4QXEA

Crystal structure of lgr4 fused with hagfish vlr
Total Genus 144
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
144
sequence length
443
structure length
443
Chain Sequence
MDPLCAAPCSCDGDRRVDCSGKGLTAVPEGLSAFTQALDISMNNITQLPEGAFKNFPFLEELQLAGNDLSFIHPKALSGLKELKVLTLQNNQLKTVPSEAIRGLSALQSLRLDANHITSVPEDSFEGLVQLRHLWLDDNSLTEVPVHPLSNLPTLQALTLALNKISSIPDFAFTNLSSLVVLHLHNNKIRSLSQHCFDGLDNLETLDLNYNNLGEFPQAIKALPSLKELGFHSNSISVIPDGAFDGNPLLRTIHLYDNPLSFVGNSAFHNLSDLHSLVIRGASMVQQFPNLTGTVHLESLTLTGTKISSIPNNLCQEQKMLRTLDLSYNNIRDLPSFNGCHALEEISLQRNQIYQIKEGTFQGLISLRILDLASNQLKSVPDGIFDRLTSLQKIWLHTNPWDCSCPRIDYLSRWLNKNSQKEQGSAKCSGSGKPVRSIICPTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of LGR4 fused with hagfish VLR
rcsb
molecule keywords Leucine-rich repeat-containing G-protein coupled receptor 4,
molecule tags Membrane protein
source organism Homo sapiens
total genus 144
structure length 443
sequence length 443
ec nomenclature
pdb deposition date 2014-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01462 LRRNT Leucine rich repeat N-terminal domain
A PF13855 LRR_8 Leucine rich repeat
A PF01462 LRRNT Leucine rich repeat N-terminal domain
A PF13855 LRR_8 Leucine rich repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 4qxeA01
4GLPA 1GWBA 4HQ1A 3ULUA 3WPHA 4CNMA 4UFRA 3A79B 2Z7XB 4PEQB 3WPDA 5FTTB 5GMHA 1P9AG 5IYXC 2P1MB 4H09A 4TZHA 4J4LA 4FHOA 4K17A 4C2AB 3OGKB 4G8AA 4OQTA 1ZIWA 1WWLA 3BZ5A 4BSRA 3ULVA 4LSAA 4AW4A 5AWAA 3WPCA 2Q4GW 3G3BA 2O6SA 1FS2A 5GMGA 3WPGA 2BEXA 4BSSA 5HZLB 5AWBA 4V2DA 4V2EA 2V70A 3P72A 4MQWX 3RW6A 2ID5A 2Z82A 5IJDA 3SB4A 2ASTB 2Z65A 4R0AA 1OGQA 2ASSB 5AWDA 4PSJA 5AWCA 4Z94G 3RGXA 4AY9X 2OMYA 5D3IA 4U09A 5A5CA 4KNGA 4R58A 3CIGA 1XECA 2XOTA 3C6OB 4ECOA 3OJAA 3WPFA 1A4YA 4CILA 3O6NA 3C6NB 3G04C 3ZYJA 4IM6A 1XEUA 2P1NB 1M0ZA 3W3JA 5HDHA 3UL8A 2OMZA 4V2CA 4P91A 4LXRA 3CVRA 4PKIG 4QC0A 4FS7A 3ZYNA 2WQVA 2V9SA 1U0ND 3RJ0A 2BNHA 4R5CA 4R5DA 4Z8GA 2R9UA 3W3GA 1KOHA 1G9UA 2JE0A 3FXIA 5AZ5A 4LI1A 4QBZA 3RGZA 4FCGA 5CMPA 4M7EC 4Y61B 4WYKA 4RWTC 3UN9A 2P1OB 4NKHA 3RW7A 4ECNA 2IFGA 1SQ0B 1H6TA 3TSRE 5B4PA 4LSCA 4Q3IA 4EZGA 3W3LA 4LI2A 1FO1A 1YRGA 3PMHG 5IJBA 2O6QA 2UZXA 1M9LA 3GOZA 1OOKG 5CMNA 4Z64C 3G39A 3E2JA 1O6SA 2XWTC 3REZA 4M7EA 4LXSA 3ZYIA 4R09A 2Z81A 2Z66A 3M19A 1Z7XW 2V9TB 2RA8A 3RIZA 4PERA 4L3FA 3E4GA 2ELLA 4Q3GA 1OZNA 4YEBB 4U06A 2Z63A 2WQWA 2P1QB 1KOOA 4R07A 3WN4A 3W3MA 2Z62A 3OJAB 4GT6A 5GS0A 3O53A 1JL5A 3C6PB 3W3KA 4R6JA 1M10B 1LTXA 4KT1A 4J0MA 5GS2B 1M9SA 3WPIA 1K5DC 4PQ8A 1DS9A 3VQ1A 1D0BA 4U7LA 4FD0A 1K5GC 3ULAA 4BV4R 4NKGA 5GQRK 2WFHA 1FQVA 1H6UA 4R6GA 2O6RA 1P8TA 4R6FA 1W8AA 1IO0A 2OMVA 2Z7XA 3VQ2A 2JQDA 1FT8A 4XGOA 1DCEA 4XOSA 4Z79A 1QYYA 2CA6A 4LSXC 5GMFA 4P8SA 1XCDA 4RCAB 4Q62A 3WPEA 4XSQA 1O6VA 3DZEA 4MN8B 3G3AA 4L3AA 4BSUA 1XKUA 3KJ4A 3RFEA 4CP6A 4FMZA 4RCWA 3UL9A 3RFSA 4Z61C 4U08A 4R08A 4B8CD 3E3ZA 4CC4C 3WPBA 2RR6A 1DFJI 3OGMB 3UL7A 4LSXA 3JB9j 5IJCA 4C2BB 2WQXA 4R6AA 1OTOA 1P8VA 2JE1A 4ARRA 3W3NA 1OTNA 2OMTA 3M18A 5B0TA 3OGLB 5LFNA 3ZYOA 1PGVA 2Z64A 4CC4A 4FDWA 4ARNA 2FT3A 2UZYA 4QXEA 4WP6A 1A9NA 2OMXA 3CIYA 4CNCA 3G06A 1OTMA 5B0NA 1O6TA 2WQUA 3RFJA 2OMWA 2OMUA 4I6JB 2Y5QA 2P1PB 3E6JA 1XWDC 2A0ZA 4KXFB
chains in the Genus database with same CATH superfamily
4GLPA 1GWBA 4HQ1A 3ULUA 3WPHA 4CNMA 4UFRA 3A79B 2Z7XB 4PEQB 3WPDA 5FTTB 5GMHA 1P9AG 5IYXC 2P1MB 4H09A 4TZHA 4J4LA 4FHOA 4K17A 4C2AB 3OGKB 4G8AA 4OQTA 1ZIWA 1WWLA 3BZ5A 4BSRA 3ULVA 4LSAA 4AW4A 5AWAA 3WPCA 2Q4GW 3G3BA 4NZTM 2O6SA 1FS2A 5GMGA 3WPGA 2BEXA 4BSSA 5HZLB 5AWBA 4V2DA 4V2EA 2V70A 3P72A 4MQWX 3RW6A 2ID5A 2Z82A 5IJDA 3SB4A 2ASTB 2Z65A 4R0AA 1OGQA 2ASSB 5AWDA 4PSJA 5AWCA 4Z94G 3RGXA 4AY9X 2OMYA 5D3IA 4U09A 5A5CA 4KNGA 4R58A 3CIGA 1XECA 2XOTA 3C6OB 4ECOA 3OJAA 3WPFA 1A4YA 4CILA 3O6NA 3C6NB 3G04C 3ZYJA 4IM6A 1XEUA 2P1NB 1M0ZA 3W3JA 5HDHA 3UL8A 2OMZA 4V2CA 4P91A 4LXRA 3CVRA 4PKIG 4QC0A 4FS7A 3ZYNA 2WQVA 2V9SA 1U0ND 3RJ0A 2BNHA 4R5CA 4R5DA 4Z8GA 2R9UA 3W3GA 1KOHA 1G9UA 2JE0A 3FXIA 5AZ5A 4LI1A 4QBZA 3RGZA 4FCGA 5CMPA 4M7EC 4Y61B 4WYKA 4RWTC 3UN9A 2P1OB 4NKHA 3RW7A 4ECNA 2IFGA 1SQ0B 1H6TA 3TSRE 5B4PA 4LSCA 4Q3IA 4EZGA 3W3LA 4LI2A 1FO1A 1YRGA 3PMHG 5IJBA 2O6QA 2UZXA 1M9LA 3GOZA 1OOKG 5CMNA 4Z64C 3G39A 3E2JA 1O6SA 2XWTC 3REZA 4M7EA 4LXSA 3ZYIA 4R09A 2Z81A 2Z66A 3M19A 1Z7XW 2V9TB 2RA8A 3RIZA 4PERA 4L3FA 3E4GA 2ELLA 4Q3GA 1OZNA 4YEBB 4U06A 2Z63A 2WQWA 2P1QB 1KOOA 4R07A 3WN4A 3W3MA 2Z62A 3OJAB 4GT6A 5GS0A 3O53A 1JL5A 3C6PB 3W3KA 4R6JA 1M10B 1LTXA 4KT1A 4J0MA 5GS2B 1M9SA 3WPIA 1K5DC 4PQ8A 1DS9A 3VQ1A 1D0BA 4U7LA 4FD0A 1K5GC 3ULAA 4BV4R 4NKGA 5GQRK 2WFHA 1FQVA 1H6UA 4R6GA 2O6RA 1P8TA 4R6FA 1W8AA 1IO0A 2OMVA 2Z7XA 3VQ2A 2JQDA 1FT8A 4XGOA 1DCEA 4NZRM 4XOSA 4Z79A 1QYYA 2CA6A 4LSXC 5GMFA 4P8SA 1XCDA 4RCAB 4Q62A 3WPEA 4XSQA 1O6VA 3DZEA 4MN8B 3G3AA 4L3AA 4BSUA 1XKUA 3KJ4A 3RFEA 4CP6A 4FMZA 4RCWA 3UL9A 3RFSA 4Z61C 4U08A 4R08A 4B8CD 3E3ZA 4CC4C 3WPBA 2RR6A 1DFJI 3OGMB 3UL7A 4LSXA 3JB9j 5IJCA 4C2BB 2WQXA 4R6AA 1OTOA 1P8VA 2JE1A 4ARRA 3W3NA 1OTNA 2OMTA 3M18A 5B0TA 3OGLB 5LFNA 3ZYOA 1PGVA 2Z64A 4CC4A 4FDWA 4ARNA 2FT3A 2UZYA 4QXEA 4WP6A 1A9NA 2OMXA 3CIYA 4CNCA 3G06A 1OTMA 5B0NA 1O6TA 2WQUA 3RFJA 2OMWA 2OMUA 4I6JB 2Y5QA 2P1PB 3E6JA 1XWDC 2A0ZA 4KXFB
chains in the Genus database with same CATH topology
4GLPA 1GWBA 4HQ1A 3ULUA 3WPHA 4CNMA 4UFRA 3A79B 2Z7XB 4PEQB 3WPDA 5FTTB 5GMHA 1P9AG 5IYXC 2P1MB 4H09A 4TZHA 4J4LA 4FHOA 4K17A 4C2AB 3OGKB 4G8AA 4OQTA 1ZIWA 1WWLA 3BZ5A 4BSRA 3ULVA 4LSAA 4AW4A 5AWAA 3WPCA 2Q4GW 3G3BA 2O6SA 1FS2A 5GMGA 3WPGA 2BEXA 4BSSA 5HZLB 5AWBA 4V2DA 4V2EA 2V70A 3P72A 4MQWX 3RW6A 2ID5A 2Z82A 5IJDA 3SB4A 2ASTB 2Z65A 4R0AA 1OGQA 2ASSB 5AWDA 4PSJA 5AWCA 4Z94G 3RGXA 4AY9X 2OMYA 5D3IA 4U09A 5A5CA 4KNGA 4R58A 3CIGA 1XECA 2XOTA 3C6OB 4ECOA 3OJAA 3WPFA 1A4YA 4CILA 3O6NA 3C6NB 3G04C 3ZYJA 4IM6A 1XEUA 2P1NB 1M0ZA 3W3JA 5HDHA 3UL8A 2OMZA 4V2CA 4P91A 4LXRA 3CVRA 4PKIG 4QC0A 4FS7A 3ZYNA 2WQVA 2V9SA 1U0ND 3RJ0A 2BNHA 4R5CA 4R5DA 4Z8GA 2R9UA 3W3GA 1KOHA 1G9UA 2JE0A 3FXIA 5AZ5A 4LI1A 4QBZA 3RGZA 4FCGA 5CMPA 4M7EC 4Y61B 4WYKA 4RWTC 3UN9A 2P1OB 4NKHA 3RW7A 4ECNA 2IFGA 1SQ0B 1H6TA 3TSRE 5B4PA 4LSCA 4Q3IA 4EZGA 3W3LA 4LI2A 1FO1A 1YRGA 3PMHG 5IJBA 2O6QA 2UZXA 1M9LA 3GOZA 1OOKG 5CMNA 4Z64C 3G39A 3E2JA 1O6SA 2XWTC 3REZA 4M7EA 4LXSA 3ZYIA 4R09A 2Z81A 2Z66A 3M19A 1Z7XW 2V9TB 2RA8A 3RIZA 4PERA 4L3FA 3E4GA 2ELLA 4Q3GA 1OZNA 4YEBB 4U06A 2Z63A 2WQWA 2P1QB 1KOOA 4R07A 3WN4A 3W3MA 2Z62A 3OJAB 4GT6A 5GS0A 3O53A 1JL5A 3C6PB 3W3KA 4R6JA 1M10B 1LTXA 4KT1A 4J0MA 5GS2B 1M9SA 3WPIA 1K5DC 4PQ8A 1DS9A 3VQ1A 1D0BA 4U7LA 4FD0A 1K5GC 3ULAA 4BV4R 4NKGA 5GQRK 2WFHA 1FQVA 1H6UA 4R6GA 2O6RA 1P8TA 4R6FA 1W8AA 1IO0A 2OMVA 2Z7XA 3VQ2A 2JQDA 1FT8A 4XGOA 1DCEA 4XOSA 4Z79A 1QYYA 2CA6A 4LSXC 5GMFA 4P8SA 1XCDA 4RCAB 4Q62A 3WPEA 4XSQA 1O6VA 3DZEA 4MN8B 3G3AA 4L3AA 4BSUA 1XKUA 3KJ4A 3RFEA 4CP6A 4FMZA 4RCWA 3UL9A 3RFSA 4Z61C 4U08A 4R08A 4B8CD 3E3ZA 4CC4C 3WPBA 2RR6A 1DFJI 3OGMB 3UL7A 4LSXA 3JB9j 5IJCA 4C2BB 2WQXA 4R6AA 1OTOA 1P8VA 2JE1A 4ARRA 3W3NA 1OTNA 2OMTA 3M18A 5B0TA 3OGLB 5LFNA 3ZYOA 1PGVA 2Z64A 4CC4A 4FDWA 4ARNA 2FT3A 2UZYA 4QXEA 4WP6A 1A9NA 2OMXA 3CIYA 4CNCA 3G06A 1OTMA 5B0NA 1O6TA 2WQUA 3RFJA 2OMWA 2OMUA 4I6JB 2Y5QA 2P1PB 3E6JA 1XWDC 2A0ZA 4KXFB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GLP A;  1GWB A;  4HQ1 A;  3ULU A;  3WPH A;  4CNM A;  4UFR A;  3A79 B;  2Z7X B;  4PEQ B;  3WPD A;  5FTT B;  5GMH A;  1P9A G;  5IYX C;  2P1M B;  4H09 A;  4TZH A;  4J4L A;  4FHO A;  4K17 A;  4C2A B;  3OGK B;  4G8A A;  4OQT A;  1ZIW A;  1WWL A;  3BZ5 A;  4BSR A;  3ULV A;  4LSA A;  4AW4 A;  5AWA A;  3WPC A;  2Q4G W;  3G3B A;  2O6S A;  1FS2 A;  5GMG A;  3WPG A;  2BEX A;  4BSS A;  5HZL B;  5AWB A;  4V2D A;  4V2E A;  2V70 A;  3P72 A;  4MQW X;  3RW6 A;  2ID5 A;  2Z82 A;  5IJD A;  3SB4 A;  2AST B;  2Z65 A;  4R0A A;  1OGQ A;  2ASS B;  5AWD A;  4PSJ A;  5AWC A;  4Z94 G;  3RGX A;  4AY9 X;  2OMY A;  5D3I A;  4U09 A;  5A5C A;  4KNG A;  4R58 A;  3CIG A;  1XEC A;  2XOT A;  3C6O B;  4ECO A;  3OJA A;  3WPF A;  1A4Y A;  4CIL A;  3O6N A;  3C6N B;  3G04 C;  3ZYJ A;  4IM6 A;  1XEU A;  2P1N B;  1M0Z A;  3W3J A;  5HDH A;  3UL8 A;  2OMZ A;  4V2C A;  4P91 A;  4LXR A;  3CVR A;  4PKI G;  4QC0 A;  4FS7 A;  3ZYN A;  2WQV A;  2V9S A;  1U0N D;  3RJ0 A;  2BNH A;  4R5C A;  4R5D A;  4Z8G A;  2R9U A;  3W3G A;  1KOH A;  1G9U A;  2JE0 A;  3FXI A;  5AZ5 A;  4LI1 A;  4QBZ A;  3RGZ A;  4FCG A;  5CMP A;  4M7E C;  4Y61 B;  4WYK A;  4RWT C;  3UN9 A;  2P1O B;  4NKH A;  3RW7 A;  4ECN A;  2IFG A;  1SQ0 B;  1H6T A;  3TSR E;  5B4P A;  4LSC A;  4Q3I A;  4EZG A;  3W3L A;  4LI2 A;  1FO1 A;  1YRG A;  3PMH G;  5IJB A;  2O6Q A;  2UZX A;  1M9L A;  3GOZ A;  1OOK G;  5CMN A;  4Z64 C;  3G39 A;  3E2J A;  1O6S A;  2XWT C;  3REZ A;  4M7E A;  4LXS A;  3ZYI A;  4R09 A;  2Z81 A;  2Z66 A;  3M19 A;  1Z7X W;  2V9T B;  2RA8 A;  3RIZ A;  4PER A;  4L3F A;  3E4G A;  2ELL A;  4Q3G A;  1OZN A;  4YEB B;  4U06 A;  2Z63 A;  2WQW A;  2P1Q B;  1KOO A;  4R07 A;  3WN4 A;  3W3M A;  2Z62 A;  3OJA B;  4GT6 A;  5GS0 A;  3O53 A;  1JL5 A;  3C6P B;  3W3K A;  4R6J A;  1M10 B;  1LTX A;  4KT1 A;  4J0M A;  5GS2 B;  1M9S A;  3WPI A;  1K5D C;  4PQ8 A;  1DS9 A;  3VQ1 A;  1D0B A;  4U7L A;  4FD0 A;  1K5G C;  3ULA A;  4BV4 R;  4NKG A;  5GQR K;  2WFH A;  1FQV A;  1H6U A;  4R6G A;  2O6R A;  1P8T A;  4R6F A;  1W8A A;  1IO0 A;  2OMV A;  2Z7X A;  3VQ2 A;  2JQD A;  1FT8 A;  4XGO A;  1DCE A;  4XOS A;  4Z79 A;  1QYY A;  2CA6 A;  4LSX C;  5GMF A;  4P8S A;  1XCD A;  4RCA B;  4Q62 A;  3WPE A;  4XSQ A;  1O6V A;  3DZE A;  4MN8 B;  3G3A A;  4L3A A;  4BSU A;  1XKU A;  3KJ4 A;  3RFE A;  4CP6 A;  4FMZ A;  4RCW A;  3UL9 A;  3RFS A;  4Z61 C;  4U08 A;  4R08 A;  4B8C D;  3E3Z A;  4CC4 C;  3WPB A;  2RR6 A;  1DFJ I;  3OGM B;  3UL7 A;  4LSX A;  3JB9 j;  5IJC A;  4C2B B;  2WQX A;  4R6A A;  1OTO A;  1P8V A;  2JE1 A;  4ARR A;  3W3N A;  1OTN A;  2OMT A;  3M18 A;  5B0T A;  3OGL B;  5LFN A;  3ZYO A;  1PGV A;  2Z64 A;  4CC4 A;  4FDW A;  4ARN A;  2FT3 A;  2UZY A;  4QXE A;  4WP6 A;  1A9N A;  2OMX A;  3CIY A;  4CNC A;  3G06 A;  1OTM A;  5B0N A;  1O6T A;  2WQU A;  3RFJ A;  2OMW A;  2OMU A;  4I6J B;  2Y5Q A;  2P1P B;  3E6J A;  1XWD C;  2A0Z A;  4KXF B; 
#chains in the Genus database with same CATH topology
 4GLP A;  1GWB A;  4HQ1 A;  3ULU A;  3WPH A;  4CNM A;  4UFR A;  3A79 B;  2Z7X B;  4PEQ B;  3WPD A;  5FTT B;  5GMH A;  1P9A G;  5IYX C;  2P1M B;  4H09 A;  4TZH A;  4J4L A;  4FHO A;  4K17 A;  4C2A B;  3OGK B;  4G8A A;  4OQT A;  1ZIW A;  1WWL A;  3BZ5 A;  4BSR A;  3ULV A;  4LSA A;  4AW4 A;  5AWA A;  3WPC A;  2Q4G W;  3G3B A;  4NZT M;  2O6S A;  1FS2 A;  5GMG A;  3WPG A;  2BEX A;  4BSS A;  5HZL B;  5AWB A;  4V2D A;  4V2E A;  2V70 A;  3P72 A;  4MQW X;  3RW6 A;  2ID5 A;  2Z82 A;  5IJD A;  3SB4 A;  2AST B;  2Z65 A;  4R0A A;  1OGQ A;  2ASS B;  5AWD A;  4PSJ A;  5AWC A;  4Z94 G;  3RGX A;  4AY9 X;  2OMY A;  5D3I A;  4U09 A;  5A5C A;  4KNG A;  4R58 A;  3CIG A;  1XEC A;  2XOT A;  3C6O B;  4ECO A;  3OJA A;  3WPF A;  1A4Y A;  4CIL A;  3O6N A;  3C6N B;  3G04 C;  3ZYJ A;  4IM6 A;  1XEU A;  2P1N B;  1M0Z A;  3W3J A;  5HDH A;  3UL8 A;  2OMZ A;  4V2C A;  4P91 A;  4LXR A;  3CVR A;  4PKI G;  4QC0 A;  4FS7 A;  3ZYN A;  2WQV A;  2V9S A;  1U0N D;  3RJ0 A;  2BNH A;  4R5C A;  4R5D A;  4Z8G A;  2R9U A;  3W3G A;  1KOH A;  1G9U A;  2JE0 A;  3FXI A;  5AZ5 A;  4LI1 A;  4QBZ A;  3RGZ A;  4FCG A;  5CMP A;  4M7E C;  4Y61 B;  4WYK A;  4RWT C;  3UN9 A;  2P1O B;  4NKH A;  3RW7 A;  4ECN A;  2IFG A;  1SQ0 B;  1H6T A;  3TSR E;  5B4P A;  4LSC A;  4Q3I A;  4EZG A;  3W3L A;  4LI2 A;  1FO1 A;  1YRG A;  3PMH G;  5IJB A;  2O6Q A;  2UZX A;  1M9L A;  3GOZ A;  1OOK G;  5CMN A;  4Z64 C;  3G39 A;  3E2J A;  1O6S A;  2XWT C;  3REZ A;  4M7E A;  4LXS A;  3ZYI A;  4R09 A;  2Z81 A;  2Z66 A;  3M19 A;  1Z7X W;  2V9T B;  2RA8 A;  3RIZ A;  4PER A;  4L3F A;  3E4G A;  2ELL A;  4Q3G A;  1OZN A;  4YEB B;  4U06 A;  2Z63 A;  2WQW A;  2P1Q B;  1KOO A;  4R07 A;  3WN4 A;  3W3M A;  2Z62 A;  3OJA B;  4GT6 A;  5GS0 A;  3O53 A;  1JL5 A;  3C6P B;  3W3K A;  4R6J A;  1M10 B;  1LTX A;  4KT1 A;  4J0M A;  5GS2 B;  1M9S A;  3WPI A;  1K5D C;  4PQ8 A;  1DS9 A;  3VQ1 A;  1D0B A;  4U7L A;  4FD0 A;  1K5G C;  3ULA A;  4BV4 R;  4NKG A;  5GQR K;  2WFH A;  1FQV A;  1H6U A;  4R6G A;  2O6R A;  1P8T A;  4R6F A;  1W8A A;  1IO0 A;  2OMV A;  2Z7X A;  3VQ2 A;  2JQD A;  1FT8 A;  4XGO A;  1DCE A;  4NZR M;  4XOS A;  4Z79 A;  1QYY A;  2CA6 A;  4LSX C;  5GMF A;  4P8S A;  1XCD A;  4RCA B;  4Q62 A;  3WPE A;  4XSQ A;  1O6V A;  3DZE A;  4MN8 B;  3G3A A;  4L3A A;  4BSU A;  1XKU A;  3KJ4 A;  3RFE A;  4CP6 A;  4FMZ A;  4RCW A;  3UL9 A;  3RFS A;  4Z61 C;  4U08 A;  4R08 A;  4B8C D;  3E3Z A;  4CC4 C;  3WPB A;  2RR6 A;  1DFJ I;  3OGM B;  3UL7 A;  4LSX A;  3JB9 j;  5IJC A;  4C2B B;  2WQX A;  4R6A A;  1OTO A;  1P8V A;  2JE1 A;  4ARR A;  3W3N A;  1OTN A;  2OMT A;  3M18 A;  5B0T A;  3OGL B;  5LFN A;  3ZYO A;  1PGV A;  2Z64 A;  4CC4 A;  4FDW A;  4ARN A;  2FT3 A;  2UZY A;  4QXE A;  4WP6 A;  1A9N A;  2OMX A;  3CIY A;  4CNC A;  3G06 A;  1OTM A;  5B0N A;  1O6T A;  2WQU A;  3RFJ A;  2OMW A;  2OMU A;  4I6J B;  2Y5Q A;  2P1P B;  3E6J A;  1XWD C;  2A0Z A;  4KXF B; 
#chains in the Genus database with same CATH homology
 4GLP A;  1GWB A;  4HQ1 A;  3ULU A;  3WPH A;  4CNM A;  4UFR A;  3A79 B;  2Z7X B;  4PEQ B;  3WPD A;  5FTT B;  5GMH A;  1P9A G;  5IYX C;  2P1M B;  4H09 A;  4TZH A;  4J4L A;  4FHO A;  4K17 A;  4C2A B;  3OGK B;  4G8A A;  4OQT A;  1ZIW A;  1WWL A;  3BZ5 A;  4BSR A;  3ULV A;  4LSA A;  4AW4 A;  5AWA A;  3WPC A;  2Q4G W;  3G3B A;  2O6S A;  1FS2 A;  5GMG A;  3WPG A;  2BEX A;  4BSS A;  5HZL B;  5AWB A;  4V2D A;  4V2E A;  2V70 A;  3P72 A;  4MQW X;  3RW6 A;  2ID5 A;  2Z82 A;  5IJD A;  3SB4 A;  2AST B;  2Z65 A;  4R0A A;  1OGQ A;  2ASS B;  5AWD A;  4PSJ A;  5AWC A;  4Z94 G;  3RGX A;  4AY9 X;  2OMY A;  5D3I A;  4U09 A;  5A5C A;  4KNG A;  4R58 A;  3CIG A;  1XEC A;  2XOT A;  3C6O B;  4ECO A;  3OJA A;  3WPF A;  1A4Y A;  4CIL A;  3O6N A;  3C6N B;  3G04 C;  3ZYJ A;  4IM6 A;  1XEU A;  2P1N B;  1M0Z A;  3W3J A;  5HDH A;  3UL8 A;  2OMZ A;  4V2C A;  4P91 A;  4LXR A;  3CVR A;  4PKI G;  4QC0 A;  4FS7 A;  3ZYN A;  2WQV A;  2V9S A;  1U0N D;  3RJ0 A;  2BNH A;  4R5C A;  4R5D A;  4Z8G A;  2R9U A;  3W3G A;  1KOH A;  1G9U A;  2JE0 A;  3FXI A;  5AZ5 A;  4LI1 A;  4QBZ A;  3RGZ A;  4FCG A;  5CMP A;  4M7E C;  4Y61 B;  4WYK A;  4RWT C;  3UN9 A;  2P1O B;  4NKH A;  3RW7 A;  4ECN A;  2IFG A;  1SQ0 B;  1H6T A;  3TSR E;  5B4P A;  4LSC A;  4Q3I A;  4EZG A;  3W3L A;  4LI2 A;  1FO1 A;  1YRG A;  3PMH G;  5IJB A;  2O6Q A;  2UZX A;  1M9L A;  3GOZ A;  1OOK G;  5CMN A;  4Z64 C;  3G39 A;  3E2J A;  1O6S A;  2XWT C;  3REZ A;  4M7E A;  4LXS A;  3ZYI A;  4R09 A;  2Z81 A;  2Z66 A;  3M19 A;  1Z7X W;  2V9T B;  2RA8 A;  3RIZ A;  4PER A;  4L3F A;  3E4G A;  2ELL A;  4Q3G A;  1OZN A;  4YEB B;  4U06 A;  2Z63 A;  2WQW A;  2P1Q B;  1KOO A;  4R07 A;  3WN4 A;  3W3M A;  2Z62 A;  3OJA B;  4GT6 A;  5GS0 A;  3O53 A;  1JL5 A;  3C6P B;  3W3K A;  4R6J A;  1M10 B;  1LTX A;  4KT1 A;  4J0M A;  5GS2 B;  1M9S A;  3WPI A;  1K5D C;  4PQ8 A;  1DS9 A;  3VQ1 A;  1D0B A;  4U7L A;  4FD0 A;  1K5G C;  3ULA A;  4BV4 R;  4NKG A;  5GQR K;  2WFH A;  1FQV A;  1H6U A;  4R6G A;  2O6R A;  1P8T A;  4R6F A;  1W8A A;  1IO0 A;  2OMV A;  2Z7X A;  3VQ2 A;  2JQD A;  1FT8 A;  4XGO A;  1DCE A;  4XOS A;  4Z79 A;  1QYY A;  2CA6 A;  4LSX C;  5GMF A;  4P8S A;  1XCD A;  4RCA B;  4Q62 A;  3WPE A;  4XSQ A;  1O6V A;  3DZE A;  4MN8 B;  3G3A A;  4L3A A;  4BSU A;  1XKU A;  3KJ4 A;  3RFE A;  4CP6 A;  4FMZ A;  4RCW A;  3UL9 A;  3RFS A;  4Z61 C;  4U08 A;  4R08 A;  4B8C D;  3E3Z A;  4CC4 C;  3WPB A;  2RR6 A;  1DFJ I;  3OGM B;  3UL7 A;  4LSX A;  3JB9 j;  5IJC A;  4C2B B;  2WQX A;  4R6A A;  1OTO A;  1P8V A;  2JE1 A;  4ARR A;  3W3N A;  1OTN A;  2OMT A;  3M18 A;  5B0T A;  3OGL B;  5LFN A;  3ZYO A;  1PGV A;  2Z64 A;  4CC4 A;  4FDW A;  4ARN A;  2FT3 A;  2UZY A;  4QXE A;  4WP6 A;  1A9N A;  2OMX A;  3CIY A;  4CNC A;  3G06 A;  1OTM A;  5B0N A;  1O6T A;  2WQU A;  3RFJ A;  2OMW A;  2OMU A;  4I6J B;  2Y5Q A;  2P1P B;  3E6J A;  1XWD C;  2A0Z A;  4KXF B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...