2WQWA 5GMFA 3RFSA 2Z7XA 4NKGA 4R08A 2O6SA 4XGOA 1FT8A 1WWLA 5GS2B 1XKUA 1DFJI 4NKHA 2A0ZA 2BEXA 4KNGA 2O6RA 4WYKA 4R09A 4CC4C 1XWDC 4PSJA 4CNMA 4CILA 4J0MA 4RCAB 4M7EC 4MN8B 1KOOA 1XECA 3ULVA 4P8SA 4YEBB 1JL5A 2P1PB 2Z62A 1OZNA 4BV4R 5GS0A 4LXRA 3CVRA 4RCWA 3VQ2A 4LI2A 4FD0A 1FO1A 3BZ5A 3TSRE 4M7EA 1IO0A 4ECNA 3RFEA 2V9TB 3ZYIA 1M9SA 5AWCA 2O6QA 1OTMA 2XWTC 1ZIWA 1DCEA 1FQVA 4FCGA 4UFRA 1PGVA 3SB4A 2RA8A 4Y61B 3UL9A 3ULAA 2OMZA 4KT1A 4Z61C 4V2CA 3M18A 1H6UA 2CA6A 2Z65A 4B8CD 3OGKB 5HDHA 3WN4A 4Z8GA 4R0AA 1DS9A 2Z64A 4R6AA 4I6JB 1M0ZA 5LFNA 3RFJA 2JQDA 3O6NA 3VQ1A 3ZYJA 4XSQA 5GMHA 3P72A 1D0BA 1Z7XW 4AW4A 4FHOA 4QC0A 2UZYA 1QYYA 1OOKG 5IJCA 2Q4GW 4Q62A 3ZYNA 3WPDA 4R5DA 2OMXA 4LI1A 4H09A 3UL7A 4PERA 2P1OB 1XCDA 4U08A 4XOSA 4GT6A 3G06A 1K5DC 3W3JA 4FMZA 4Q3IA 1M9LA 1P9AG 1FS2A 4R5CA 3RJ0A 4AY9X 2IFGA 2Z66A 2WQUA 4ARNA 5GMGA 4LSAA 1K5GC 4Q3GA 5B0TA 5IJDA 2OMUA 5AZ5A 2WFHA 4LXSA 3W3MA 3RIZA 2ELLA 4R6GA 4Z64C 3OGMB 4Z79A 2UZXA 2BNHA 2V70A 2OMYA 3OJAB 3OGLB 5IYXC 4R6FA 2ASSB 1O6SA 2ASTB 3WPBA 3C6OB 4WP6A 3WPGA 5B0NA 2Z63A 3CIYA 4FS7A 3G39A 4CP6A 4KXFB 3WPEA 3RGZA 1YRGA 4ECOA 1P8TA 4C2BB 3E3ZA 4PQ8A 4R07A 4IM6A 4L3FA 5CMPA 4QBZA 4BSSA 4CNCA 3GOZA 4C2AB 3W3KA 3RW6A 1W8AA 1SQ0B 1O6TA 4P91A 4J4LA 3OJAA 1OTOA 1H6TA 5A5CA 2R9UA 3WPHA 2FT3A 3W3NA 3C6NB 1OGQA 2P1NB 4FDWA 1A4YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1M10 B;  5AWD A;  3O53 A;  4TZH A;  5FTT B;  3WPC A;  4QXE A;  4PKI G;  3ULU A;  1LTX A;  3REZ A;  4Z94 G;  4K17 A;  1P8V A;  4BSU A;  3JB9 j;  2WQX A;  2OMW A;  3PMH G;  3E6J A;  3W3G A;  4U7L A;  3CIG A;  2OMV A;  4MQW X;  5CMN A;  4R6J A;  4CC4 A;  1G9U A;  3A79 B;  2V9S A;  4LSX C;  5B4P A;  5AWA A;  3FXI A;  4PEQ B;  4LSC A;  2Z7X B;  1KOH A;  2XOT A;  2Z82 A;  4L3A A;  1U0N D;  4V2E A;  1A9N A;  4ARR A;  2P1Q B;  1GWB A;  3WPF A;  3E2J A;  3RGX A;  2JE1 A;  5D3I A;  3M19 A;  5GQR K;  3UN9 A;  5AWB A;  4V2D A;  3WPI A;  2ID5 A;  3DZE A;  2P1M B;  4LSX A;  4EZG A;  2Z81 A;  2OMT A;  5HZL B;  3KJ4 A;  4GLP A;  1O6V A;  3RW7 A;  1XEU A;  5IJB A;  4OQT A;  2RR6 A;  3W3L A;  3G04 C;  3UL8 A;  4U09 A;  2Y5Q A;  2WQV A;  1OTN A;  4HQ1 A;  3E4G A;  3ZYO A;  4R58 A;  4G8A A;  3G3B A;  3C6P B;  4RWT C;  4U06 A;  3G3A A;  2JE0 A;  4BSR A;  2WQW A;  5GMF A;  3RFS A;  2Z7X A;  4NKG A;  4R08 A;  2O6S A;  4XGO A;  1FT8 A;  1WWL A;  5GS2 B;  1XKU A;  1DFJ I;  4NKH A;  2A0Z A;  2BEX A;  4KNG A;  2O6R A;  4WYK A;  4R09 A;  4CC4 C;  1XWD C;  4PSJ A;  4CNM A;  4CIL A;  4J0M A;  4RCA B;  4M7E C;  4MN8 B;  1KOO A;  1XEC A;  3ULV A;  4P8S A;  4YEB B;  1JL5 A;  2P1P B;  2Z62 A;  1OZN A;  4BV4 R;  5GS0 A;  4LXR A;  3CVR A;  4RCW A;  3VQ2 A;  4LI2 A;  4FD0 A;  1FO1 A;  3BZ5 A;  3TSR E;  4M7E A;  1IO0 A;  4ECN A;  3RFE A;  2V9T B;  3ZYI A;  1M9S A;  5AWC A;  2O6Q A;  1OTM A;  2XWT C;  1ZIW A;  1DCE A;  1FQV A;  4FCG A;  4UFR A;  1PGV A;  3SB4 A;  2RA8 A;  4Y61 B;  3UL9 A;  3ULA A;  2OMZ A;  4KT1 A;  4Z61 C;  4V2C A;  3M18 A;  1H6U A;  2CA6 A;  2Z65 A;  4B8C D;  3OGK B;  5HDH A;  3WN4 A;  4Z8G A;  4R0A A;  1DS9 A;  2Z64 A;  4R6A A;  4I6J B;  1M0Z A;  5LFN A;  3RFJ A;  2JQD A;  3O6N A;  3VQ1 A;  3ZYJ A;  4XSQ A;  5GMH A;  3P72 A;  1D0B A;  1Z7X W;  4AW4 A;  4FHO A;  4QC0 A;  2UZY A;  1QYY A;  1OOK G;  5IJC A;  2Q4G W;  4Q62 A;  3ZYN A;  3WPD A;  4R5D A;  2OMX A;  4LI1 A;  4H09 A;  3UL7 A;  4PER A;  2P1O B;  1XCD A;  4U08 A;  4XOS A;  4GT6 A;  3G06 A;  1K5D C;  3W3J A;  4FMZ A;  4Q3I A;  1M9L A;  1P9A G;  1FS2 A;  4R5C A;  3RJ0 A;  4AY9 X;  2IFG A;  2Z66 A;  2WQU A;  4ARN A;  5GMG A;  4LSA A;  1K5G C;  4Q3G A;  5B0T A;  5IJD A;  2OMU A;  5AZ5 A;  2WFH A;  4LXS A;  3W3M A;  3RIZ A;  2ELL A;  4R6G A;  4Z64 C;  3OGM B;  4Z79 A;  2UZX A;  2BNH A;  2V70 A;  2OMY A;  3OJA B;  3OGL B;  5IYX C;  4R6F A;  2ASS B;  1O6S A;  2AST B;  3WPB A;  3C6O B;  4WP6 A;  3WPG A;  5B0N A;  2Z63 A;  3CIY A;  4FS7 A;  3G39 A;  4CP6 A;  4KXF B;  3WPE A;  3RGZ A;  1YRG A;  4ECO A;  1P8T A;  4C2B B;  3E3Z A;  4PQ8 A;  4R07 A;  4IM6 A;  4L3F A;  5CMP A;  4QBZ A;  4BSS A;  4CNC A;  3GOZ A;  4C2A B;  3W3K A;  3RW6 A;  1W8A A;  1SQ0 B;  1O6T A;  4P91 A;  4J4L A;  3OJA A;  1OTO A;  1H6T A;  5A5C A;  2R9U A;  3WPH A;  2FT3 A;  3W3N A;  3C6N B;  1OGQ A;  2P1N B;  4FDW A;  1A4Y A; 
#chains in the Genus database with same CATH topology
 1M10 B;  5AWD A;  3O53 A;  4TZH A;  5FTT B;  3WPC A;  4QXE A;  4PKI G;  3ULU A;  1LTX A;  3REZ A;  4Z94 G;  4K17 A;  1P8V A;  4BSU A;  3JB9 j;  2WQX A;  2OMW A;  3PMH G;  3E6J A;  3W3G A;  4U7L A;  3CIG A;  2OMV A;  4MQW X;  5CMN A;  4R6J A;  4CC4 A;  1G9U A;  3A79 B;  2V9S A;  4LSX C;  5B4P A;  5AWA A;  3FXI A;  4PEQ B;  4LSC A;  2Z7X B;  1KOH A;  2XOT A;  2Z82 A;  4L3A A;  1U0N D;  4V2E A;  1A9N A;  4ARR A;  2P1Q B;  1GWB A;  3WPF A;  3E2J A;  3RGX A;  2JE1 A;  5D3I A;  3M19 A;  5GQR K;  3UN9 A;  5AWB A;  4V2D A;  3WPI A;  2ID5 A;  3DZE A;  2P1M B;  4NZR M;  4LSX A;  4EZG A;  2Z81 A;  2OMT A;  5HZL B;  3KJ4 A;  4GLP A;  1O6V A;  3RW7 A;  1XEU A;  5IJB A;  4OQT A;  2RR6 A;  3W3L A;  3G04 C;  3UL8 A;  4U09 A;  2Y5Q A;  2WQV A;  1OTN A;  4HQ1 A;  3E4G A;  3ZYO A;  4R58 A;  4G8A A;  3G3B A;  3C6P B;  4RWT C;  4U06 A;  3G3A A;  2JE0 A;  4BSR A;  2WQW A;  5GMF A;  3RFS A;  2Z7X A;  4NKG A;  4R08 A;  2O6S A;  4XGO A;  1FT8 A;  1WWL A;  5GS2 B;  1XKU A;  1DFJ I;  4NKH A;  2A0Z A;  2BEX A;  4KNG A;  2O6R A;  4WYK A;  4R09 A;  4CC4 C;  1XWD C;  4PSJ A;  4CNM A;  4CIL A;  4J0M A;  4RCA B;  4M7E C;  4MN8 B;  1KOO A;  1XEC A;  3ULV A;  4P8S A;  4YEB B;  1JL5 A;  2P1P B;  2Z62 A;  1OZN A;  4BV4 R;  5GS0 A;  4LXR A;  4NZT M;  3CVR A;  4RCW A;  3VQ2 A;  4LI2 A;  4FD0 A;  1FO1 A;  3BZ5 A;  3TSR E;  4M7E A;  1IO0 A;  4ECN A;  3RFE A;  2V9T B;  3ZYI A;  1M9S A;  5AWC A;  2O6Q A;  1OTM A;  2XWT C;  1ZIW A;  1DCE A;  1FQV A;  4FCG A;  4UFR A;  1PGV A;  3SB4 A;  2RA8 A;  4Y61 B;  3UL9 A;  3ULA A;  2OMZ A;  4KT1 A;  4Z61 C;  4V2C A;  3M18 A;  1H6U A;  2CA6 A;  2Z65 A;  4B8C D;  3OGK B;  5HDH A;  3WN4 A;  4Z8G A;  4R0A A;  1DS9 A;  2Z64 A;  4R6A A;  4I6J B;  1M0Z A;  5LFN A;  3RFJ A;  2JQD A;  3O6N A;  3VQ1 A;  3ZYJ A;  4XSQ A;  5GMH A;  3P72 A;  1D0B A;  1Z7X W;  4AW4 A;  4FHO A;  4QC0 A;  2UZY A;  1QYY A;  1OOK G;  5IJC A;  2Q4G W;  4Q62 A;  3ZYN A;  3WPD A;  4R5D A;  2OMX A;  4LI1 A;  4H09 A;  3UL7 A;  4PER A;  2P1O B;  1XCD A;  4U08 A;  4XOS A;  4GT6 A;  3G06 A;  1K5D C;  3W3J A;  4FMZ A;  4Q3I A;  1M9L A;  1P9A G;  1FS2 A;  4R5C A;  3RJ0 A;  4AY9 X;  2IFG A;  2Z66 A;  2WQU A;  4ARN A;  5GMG A;  4LSA A;  1K5G C;  4Q3G A;  5B0T A;  5IJD A;  2OMU A;  5AZ5 A;  2WFH A;  4LXS A;  3W3M A;  3RIZ A;  2ELL A;  4R6G A;  4Z64 C;  3OGM B;  4Z79 A;  2UZX A;  2BNH A;  2V70 A;  2OMY A;  3OJA B;  3OGL B;  5IYX C;  4R6F A;  2ASS B;  1O6S A;  2AST B;  3WPB A;  3C6O B;  4WP6 A;  3WPG A;  5B0N A;  2Z63 A;  3CIY A;  4FS7 A;  3G39 A;  4CP6 A;  4KXF B;  3WPE A;  3RGZ A;  1YRG A;  4ECO A;  1P8T A;  4C2B B;  3E3Z A;  4PQ8 A;  4R07 A;  4IM6 A;  4L3F A;  5CMP A;  4QBZ A;  4BSS A;  4CNC A;  3GOZ A;  4C2A B;  3W3K A;  3RW6 A;  1W8A A;  1SQ0 B;  1O6T A;  4P91 A;  4J4L A;  3OJA A;  1OTO A;  1H6T A;  5A5C A;  2R9U A;  3WPH A;  2FT3 A;  3W3N A;  3C6N B;  1OGQ A;  2P1N B;  4FDW A;  1A4Y A; 
#chains in the Genus database with same CATH homology
 1M10 B;  5AWD A;  3O53 A;  4TZH A;  5FTT B;  3WPC A;  4QXE A;  4PKI G;  3ULU A;  1LTX A;  3REZ A;  4Z94 G;  4K17 A;  1P8V A;  4BSU A;  3JB9 j;  2WQX A;  2OMW A;  3PMH G;  3E6J A;  3W3G A;  4U7L A;  3CIG A;  2OMV A;  4MQW X;  5CMN A;  4R6J A;  4CC4 A;  1G9U A;  3A79 B;  2V9S A;  4LSX C;  5B4P A;  5AWA A;  3FXI A;  4PEQ B;  4LSC A;  2Z7X B;  1KOH A;  2XOT A;  2Z82 A;  4L3A A;  1U0N D;  4V2E A;  1A9N A;  4ARR A;  2P1Q B;  1GWB A;  3WPF A;  3E2J A;  3RGX A;  2JE1 A;  5D3I A;  3M19 A;  5GQR K;  3UN9 A;  5AWB A;  4V2D A;  3WPI A;  2ID5 A;  3DZE A;  2P1M B;  4LSX A;  4EZG A;  2Z81 A;  2OMT A;  5HZL B;  3KJ4 A;  4GLP A;  1O6V A;  3RW7 A;  1XEU A;  5IJB A;  4OQT A;  2RR6 A;  3W3L A;  3G04 C;  3UL8 A;  4U09 A;  2Y5Q A;  2WQV A;  1OTN A;  4HQ1 A;  3E4G A;  3ZYO A;  4R58 A;  4G8A A;  3G3B A;  3C6P B;  4RWT C;  4U06 A;  3G3A A;  2JE0 A;  4BSR A;  2WQW A;  5GMF A;  3RFS A;  2Z7X A;  4NKG A;  4R08 A;  2O6S A;  4XGO A;  1FT8 A;  1WWL A;  5GS2 B;  1XKU A;  1DFJ I;  4NKH A;  2A0Z A;  2BEX A;  4KNG A;  2O6R A;  4WYK A;  4R09 A;  4CC4 C;  1XWD C;  4PSJ A;  4CNM A;  4CIL A;  4J0M A;  4RCA B;  4M7E C;  4MN8 B;  1KOO A;  1XEC A;  3ULV A;  4P8S A;  4YEB B;  1JL5 A;  2P1P B;  2Z62 A;  1OZN A;  4BV4 R;  5GS0 A;  4LXR A;  3CVR A;  4RCW A;  3VQ2 A;  4LI2 A;  4FD0 A;  1FO1 A;  3BZ5 A;  3TSR E;  4M7E A;  1IO0 A;  4ECN A;  3RFE A;  2V9T B;  3ZYI A;  1M9S A;  5AWC A;  2O6Q A;  1OTM A;  2XWT C;  1ZIW A;  1DCE A;  1FQV A;  4FCG A;  4UFR A;  1PGV A;  3SB4 A;  2RA8 A;  4Y61 B;  3UL9 A;  3ULA A;  2OMZ A;  4KT1 A;  4Z61 C;  4V2C A;  3M18 A;  1H6U A;  2CA6 A;  2Z65 A;  4B8C D;  3OGK B;  5HDH A;  3WN4 A;  4Z8G A;  4R0A A;  1DS9 A;  2Z64 A;  4R6A A;  4I6J B;  1M0Z A;  5LFN A;  3RFJ A;  2JQD A;  3O6N A;  3VQ1 A;  3ZYJ A;  4XSQ A;  5GMH A;  3P72 A;  1D0B A;  1Z7X W;  4AW4 A;  4FHO A;  4QC0 A;  2UZY A;  1QYY A;  1OOK G;  5IJC A;  2Q4G W;  4Q62 A;  3ZYN A;  3WPD A;  4R5D A;  2OMX A;  4LI1 A;  4H09 A;  3UL7 A;  4PER A;  2P1O B;  1XCD A;  4U08 A;  4XOS A;  4GT6 A;  3G06 A;  1K5D C;  3W3J A;  4FMZ A;  4Q3I A;  1M9L A;  1P9A G;  1FS2 A;  4R5C A;  3RJ0 A;  4AY9 X;  2IFG A;  2Z66 A;  2WQU A;  4ARN A;  5GMG A;  4LSA A;  1K5G C;  4Q3G A;  5B0T A;  5IJD A;  2OMU A;  5AZ5 A;  2WFH A;  4LXS A;  3W3M A;  3RIZ A;  2ELL A;  4R6G A;  4Z64 C;  3OGM B;  4Z79 A;  2UZX A;  2BNH A;  2V70 A;  2OMY A;  3OJA B;  3OGL B;  5IYX C;  4R6F A;  2ASS B;  1O6S A;  2AST B;  3WPB A;  3C6O B;  4WP6 A;  3WPG A;  5B0N A;  2Z63 A;  3CIY A;  4FS7 A;  3G39 A;  4CP6 A;  4KXF B;  3WPE A;  3RGZ A;  1YRG A;  4ECO A;  1P8T A;  4C2B B;  3E3Z A;  4PQ8 A;  4R07 A;  4IM6 A;  4L3F A;  5CMP A;  4QBZ A;  4BSS A;  4CNC A;  3GOZ A;  4C2A B;  3W3K A;  3RW6 A;  1W8A A;  1SQ0 B;  1O6T A;  4P91 A;  4J4L A;  3OJA A;  1OTO A;  1H6T A;  5A5C A;  2R9U A;  3WPH A;  2FT3 A;  3W3N A;  3C6N B;  1OGQ A;  2P1N B;  4FDW A;  1A4Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...