5GMGA

Crystal structure of monkey tlr7 in complex with loxoribine and polyu
Total Genus 252
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
252
sequence length
806
structure length
762
Chain Sequence
RWFPKTLPCDVTLDHVIVDCTDKHLTEIPGGIPTNTTNLTLTINHIPDISPASFHRLVHLVEIDFRCNCVPIRLGSKSNMCPRRLQIKPRSFSGLTYLKSLYLDGNQLLEIPQGLPPSLQLLSLEANNIFSIRKEQLTELANIEILYLGQNCYYRNPCYVSYSIEKDAFLNLTKLKVLSLKDNNVTTVPTVLPSTLTELYLYNNMIAEIQEDDFNNLNQLQILDLSGNCPRCYNAPFPCTPCKNNSPLQIPVNAFDALTELKVLRLHSNSLQHVPPRWFKNINNLQELDLSQNFLAKEIGDAKFLHFLPNLIQLDLSFNFELQVYRASMNLSQAFSSLKSLKILRIRGYVFKELKSFQLSPLHNLQNLEVLDLGTNFIKIANLSMFKQFKRLKVIDLSVNKISPLYYFRYDKYARSCRSCYKYGQTLDLSKNSIFFIKSSDFQHLSFLKCLNLSGNLISQTLNGSEFQPLAELRYLDFSNNRLDLLHSTAFEELRKLEVLDISSNSHYFQSEGITHMLNFTKNLKVLQKLMMNDNDISSSTSRTMESESLRTLEFRGNHLDVLWRDGDNRYLQLFKNLLKLEELDISKNSLSFLPSGVFDGMPPNLKNLSLAKNGLKSFIWEKLRYLKNLETLDLSHNQLTTVPERLSNCSRSLKNLILKNNQIRSLTKYFLQDAFQLRYLDLSSNKIQMIQKTSFPENVLNNLKMLLLHHNRFLCTCDAVWFVWWVQHTEVTIPYLATDVTCVGPGAHKGQSVISLDLYTC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Toll-like receptor 7
publication title Structural Analysis Reveals that Toll-like Receptor 7 Is a Dual Receptor for Guanosine and Single-Stranded RNA
pubmed doi rcsb
source organism Macaca mulatta
molecule tags Immune system/rna
total genus 252
structure length 762
sequence length 806
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13306 LRR_5 BspA type Leucine rich repeat region (6 copies)
A PF13855 LRR_8 Leucine rich repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 5gmgA00
4BV4R 3W3MA 2BEXA 2OMXA 4P8SA 4BSUA 1M9SA 4RCWA 4KXFB 2OMUA 4TZHA 1U0ND 3ZYIA 3WPBA 3WN4A 3W3NA 4LXRA 4U08A 4PEQB 2A0ZA 1LTXA 4FCGA 3O6NA 2RR6A 3RFJA 3ULAA 1K5GC 3TSRE 4RWTC 5IJDA 1GWBA 4XOSA 5B0TA 1PGVA 3VQ2A 4Y61B 4R6GA 1A9NA 4QC0A 4LSCA 1FO1A 2Q4GW 5IYXC 2IFGA 5CMPA 4QXEA 2P1OB 5GMFA 1XKUA 1W8AA 4KT1A 5LFNA 4PERA 4FMZA 3P72A 1M9LA 2OMZA 4Z8GA 1FS2A 4CNMA 3C6OB 2OMWA 4LI2A 3ZYNA 4Z79A 2O6RA 3OJAA 1M10B 4CC4C 4C2AB 1OTMA 2WQWA 4UFRA 4YEBB 1XEUA 5GMHA 3RIZA 4HQ1A 3RW6A 4C2BB 3BZ5A 3E4GA 3G06A 5B4PA 2BNHA 4LSXA 2P1NB 3ULUA 1O6SA 3E6JA 5CMNA 3FXIA 3UN9A 1G9UA 5IJCA 3VQ1A 3E2JA 2ASSB 4PSJA 2UZYA 1XECA 2Z63A 4MQWX 4CP6A 5A5CA 2Z7XA 1JL5A 5HDHA 3W3JA 3G3AA 3OJAB 2Z81A 5D3IA 5AWBA 1QYYA 2Z65A 3RJ0A 2FT3A 1OTNA 5GS2B 3WPEA 4FDWA 5GMGA 4R6JA 4R07A 1XWDC 2OMVA 1OTOA 3CIYA 2P1MB 2ELLA 3RFSA 5AWDA 4XGOA 1FQVA 4RCAB 4V2DA 5GS0A 2Z62A 4B8CD 2Y5QA 5FTTB 1OGQA 4GLPA 3W3GA 4M7EC 2JQDA 3ZYOA 4R09A 3RGXA 3C6PB 3UL7A 4Z94G 3UL8A 3RFEA 2V9TB 2O6SA 3WPCA 2XOTA 2Z82A 1OZNA 1FT8A 1H6UA 3DZEA 2R9UA 1P8TA 3CIGA 4U09A 2OMTA 5B0NA 5AWAA 3OGMB 1DFJI 4ECOA 1O6TA 4MN8B 4GT6A 5AZ5A 4M7EA 3A79B 4ARRA 4Z64C 1DS9A 1P8VA 1M0ZA 4J0MA 4CNCA 4K17A 4OQTA 1O6VA 4LSAA 3KJ4A 4BSSA 4PKIG 3CVRA 4WYKA 1Z7XW 4QBZA 2OMYA 4CC4A 2WQXA 1OOKG 2V9SA 4AY9X 1SQ0B 4NKHA 3PMHG 4FD0A 5AWCA 3W3LA 4XSQA 1KOOA 2V70A 3ULVA 4V2EA 3JB9j 3OGLB 3GOZA 1D0BA 3E3ZA 3WPDA 2JE1A 4LXSA 3G39A 3M18A 3OGKB 4R08A 2ASTB 3G04C 3WPGA 4U06A 3M19A 4Q62A 5IJBA 1DCEA 4FHOA 4R5DA 5HZLB 2WQUA 2XWTC 3SB4A 3WPIA 3O53A 1WWLA 4KNGA 3UL9A 4H09A 2RA8A 1XCDA 4L3AA 3REZA 1A4YA 4U7LA 1H6TA 4FS7A 4P91A 4Z61C 2CA6A 4WP6A 4Q3GA 1KOHA 1K5DC 2Z7XB 4EZGA 4R6AA 2O6QA 1P9AG 4NKGA 3G3BA 4IM6A 3RGZA 4LSXC 2JE0A 4R6FA 4AW4A 2P1QB 4R5CA 4V2CA 1ZIWA 4L3FA 3RW7A 2ID5A 4Q3IA 4ARNA 3ZYJA 2Z66A 3WPFA 1YRGA 4R58A 1IO0A 2WQVA 3W3KA 2P1PB 2WFHA 5GQRK 2UZXA 4G8AA 4J4LA 4R0AA 4CILA 4LI1A 3WPHA 2Z64A 4BSRA 3C6NB 4PQ8A 4ECNA 4I6JB
chains in the Genus database with same CATH superfamily
4BV4R 3W3MA 2BEXA 2OMXA 4P8SA 4BSUA 1M9SA 4RCWA 4KXFB 2OMUA 4TZHA 1U0ND 3ZYIA 3WPBA 3WN4A 3W3NA 4LXRA 4U08A 4PEQB 2A0ZA 1LTXA 4FCGA 3O6NA 2RR6A 3RFJA 3ULAA 1K5GC 3TSRE 4RWTC 5IJDA 1GWBA 4XOSA 5B0TA 1PGVA 3VQ2A 4Y61B 4R6GA 1A9NA 4QC0A 4LSCA 1FO1A 2Q4GW 5IYXC 2IFGA 5CMPA 4QXEA 2P1OB 5GMFA 1XKUA 1W8AA 4KT1A 5LFNA 4PERA 4FMZA 3P72A 1M9LA 2OMZA 4Z8GA 1FS2A 4CNMA 3C6OB 2OMWA 4LI2A 3ZYNA 4Z79A 2O6RA 3OJAA 1M10B 4CC4C 4C2AB 1OTMA 2WQWA 4UFRA 4YEBB 1XEUA 5GMHA 3RIZA 4HQ1A 3RW6A 4C2BB 3BZ5A 3E4GA 3G06A 5B4PA 2BNHA 4LSXA 2P1NB 3ULUA 1O6SA 3E6JA 5CMNA 3FXIA 3UN9A 1G9UA 5IJCA 3VQ1A 3E2JA 2ASSB 4PSJA 2UZYA 1XECA 2Z63A 4MQWX 4CP6A 5A5CA 2Z7XA 1JL5A 5HDHA 3W3JA 3G3AA 3OJAB 2Z81A 5D3IA 5AWBA 1QYYA 2Z65A 3RJ0A 2FT3A 1OTNA 5GS2B 3WPEA 4FDWA 5GMGA 4R6JA 4R07A 1XWDC 2OMVA 1OTOA 3CIYA 2P1MB 2ELLA 3RFSA 5AWDA 4XGOA 1FQVA 4RCAB 4V2DA 5GS0A 2Z62A 4B8CD 2Y5QA 5FTTB 1OGQA 4GLPA 3W3GA 4M7EC 2JQDA 3ZYOA 4R09A 3RGXA 3C6PB 3UL7A 4Z94G 3UL8A 3RFEA 2V9TB 2O6SA 3WPCA 2XOTA 2Z82A 1OZNA 1FT8A 1H6UA 3DZEA 2R9UA 1P8TA 3CIGA 4U09A 2OMTA 5B0NA 5AWAA 3OGMB 1DFJI 4ECOA 1O6TA 4MN8B 4GT6A 4NZTM 5AZ5A 4M7EA 3A79B 4ARRA 4Z64C 1DS9A 1P8VA 1M0ZA 4J0MA 4CNCA 4K17A 4OQTA 1O6VA 4LSAA 3KJ4A 4BSSA 4PKIG 3CVRA 4WYKA 1Z7XW 4QBZA 2OMYA 4CC4A 2WQXA 1OOKG 2V9SA 4AY9X 1SQ0B 4NKHA 3PMHG 4FD0A 5AWCA 3W3LA 4XSQA 1KOOA 2V70A 3ULVA 4V2EA 3JB9j 3OGLB 3GOZA 1D0BA 3E3ZA 3WPDA 2JE1A 4LXSA 3G39A 3M18A 3OGKB 4R08A 2ASTB 3G04C 3WPGA 4U06A 3M19A 4Q62A 5IJBA 1DCEA 4FHOA 4R5DA 4NZRM 5HZLB 2WQUA 2XWTC 3SB4A 3WPIA 3O53A 1WWLA 4KNGA 3UL9A 4H09A 2RA8A 1XCDA 4L3AA 3REZA 1A4YA 4U7LA 1H6TA 4FS7A 4P91A 4Z61C 2CA6A 4WP6A 4Q3GA 1KOHA 1K5DC 2Z7XB 4EZGA 4R6AA 2O6QA 1P9AG 4NKGA 3G3BA 4IM6A 3RGZA 4LSXC 2JE0A 4R6FA 4AW4A 2P1QB 4R5CA 4V2CA 1ZIWA 4L3FA 3RW7A 2ID5A 4Q3IA 4ARNA 3ZYJA 2Z66A 3WPFA 1YRGA 4R58A 1IO0A 2WQVA 3W3KA 2P1PB 2WFHA 5GQRK 2UZXA 4G8AA 4J4LA 4R0AA 4CILA 4LI1A 3WPHA 2Z64A 4BSRA 3C6NB 4PQ8A 4ECNA 4I6JB
chains in the Genus database with same CATH topology
4BV4R 3W3MA 2BEXA 2OMXA 4P8SA 4BSUA 1M9SA 4RCWA 4KXFB 2OMUA 4TZHA 1U0ND 3ZYIA 3WPBA 3WN4A 3W3NA 4LXRA 4U08A 4PEQB 2A0ZA 1LTXA 4FCGA 3O6NA 2RR6A 3RFJA 3ULAA 1K5GC 3TSRE 4RWTC 5IJDA 1GWBA 4XOSA 5B0TA 1PGVA 3VQ2A 4Y61B 4R6GA 1A9NA 4QC0A 4LSCA 1FO1A 2Q4GW 5IYXC 2IFGA 5CMPA 4QXEA 2P1OB 5GMFA 1XKUA 1W8AA 4KT1A 5LFNA 4PERA 4FMZA 3P72A 1M9LA 2OMZA 4Z8GA 1FS2A 4CNMA 3C6OB 2OMWA 4LI2A 3ZYNA 4Z79A 2O6RA 3OJAA 1M10B 4CC4C 4C2AB 1OTMA 2WQWA 4UFRA 4YEBB 1XEUA 5GMHA 3RIZA 4HQ1A 3RW6A 4C2BB 3BZ5A 3E4GA 3G06A 5B4PA 2BNHA 4LSXA 2P1NB 3ULUA 1O6SA 3E6JA 5CMNA 3FXIA 3UN9A 1G9UA 5IJCA 3VQ1A 3E2JA 2ASSB 4PSJA 2UZYA 1XECA 2Z63A 4MQWX 4CP6A 5A5CA 2Z7XA 1JL5A 5HDHA 3W3JA 3G3AA 3OJAB 2Z81A 5D3IA 5AWBA 1QYYA 2Z65A 3RJ0A 2FT3A 1OTNA 5GS2B 3WPEA 4FDWA 5GMGA 4R6JA 4R07A 1XWDC 2OMVA 1OTOA 3CIYA 2P1MB 2ELLA 3RFSA 5AWDA 4XGOA 1FQVA 4RCAB 4V2DA 5GS0A 2Z62A 4B8CD 2Y5QA 5FTTB 1OGQA 4GLPA 3W3GA 4M7EC 2JQDA 3ZYOA 4R09A 3RGXA 3C6PB 3UL7A 4Z94G 3UL8A 3RFEA 2V9TB 2O6SA 3WPCA 2XOTA 2Z82A 1OZNA 1FT8A 1H6UA 3DZEA 2R9UA 1P8TA 3CIGA 4U09A 2OMTA 5B0NA 5AWAA 3OGMB 1DFJI 4ECOA 1O6TA 4MN8B 4GT6A 5AZ5A 4M7EA 3A79B 4ARRA 4Z64C 1DS9A 1P8VA 1M0ZA 4J0MA 4CNCA 4K17A 4OQTA 1O6VA 4LSAA 3KJ4A 4BSSA 4PKIG 3CVRA 4WYKA 1Z7XW 4QBZA 2OMYA 4CC4A 2WQXA 1OOKG 2V9SA 4AY9X 1SQ0B 4NKHA 3PMHG 4FD0A 5AWCA 3W3LA 4XSQA 1KOOA 2V70A 3ULVA 4V2EA 3JB9j 3OGLB 3GOZA 1D0BA 3E3ZA 3WPDA 2JE1A 4LXSA 3G39A 3M18A 3OGKB 4R08A 2ASTB 3G04C 3WPGA 4U06A 3M19A 4Q62A 5IJBA 1DCEA 4FHOA 4R5DA 5HZLB 2WQUA 2XWTC 3SB4A 3WPIA 3O53A 1WWLA 4KNGA 3UL9A 4H09A 2RA8A 1XCDA 4L3AA 3REZA 1A4YA 4U7LA 1H6TA 4FS7A 4P91A 4Z61C 2CA6A 4WP6A 4Q3GA 1KOHA 1K5DC 2Z7XB 4EZGA 4R6AA 2O6QA 1P9AG 4NKGA 3G3BA 4IM6A 3RGZA 4LSXC 2JE0A 4R6FA 4AW4A 2P1QB 4R5CA 4V2CA 1ZIWA 4L3FA 3RW7A 2ID5A 4Q3IA 4ARNA 3ZYJA 2Z66A 3WPFA 1YRGA 4R58A 1IO0A 2WQVA 3W3KA 2P1PB 2WFHA 5GQRK 2UZXA 4G8AA 4J4LA 4R0AA 4CILA 4LI1A 3WPHA 2Z64A 4BSRA 3C6NB 4PQ8A 4ECNA 4I6JB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BV4 R;  3W3M A;  2BEX A;  2OMX A;  4P8S A;  4BSU A;  1M9S A;  4RCW A;  4KXF B;  2OMU A;  4TZH A;  1U0N D;  3ZYI A;  3WPB A;  3WN4 A;  3W3N A;  4LXR A;  4U08 A;  4PEQ B;  2A0Z A;  1LTX A;  4FCG A;  3O6N A;  2RR6 A;  3RFJ A;  3ULA A;  1K5G C;  3TSR E;  4RWT C;  5IJD A;  1GWB A;  4XOS A;  5B0T A;  1PGV A;  3VQ2 A;  4Y61 B;  4R6G A;  1A9N A;  4QC0 A;  4LSC A;  1FO1 A;  2Q4G W;  5IYX C;  2IFG A;  5CMP A;  4QXE A;  2P1O B;  5GMF A;  1XKU A;  1W8A A;  4KT1 A;  5LFN A;  4PER A;  4FMZ A;  3P72 A;  1M9L A;  2OMZ A;  4Z8G A;  1FS2 A;  4CNM A;  3C6O B;  2OMW A;  4LI2 A;  3ZYN A;  4Z79 A;  2O6R A;  3OJA A;  1M10 B;  4CC4 C;  4C2A B;  1OTM A;  2WQW A;  4UFR A;  4YEB B;  1XEU A;  5GMH A;  3RIZ A;  4HQ1 A;  3RW6 A;  4C2B B;  3BZ5 A;  3E4G A;  3G06 A;  5B4P A;  2BNH A;  4LSX A;  2P1N B;  3ULU A;  1O6S A;  3E6J A;  5CMN A;  3FXI A;  3UN9 A;  1G9U A;  5IJC A;  3VQ1 A;  3E2J A;  2ASS B;  4PSJ A;  2UZY A;  1XEC A;  2Z63 A;  4MQW X;  4CP6 A;  5A5C A;  2Z7X A;  1JL5 A;  5HDH A;  3W3J A;  3G3A A;  3OJA B;  2Z81 A;  5D3I A;  5AWB A;  1QYY A;  2Z65 A;  3RJ0 A;  2FT3 A;  1OTN A;  5GS2 B;  3WPE A;  4FDW A;  5GMG A;  4R6J A;  4R07 A;  1XWD C;  2OMV A;  1OTO A;  3CIY A;  2P1M B;  2ELL A;  3RFS A;  5AWD A;  4XGO A;  1FQV A;  4RCA B;  4V2D A;  5GS0 A;  2Z62 A;  4B8C D;  2Y5Q A;  5FTT B;  1OGQ A;  4GLP A;  3W3G A;  4M7E C;  2JQD A;  3ZYO A;  4R09 A;  3RGX A;  3C6P B;  3UL7 A;  4Z94 G;  3UL8 A;  3RFE A;  2V9T B;  2O6S A;  3WPC A;  2XOT A;  2Z82 A;  1OZN A;  1FT8 A;  1H6U A;  3DZE A;  2R9U A;  1P8T A;  3CIG A;  4U09 A;  2OMT A;  5B0N A;  5AWA A;  3OGM B;  1DFJ I;  4ECO A;  1O6T A;  4MN8 B;  4GT6 A;  5AZ5 A;  4M7E A;  3A79 B;  4ARR A;  4Z64 C;  1DS9 A;  1P8V A;  1M0Z A;  4J0M A;  4CNC A;  4K17 A;  4OQT A;  1O6V A;  4LSA A;  3KJ4 A;  4BSS A;  4PKI G;  3CVR A;  4WYK A;  1Z7X W;  4QBZ A;  2OMY A;  4CC4 A;  2WQX A;  1OOK G;  2V9S A;  4AY9 X;  1SQ0 B;  4NKH A;  3PMH G;  4FD0 A;  5AWC A;  3W3L A;  4XSQ A;  1KOO A;  2V70 A;  3ULV A;  4V2E A;  3JB9 j;  3OGL B;  3GOZ A;  1D0B A;  3E3Z A;  3WPD A;  2JE1 A;  4LXS A;  3G39 A;  3M18 A;  3OGK B;  4R08 A;  2AST B;  3G04 C;  3WPG A;  4U06 A;  3M19 A;  4Q62 A;  5IJB A;  1DCE A;  4FHO A;  4R5D A;  5HZL B;  2WQU A;  2XWT C;  3SB4 A;  3WPI A;  3O53 A;  1WWL A;  4KNG A;  3UL9 A;  4H09 A;  2RA8 A;  1XCD A;  4L3A A;  3REZ A;  1A4Y A;  4U7L A;  1H6T A;  4FS7 A;  4P91 A;  4Z61 C;  2CA6 A;  4WP6 A;  4Q3G A;  1KOH A;  1K5D C;  2Z7X B;  4EZG A;  4R6A A;  2O6Q A;  1P9A G;  4NKG A;  3G3B A;  4IM6 A;  3RGZ A;  4LSX C;  2JE0 A;  4R6F A;  4AW4 A;  2P1Q B;  4R5C A;  4V2C A;  1ZIW A;  4L3F A;  3RW7 A;  2ID5 A;  4Q3I A;  4ARN A;  3ZYJ A;  2Z66 A;  3WPF A;  1YRG A;  4R58 A;  1IO0 A;  2WQV A;  3W3K A;  2P1P B;  2WFH A;  5GQR K;  2UZX A;  4G8A A;  4J4L A;  4R0A A;  4CIL A;  4LI1 A;  3WPH A;  2Z64 A;  4BSR A;  3C6N B;  4PQ8 A;  4ECN A;  4I6J B; 
#chains in the Genus database with same CATH topology
 4BV4 R;  3W3M A;  2BEX A;  2OMX A;  4P8S A;  4BSU A;  1M9S A;  4RCW A;  4KXF B;  2OMU A;  4TZH A;  1U0N D;  3ZYI A;  3WPB A;  3WN4 A;  3W3N A;  4LXR A;  4U08 A;  4PEQ B;  2A0Z A;  1LTX A;  4FCG A;  3O6N A;  2RR6 A;  3RFJ A;  3ULA A;  1K5G C;  3TSR E;  4RWT C;  5IJD A;  1GWB A;  4XOS A;  5B0T A;  1PGV A;  3VQ2 A;  4Y61 B;  4R6G A;  1A9N A;  4QC0 A;  4LSC A;  1FO1 A;  2Q4G W;  5IYX C;  2IFG A;  5CMP A;  4QXE A;  2P1O B;  5GMF A;  1XKU A;  1W8A A;  4KT1 A;  5LFN A;  4PER A;  4FMZ A;  3P72 A;  1M9L A;  2OMZ A;  4Z8G A;  1FS2 A;  4CNM A;  3C6O B;  2OMW A;  4LI2 A;  3ZYN A;  4Z79 A;  2O6R A;  3OJA A;  1M10 B;  4CC4 C;  4C2A B;  1OTM A;  2WQW A;  4UFR A;  4YEB B;  1XEU A;  5GMH A;  3RIZ A;  4HQ1 A;  3RW6 A;  4C2B B;  3BZ5 A;  3E4G A;  3G06 A;  5B4P A;  2BNH A;  4LSX A;  2P1N B;  3ULU A;  1O6S A;  3E6J A;  5CMN A;  3FXI A;  3UN9 A;  1G9U A;  5IJC A;  3VQ1 A;  3E2J A;  2ASS B;  4PSJ A;  2UZY A;  1XEC A;  2Z63 A;  4MQW X;  4CP6 A;  5A5C A;  2Z7X A;  1JL5 A;  5HDH A;  3W3J A;  3G3A A;  3OJA B;  2Z81 A;  5D3I A;  5AWB A;  1QYY A;  2Z65 A;  3RJ0 A;  2FT3 A;  1OTN A;  5GS2 B;  3WPE A;  4FDW A;  5GMG A;  4R6J A;  4R07 A;  1XWD C;  2OMV A;  1OTO A;  3CIY A;  2P1M B;  2ELL A;  3RFS A;  5AWD A;  4XGO A;  1FQV A;  4RCA B;  4V2D A;  5GS0 A;  2Z62 A;  4B8C D;  2Y5Q A;  5FTT B;  1OGQ A;  4GLP A;  3W3G A;  4M7E C;  2JQD A;  3ZYO A;  4R09 A;  3RGX A;  3C6P B;  3UL7 A;  4Z94 G;  3UL8 A;  3RFE A;  2V9T B;  2O6S A;  3WPC A;  2XOT A;  2Z82 A;  1OZN A;  1FT8 A;  1H6U A;  3DZE A;  2R9U A;  1P8T A;  3CIG A;  4U09 A;  2OMT A;  5B0N A;  5AWA A;  3OGM B;  1DFJ I;  4ECO A;  1O6T A;  4MN8 B;  4GT6 A;  4NZT M;  5AZ5 A;  4M7E A;  3A79 B;  4ARR A;  4Z64 C;  1DS9 A;  1P8V A;  1M0Z A;  4J0M A;  4CNC A;  4K17 A;  4OQT A;  1O6V A;  4LSA A;  3KJ4 A;  4BSS A;  4PKI G;  3CVR A;  4WYK A;  1Z7X W;  4QBZ A;  2OMY A;  4CC4 A;  2WQX A;  1OOK G;  2V9S A;  4AY9 X;  1SQ0 B;  4NKH A;  3PMH G;  4FD0 A;  5AWC A;  3W3L A;  4XSQ A;  1KOO A;  2V70 A;  3ULV A;  4V2E A;  3JB9 j;  3OGL B;  3GOZ A;  1D0B A;  3E3Z A;  3WPD A;  2JE1 A;  4LXS A;  3G39 A;  3M18 A;  3OGK B;  4R08 A;  2AST B;  3G04 C;  3WPG A;  4U06 A;  3M19 A;  4Q62 A;  5IJB A;  1DCE A;  4FHO A;  4R5D A;  4NZR M;  5HZL B;  2WQU A;  2XWT C;  3SB4 A;  3WPI A;  3O53 A;  1WWL A;  4KNG A;  3UL9 A;  4H09 A;  2RA8 A;  1XCD A;  4L3A A;  3REZ A;  1A4Y A;  4U7L A;  1H6T A;  4FS7 A;  4P91 A;  4Z61 C;  2CA6 A;  4WP6 A;  4Q3G A;  1KOH A;  1K5D C;  2Z7X B;  4EZG A;  4R6A A;  2O6Q A;  1P9A G;  4NKG A;  3G3B A;  4IM6 A;  3RGZ A;  4LSX C;  2JE0 A;  4R6F A;  4AW4 A;  2P1Q B;  4R5C A;  4V2C A;  1ZIW A;  4L3F A;  3RW7 A;  2ID5 A;  4Q3I A;  4ARN A;  3ZYJ A;  2Z66 A;  3WPF A;  1YRG A;  4R58 A;  1IO0 A;  2WQV A;  3W3K A;  2P1P B;  2WFH A;  5GQR K;  2UZX A;  4G8A A;  4J4L A;  4R0A A;  4CIL A;  4LI1 A;  3WPH A;  2Z64 A;  4BSR A;  3C6N B;  4PQ8 A;  4ECN A;  4I6J B; 
#chains in the Genus database with same CATH homology
 4BV4 R;  3W3M A;  2BEX A;  2OMX A;  4P8S A;  4BSU A;  1M9S A;  4RCW A;  4KXF B;  2OMU A;  4TZH A;  1U0N D;  3ZYI A;  3WPB A;  3WN4 A;  3W3N A;  4LXR A;  4U08 A;  4PEQ B;  2A0Z A;  1LTX A;  4FCG A;  3O6N A;  2RR6 A;  3RFJ A;  3ULA A;  1K5G C;  3TSR E;  4RWT C;  5IJD A;  1GWB A;  4XOS A;  5B0T A;  1PGV A;  3VQ2 A;  4Y61 B;  4R6G A;  1A9N A;  4QC0 A;  4LSC A;  1FO1 A;  2Q4G W;  5IYX C;  2IFG A;  5CMP A;  4QXE A;  2P1O B;  5GMF A;  1XKU A;  1W8A A;  4KT1 A;  5LFN A;  4PER A;  4FMZ A;  3P72 A;  1M9L A;  2OMZ A;  4Z8G A;  1FS2 A;  4CNM A;  3C6O B;  2OMW A;  4LI2 A;  3ZYN A;  4Z79 A;  2O6R A;  3OJA A;  1M10 B;  4CC4 C;  4C2A B;  1OTM A;  2WQW A;  4UFR A;  4YEB B;  1XEU A;  5GMH A;  3RIZ A;  4HQ1 A;  3RW6 A;  4C2B B;  3BZ5 A;  3E4G A;  3G06 A;  5B4P A;  2BNH A;  4LSX A;  2P1N B;  3ULU A;  1O6S A;  3E6J A;  5CMN A;  3FXI A;  3UN9 A;  1G9U A;  5IJC A;  3VQ1 A;  3E2J A;  2ASS B;  4PSJ A;  2UZY A;  1XEC A;  2Z63 A;  4MQW X;  4CP6 A;  5A5C A;  2Z7X A;  1JL5 A;  5HDH A;  3W3J A;  3G3A A;  3OJA B;  2Z81 A;  5D3I A;  5AWB A;  1QYY A;  2Z65 A;  3RJ0 A;  2FT3 A;  1OTN A;  5GS2 B;  3WPE A;  4FDW A;  5GMG A;  4R6J A;  4R07 A;  1XWD C;  2OMV A;  1OTO A;  3CIY A;  2P1M B;  2ELL A;  3RFS A;  5AWD A;  4XGO A;  1FQV A;  4RCA B;  4V2D A;  5GS0 A;  2Z62 A;  4B8C D;  2Y5Q A;  5FTT B;  1OGQ A;  4GLP A;  3W3G A;  4M7E C;  2JQD A;  3ZYO A;  4R09 A;  3RGX A;  3C6P B;  3UL7 A;  4Z94 G;  3UL8 A;  3RFE A;  2V9T B;  2O6S A;  3WPC A;  2XOT A;  2Z82 A;  1OZN A;  1FT8 A;  1H6U A;  3DZE A;  2R9U A;  1P8T A;  3CIG A;  4U09 A;  2OMT A;  5B0N A;  5AWA A;  3OGM B;  1DFJ I;  4ECO A;  1O6T A;  4MN8 B;  4GT6 A;  5AZ5 A;  4M7E A;  3A79 B;  4ARR A;  4Z64 C;  1DS9 A;  1P8V A;  1M0Z A;  4J0M A;  4CNC A;  4K17 A;  4OQT A;  1O6V A;  4LSA A;  3KJ4 A;  4BSS A;  4PKI G;  3CVR A;  4WYK A;  1Z7X W;  4QBZ A;  2OMY A;  4CC4 A;  2WQX A;  1OOK G;  2V9S A;  4AY9 X;  1SQ0 B;  4NKH A;  3PMH G;  4FD0 A;  5AWC A;  3W3L A;  4XSQ A;  1KOO A;  2V70 A;  3ULV A;  4V2E A;  3JB9 j;  3OGL B;  3GOZ A;  1D0B A;  3E3Z A;  3WPD A;  2JE1 A;  4LXS A;  3G39 A;  3M18 A;  3OGK B;  4R08 A;  2AST B;  3G04 C;  3WPG A;  4U06 A;  3M19 A;  4Q62 A;  5IJB A;  1DCE A;  4FHO A;  4R5D A;  5HZL B;  2WQU A;  2XWT C;  3SB4 A;  3WPI A;  3O53 A;  1WWL A;  4KNG A;  3UL9 A;  4H09 A;  2RA8 A;  1XCD A;  4L3A A;  3REZ A;  1A4Y A;  4U7L A;  1H6T A;  4FS7 A;  4P91 A;  4Z61 C;  2CA6 A;  4WP6 A;  4Q3G A;  1KOH A;  1K5D C;  2Z7X B;  4EZG A;  4R6A A;  2O6Q A;  1P9A G;  4NKG A;  3G3B A;  4IM6 A;  3RGZ A;  4LSX C;  2JE0 A;  4R6F A;  4AW4 A;  2P1Q B;  4R5C A;  4V2C A;  1ZIW A;  4L3F A;  3RW7 A;  2ID5 A;  4Q3I A;  4ARN A;  3ZYJ A;  2Z66 A;  3WPF A;  1YRG A;  4R58 A;  1IO0 A;  2WQV A;  3W3K A;  2P1P B;  2WFH A;  5GQR K;  2UZX A;  4G8A A;  4J4L A;  4R0A A;  4CIL A;  4LI1 A;  3WPH A;  2Z64 A;  4BSR A;  3C6N B;  4PQ8 A;  4ECN A;  4I6J B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...