5GMGA

Crystal structure of monkey tlr7 in complex with loxoribine and polyu
Total Genus 252
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
252
sequence length
806
structure length
762
Chain Sequence
RWFPKTLPCDVTLDHVIVDCTDKHLTEIPGGIPTNTTNLTLTINHIPDISPASFHRLVHLVEIDFRCNCVPIRLGSKSNMCPRRLQIKPRSFSGLTYLKSLYLDGNQLLEIPQGLPPSLQLLSLEANNIFSIRKEQLTELANIEILYLGQNCYYRNPCYVSYSIEKDAFLNLTKLKVLSLKDNNVTTVPTVLPSTLTELYLYNNMIAEIQEDDFNNLNQLQILDLSGNCPRCYNAPFPCTPCKNNSPLQIPVNAFDALTELKVLRLHSNSLQHVPPRWFKNINNLQELDLSQNFLAKEIGDAKFLHFLPNLIQLDLSFNFELQVYRASMNLSQAFSSLKSLKILRIRGYVFKELKSFQLSPLHNLQNLEVLDLGTNFIKIANLSMFKQFKRLKVIDLSVNKISPLYYFRYDKYARSCRSCYKYGQTLDLSKNSIFFIKSSDFQHLSFLKCLNLSGNLISQTLNGSEFQPLAELRYLDFSNNRLDLLHSTAFEELRKLEVLDISSNSHYFQSEGITHMLNFTKNLKVLQKLMMNDNDISSSTSRTMESESLRTLEFRGNHLDVLWRDGDNRYLQLFKNLLKLEELDISKNSLSFLPSGVFDGMPPNLKNLSLAKNGLKSFIWEKLRYLKNLETLDLSHNQLTTVPERLSNCSRSLKNLILKNNQIRSLTKYFLQDAFQLRYLDLSSNKIQMIQKTSFPENVLNNLKMLLLHHNRFLCTCDAVWFVWWVQHTEVTIPYLATDVTCVGPGAHKGQSVISLDLYTC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Toll-like receptor 7
publication title Structural Analysis Reveals that Toll-like Receptor 7 Is a Dual Receptor for Guanosine and Single-Stranded RNA
pubmed doi rcsb
source organism Macaca mulatta
molecule tags Immune system/rna
total genus 252
structure length 762
sequence length 806
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13306 LRR_5 BspA type Leucine rich repeat region (6 copies)
A PF13855 LRR_8 Leucine rich repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 5gmgA00
3E2JA 3P72A 1FQVA 1OTMA 3ZYNA 3RGXA 4CNMA 1M9LA 3WN4A 1XWDC 5AWCA 3G39A 3PMHG 4R08A 4V2EA 3VQ2A 4BV4R 1M9SA 2BNHA 4ARNA 2O6RA 4KXFB 4XOSA 2V70A 3ULUA 2V9SA 5GS0A 3OGKB 4R5DA 3RIZA 2OMTA 1M0ZA 4R07A 4YEBB 1Z7XW 4LI1A 1PGVA 4BSRA 4Q62A 5IJDA 2UZXA 2Z65A 1ZIWA 5AWBA 4M7EA 1OTOA 3W3JA 4HQ1A 4Y61B 4IM6A 4QXEA 4PEQB 4R6FA 4NKGA 4FMZA 3UL9A 4FHOA 4P8SA 2OMYA 2Z66A 3JB9j 3OJAB 1DFJI 5GMHA 1FO1A 4AY9X 5A5CA 1OGQA 3O53A 1W8AA 4R0AA 4Z61C 3VQ1A 2Z62A 4ECNA 2BEXA 4U06A 4CC4A 2Z63A 1O6SA 1XKUA 4GLPA 4RCWA 4MN8B 5LFNA 3OJAA 2R9UA 3RW7A 1G9UA 2P1QB 5FTTB 2Z7XB 2WQWA 3RW6A 1XEUA 5B0TA 1P9AG 4FCGA 3ZYIA 2WFHA 1XECA 1P8VA 5GS2B 5IJBA 3WPEA 3C6NB 1O6VA 5IYXC 4CP6A 3E6JA 4U08A 4Z64C 1LTXA 2RA8A 4RCAB 1SQ0B 3E4GA 3RFJA 3ULVA 4U7LA 4K17A 1XCDA 4KNGA 2Z7XA 3G3BA 2P1OB 2JE1A 5HDHA 3WPGA 4B8CD 3ZYOA 3RJ0A 2ELLA 3CIGA 3WPBA 4G8AA 2JE0A 1FT8A 4UFRA 4WYKA 4ECOA 4CNCA 3O6NA 3TSRE 3ULAA 3WPHA 3W3KA 4L3AA 4Z94G 1YRGA 5GMGA 1A9NA 1P8TA 4V2CA 2Q4GW 4Q3IA 5AWAA 3ZYJA 1D0BA 3WPCA 4R09A 3W3LA 4V2DA 5CMPA 3WPFA 4RWTC 2O6QA 3RFEA 4LXSA 4LSXA 1OZNA 2IFGA 2P1PB 3C6OB 4M7EC 5B0NA 1H6UA 5B4PA 4Z8GA 3E3ZA 1A4YA 1K5GC 4L3FA 2Y5QA 2Z64A 2WQXA 4C2BB 4EZGA 5IJCA 2P1MB 4TZHA 5GQRK 4FS7A 4KT1A 1JL5A 2O6SA 3OGLB 4MQWX 4R5CA 4Z79A 1KOOA 2OMUA 2OMWA 5D3IA 1M10B 2ID5A 3RFSA 2Z82A 2XWTC 4PKIG 4LXRA 2FT3A 1DS9A 1OOKG 4PQ8A 3CIYA 3W3NA 4PSJA 3M19A 4CC4C 3C6PB 2UZYA 3UL8A 4PERA 1IO0A 1WWLA 2CA6A 3BZ5A 3M18A 2P1NB 4LI2A 2OMZA 3FXIA 3A79B 1H6TA 4LSAA 4J4LA 3SB4A 1U0ND 5AWDA 3G06A 2RR6A 4XSQA 4H09A 1DCEA 4NKHA 1O6TA 4LSCA 4AW4A 3UN9A 4I6JB 3RGZA 3DZEA 4ARRA 2WQUA 1KOHA 3KJ4A 4OQTA 3CVRA 5CMNA 3UL7A 2A0ZA 4U09A 4WP6A 3GOZA 4C2AB 4R6JA 4FDWA 4P91A 4XGOA 1K5DC 4CILA 1FS2A 2ASTB 2JQDA 4QBZA 3W3MA 5GMFA 3OGMB 3G04C 3WPDA 2ASSB 4Q3GA 3G3AA 2WQVA 4R58A 4R6GA 2OMVA 4BSSA 2Z81A 4GT6A 3W3GA 3WPIA 4QC0A 2OMXA 2V9TB 5AZ5A 1QYYA 4BSUA 4J0MA 2XOTA 4R6AA 1OTNA 4LSXC 1GWBA 5HZLB 3REZA 4FD0A
chains in the Genus database with same CATH superfamily
3E2JA 3P72A 1FQVA 1OTMA 3ZYNA 3RGXA 4CNMA 1M9LA 4NZRM 3WN4A 1XWDC 5AWCA 3G39A 3PMHG 4R08A 4V2EA 3VQ2A 4BV4R 1M9SA 2BNHA 4ARNA 2O6RA 4KXFB 4XOSA 2V70A 3ULUA 2V9SA 5GS0A 3OGKB 4R5DA 3RIZA 2OMTA 1M0ZA 4R07A 4YEBB 1Z7XW 4LI1A 1PGVA 4BSRA 4Q62A 5IJDA 2UZXA 2Z65A 1ZIWA 5AWBA 4M7EA 1OTOA 3W3JA 4HQ1A 4Y61B 4IM6A 4QXEA 4PEQB 4R6FA 4NKGA 4FMZA 3UL9A 4FHOA 4P8SA 2OMYA 2Z66A 3JB9j 3OJAB 1DFJI 5GMHA 1FO1A 4AY9X 5A5CA 1OGQA 3O53A 1W8AA 4R0AA 4Z61C 3VQ1A 2Z62A 4ECNA 2BEXA 4U06A 4CC4A 2Z63A 1O6SA 1XKUA 4GLPA 4RCWA 4MN8B 5LFNA 3OJAA 2R9UA 3RW7A 1G9UA 2P1QB 5FTTB 2Z7XB 2WQWA 3RW6A 1XEUA 5B0TA 1P9AG 4FCGA 3ZYIA 2WFHA 1XECA 1P8VA 5GS2B 5IJBA 3WPEA 3C6NB 1O6VA 5IYXC 4CP6A 3E6JA 4U08A 4Z64C 1LTXA 2RA8A 4RCAB 1SQ0B 3E4GA 3RFJA 3ULVA 4U7LA 4K17A 1XCDA 4KNGA 2Z7XA 3G3BA 2P1OB 2JE1A 5HDHA 3WPGA 4B8CD 3ZYOA 3RJ0A 2ELLA 3CIGA 3WPBA 4G8AA 2JE0A 1FT8A 4UFRA 4WYKA 4ECOA 4CNCA 3O6NA 3TSRE 3ULAA 3WPHA 3W3KA 4L3AA 4Z94G 1YRGA 5GMGA 1A9NA 1P8TA 4V2CA 2Q4GW 4Q3IA 5AWAA 3ZYJA 1D0BA 3WPCA 4R09A 3W3LA 4V2DA 5CMPA 3WPFA 4RWTC 2O6QA 3RFEA 4LXSA 4LSXA 1OZNA 2IFGA 2P1PB 3C6OB 4M7EC 5B0NA 1H6UA 5B4PA 4Z8GA 3E3ZA 1A4YA 1K5GC 4L3FA 2Y5QA 2Z64A 2WQXA 4C2BB 4EZGA 5IJCA 2P1MB 4TZHA 5GQRK 4FS7A 4KT1A 1JL5A 2O6SA 3OGLB 4MQWX 4R5CA 4Z79A 1KOOA 2OMUA 2OMWA 5D3IA 1M10B 2ID5A 3RFSA 2Z82A 2XWTC 4PKIG 4LXRA 2FT3A 1DS9A 1OOKG 4PQ8A 3CIYA 3W3NA 4PSJA 3M19A 4CC4C 3C6PB 2UZYA 3UL8A 4PERA 1IO0A 1WWLA 2CA6A 3BZ5A 3M18A 2P1NB 4LI2A 2OMZA 3FXIA 3A79B 1H6TA 4LSAA 4J4LA 3SB4A 1U0ND 5AWDA 3G06A 2RR6A 4XSQA 4H09A 1DCEA 4NKHA 1O6TA 4LSCA 4AW4A 3UN9A 4I6JB 3RGZA 3DZEA 4ARRA 2WQUA 1KOHA 3KJ4A 4OQTA 3CVRA 5CMNA 3UL7A 2A0ZA 4U09A 4WP6A 3GOZA 4C2AB 4R6JA 4FDWA 4P91A 4XGOA 1K5DC 4CILA 1FS2A 2ASTB 2JQDA 4QBZA 3W3MA 5GMFA 3OGMB 3G04C 3WPDA 2ASSB 4Q3GA 3G3AA 2WQVA 4R58A 4R6GA 2OMVA 4BSSA 2Z81A 4GT6A 3W3GA 3WPIA 4QC0A 2OMXA 2V9TB 5AZ5A 1QYYA 4BSUA 4J0MA 2XOTA 4R6AA 1OTNA 4LSXC 1GWBA 4NZTM 5HZLB 3REZA 4FD0A
chains in the Genus database with same CATH topology
3E2JA 3P72A 1FQVA 1OTMA 3ZYNA 3RGXA 4CNMA 1M9LA 3WN4A 1XWDC 5AWCA 3G39A 3PMHG 4R08A 4V2EA 3VQ2A 4BV4R 1M9SA 2BNHA 4ARNA 2O6RA 4KXFB 4XOSA 2V70A 3ULUA 2V9SA 5GS0A 3OGKB 4R5DA 3RIZA 2OMTA 1M0ZA 4R07A 4YEBB 1Z7XW 4LI1A 1PGVA 4BSRA 4Q62A 5IJDA 2UZXA 2Z65A 1ZIWA 5AWBA 4M7EA 1OTOA 3W3JA 4HQ1A 4Y61B 4IM6A 4QXEA 4PEQB 4R6FA 4NKGA 4FMZA 3UL9A 4FHOA 4P8SA 2OMYA 2Z66A 3JB9j 3OJAB 1DFJI 5GMHA 1FO1A 4AY9X 5A5CA 1OGQA 3O53A 1W8AA 4R0AA 4Z61C 3VQ1A 2Z62A 4ECNA 2BEXA 4U06A 4CC4A 2Z63A 1O6SA 1XKUA 4GLPA 4RCWA 4MN8B 5LFNA 3OJAA 2R9UA 3RW7A 1G9UA 2P1QB 5FTTB 2Z7XB 2WQWA 3RW6A 1XEUA 5B0TA 1P9AG 4FCGA 3ZYIA 2WFHA 1XECA 1P8VA 5GS2B 5IJBA 3WPEA 3C6NB 1O6VA 5IYXC 4CP6A 3E6JA 4U08A 4Z64C 1LTXA 2RA8A 4RCAB 1SQ0B 3E4GA 3RFJA 3ULVA 4U7LA 4K17A 1XCDA 4KNGA 2Z7XA 3G3BA 2P1OB 2JE1A 5HDHA 3WPGA 4B8CD 3ZYOA 3RJ0A 2ELLA 3CIGA 3WPBA 4G8AA 2JE0A 1FT8A 4UFRA 4WYKA 4ECOA 4CNCA 3O6NA 3TSRE 3ULAA 3WPHA 3W3KA 4L3AA 4Z94G 1YRGA 5GMGA 1A9NA 1P8TA 4V2CA 2Q4GW 4Q3IA 5AWAA 3ZYJA 1D0BA 3WPCA 4R09A 3W3LA 4V2DA 5CMPA 3WPFA 4RWTC 2O6QA 3RFEA 4LXSA 4LSXA 1OZNA 2IFGA 2P1PB 3C6OB 4M7EC 5B0NA 1H6UA 5B4PA 4Z8GA 3E3ZA 1A4YA 1K5GC 4L3FA 2Y5QA 2Z64A 2WQXA 4C2BB 4EZGA 5IJCA 2P1MB 4TZHA 5GQRK 4FS7A 4KT1A 1JL5A 2O6SA 3OGLB 4MQWX 4R5CA 4Z79A 1KOOA 2OMUA 2OMWA 5D3IA 1M10B 2ID5A 3RFSA 2Z82A 2XWTC 4PKIG 4LXRA 2FT3A 1DS9A 1OOKG 4PQ8A 3CIYA 3W3NA 4PSJA 3M19A 4CC4C 3C6PB 2UZYA 3UL8A 4PERA 1IO0A 1WWLA 2CA6A 3BZ5A 3M18A 2P1NB 4LI2A 2OMZA 3FXIA 3A79B 1H6TA 4LSAA 4J4LA 3SB4A 1U0ND 5AWDA 3G06A 2RR6A 4XSQA 4H09A 1DCEA 4NKHA 1O6TA 4LSCA 4AW4A 3UN9A 4I6JB 3RGZA 3DZEA 4ARRA 2WQUA 1KOHA 3KJ4A 4OQTA 3CVRA 5CMNA 3UL7A 2A0ZA 4U09A 4WP6A 3GOZA 4C2AB 4R6JA 4FDWA 4P91A 4XGOA 1K5DC 4CILA 1FS2A 2ASTB 2JQDA 4QBZA 3W3MA 5GMFA 3OGMB 3G04C 3WPDA 2ASSB 4Q3GA 3G3AA 2WQVA 4R58A 4R6GA 2OMVA 4BSSA 2Z81A 4GT6A 3W3GA 3WPIA 4QC0A 2OMXA 2V9TB 5AZ5A 1QYYA 4BSUA 4J0MA 2XOTA 4R6AA 1OTNA 4LSXC 1GWBA 5HZLB 3REZA 4FD0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3E2J A;  3P72 A;  1FQV A;  1OTM A;  3ZYN A;  3RGX A;  4CNM A;  1M9L A;  3WN4 A;  1XWD C;  5AWC A;  3G39 A;  3PMH G;  4R08 A;  4V2E A;  3VQ2 A;  4BV4 R;  1M9S A;  2BNH A;  4ARN A;  2O6R A;  4KXF B;  4XOS A;  2V70 A;  3ULU A;  2V9S A;  5GS0 A;  3OGK B;  4R5D A;  3RIZ A;  2OMT A;  1M0Z A;  4R07 A;  4YEB B;  1Z7X W;  4LI1 A;  1PGV A;  4BSR A;  4Q62 A;  5IJD A;  2UZX A;  2Z65 A;  1ZIW A;  5AWB A;  4M7E A;  1OTO A;  3W3J A;  4HQ1 A;  4Y61 B;  4IM6 A;  4QXE A;  4PEQ B;  4R6F A;  4NKG A;  4FMZ A;  3UL9 A;  4FHO A;  4P8S A;  2OMY A;  2Z66 A;  3JB9 j;  3OJA B;  1DFJ I;  5GMH A;  1FO1 A;  4AY9 X;  5A5C A;  1OGQ A;  3O53 A;  1W8A A;  4R0A A;  4Z61 C;  3VQ1 A;  2Z62 A;  4ECN A;  2BEX A;  4U06 A;  4CC4 A;  2Z63 A;  1O6S A;  1XKU A;  4GLP A;  4RCW A;  4MN8 B;  5LFN A;  3OJA A;  2R9U A;  3RW7 A;  1G9U A;  2P1Q B;  5FTT B;  2Z7X B;  2WQW A;  3RW6 A;  1XEU A;  5B0T A;  1P9A G;  4FCG A;  3ZYI A;  2WFH A;  1XEC A;  1P8V A;  5GS2 B;  5IJB A;  3WPE A;  3C6N B;  1O6V A;  5IYX C;  4CP6 A;  3E6J A;  4U08 A;  4Z64 C;  1LTX A;  2RA8 A;  4RCA B;  1SQ0 B;  3E4G A;  3RFJ A;  3ULV A;  4U7L A;  4K17 A;  1XCD A;  4KNG A;  2Z7X A;  3G3B A;  2P1O B;  2JE1 A;  5HDH A;  3WPG A;  4B8C D;  3ZYO A;  3RJ0 A;  2ELL A;  3CIG A;  3WPB A;  4G8A A;  2JE0 A;  1FT8 A;  4UFR A;  4WYK A;  4ECO A;  4CNC A;  3O6N A;  3TSR E;  3ULA A;  3WPH A;  3W3K A;  4L3A A;  4Z94 G;  1YRG A;  5GMG A;  1A9N A;  1P8T A;  4V2C A;  2Q4G W;  4Q3I A;  5AWA A;  3ZYJ A;  1D0B A;  3WPC A;  4R09 A;  3W3L A;  4V2D A;  5CMP A;  3WPF A;  4RWT C;  2O6Q A;  3RFE A;  4LXS A;  4LSX A;  1OZN A;  2IFG A;  2P1P B;  3C6O B;  4M7E C;  5B0N A;  1H6U A;  5B4P A;  4Z8G A;  3E3Z A;  1A4Y A;  1K5G C;  4L3F A;  2Y5Q A;  2Z64 A;  2WQX A;  4C2B B;  4EZG A;  5IJC A;  2P1M B;  4TZH A;  5GQR K;  4FS7 A;  4KT1 A;  1JL5 A;  2O6S A;  3OGL B;  4MQW X;  4R5C A;  4Z79 A;  1KOO A;  2OMU A;  2OMW A;  5D3I A;  1M10 B;  2ID5 A;  3RFS A;  2Z82 A;  2XWT C;  4PKI G;  4LXR A;  2FT3 A;  1DS9 A;  1OOK G;  4PQ8 A;  3CIY A;  3W3N A;  4PSJ A;  3M19 A;  4CC4 C;  3C6P B;  2UZY A;  3UL8 A;  4PER A;  1IO0 A;  1WWL A;  2CA6 A;  3BZ5 A;  3M18 A;  2P1N B;  4LI2 A;  2OMZ A;  3FXI A;  3A79 B;  1H6T A;  4LSA A;  4J4L A;  3SB4 A;  1U0N D;  5AWD A;  3G06 A;  2RR6 A;  4XSQ A;  4H09 A;  1DCE A;  4NKH A;  1O6T A;  4LSC A;  4AW4 A;  3UN9 A;  4I6J B;  3RGZ A;  3DZE A;  4ARR A;  2WQU A;  1KOH A;  3KJ4 A;  4OQT A;  3CVR A;  5CMN A;  3UL7 A;  2A0Z A;  4U09 A;  4WP6 A;  3GOZ A;  4C2A B;  4R6J A;  4FDW A;  4P91 A;  4XGO A;  1K5D C;  4CIL A;  1FS2 A;  2AST B;  2JQD A;  4QBZ A;  3W3M A;  5GMF A;  3OGM B;  3G04 C;  3WPD A;  2ASS B;  4Q3G A;  3G3A A;  2WQV A;  4R58 A;  4R6G A;  2OMV A;  4BSS A;  2Z81 A;  4GT6 A;  3W3G A;  3WPI A;  4QC0 A;  2OMX A;  2V9T B;  5AZ5 A;  1QYY A;  4BSU A;  4J0M A;  2XOT A;  4R6A A;  1OTN A;  4LSX C;  1GWB A;  5HZL B;  3REZ A;  4FD0 A; 
#chains in the Genus database with same CATH topology
 3E2J A;  3P72 A;  1FQV A;  1OTM A;  3ZYN A;  3RGX A;  4CNM A;  1M9L A;  4NZR M;  3WN4 A;  1XWD C;  5AWC A;  3G39 A;  3PMH G;  4R08 A;  4V2E A;  3VQ2 A;  4BV4 R;  1M9S A;  2BNH A;  4ARN A;  2O6R A;  4KXF B;  4XOS A;  2V70 A;  3ULU A;  2V9S A;  5GS0 A;  3OGK B;  4R5D A;  3RIZ A;  2OMT A;  1M0Z A;  4R07 A;  4YEB B;  1Z7X W;  4LI1 A;  1PGV A;  4BSR A;  4Q62 A;  5IJD A;  2UZX A;  2Z65 A;  1ZIW A;  5AWB A;  4M7E A;  1OTO A;  3W3J A;  4HQ1 A;  4Y61 B;  4IM6 A;  4QXE A;  4PEQ B;  4R6F A;  4NKG A;  4FMZ A;  3UL9 A;  4FHO A;  4P8S A;  2OMY A;  2Z66 A;  3JB9 j;  3OJA B;  1DFJ I;  5GMH A;  1FO1 A;  4AY9 X;  5A5C A;  1OGQ A;  3O53 A;  1W8A A;  4R0A A;  4Z61 C;  3VQ1 A;  2Z62 A;  4ECN A;  2BEX A;  4U06 A;  4CC4 A;  2Z63 A;  1O6S A;  1XKU A;  4GLP A;  4RCW A;  4MN8 B;  5LFN A;  3OJA A;  2R9U A;  3RW7 A;  1G9U A;  2P1Q B;  5FTT B;  2Z7X B;  2WQW A;  3RW6 A;  1XEU A;  5B0T A;  1P9A G;  4FCG A;  3ZYI A;  2WFH A;  1XEC A;  1P8V A;  5GS2 B;  5IJB A;  3WPE A;  3C6N B;  1O6V A;  5IYX C;  4CP6 A;  3E6J A;  4U08 A;  4Z64 C;  1LTX A;  2RA8 A;  4RCA B;  1SQ0 B;  3E4G A;  3RFJ A;  3ULV A;  4U7L A;  4K17 A;  1XCD A;  4KNG A;  2Z7X A;  3G3B A;  2P1O B;  2JE1 A;  5HDH A;  3WPG A;  4B8C D;  3ZYO A;  3RJ0 A;  2ELL A;  3CIG A;  3WPB A;  4G8A A;  2JE0 A;  1FT8 A;  4UFR A;  4WYK A;  4ECO A;  4CNC A;  3O6N A;  3TSR E;  3ULA A;  3WPH A;  3W3K A;  4L3A A;  4Z94 G;  1YRG A;  5GMG A;  1A9N A;  1P8T A;  4V2C A;  2Q4G W;  4Q3I A;  5AWA A;  3ZYJ A;  1D0B A;  3WPC A;  4R09 A;  3W3L A;  4V2D A;  5CMP A;  3WPF A;  4RWT C;  2O6Q A;  3RFE A;  4LXS A;  4LSX A;  1OZN A;  2IFG A;  2P1P B;  3C6O B;  4M7E C;  5B0N A;  1H6U A;  5B4P A;  4Z8G A;  3E3Z A;  1A4Y A;  1K5G C;  4L3F A;  2Y5Q A;  2Z64 A;  2WQX A;  4C2B B;  4EZG A;  5IJC A;  2P1M B;  4TZH A;  5GQR K;  4FS7 A;  4KT1 A;  1JL5 A;  2O6S A;  3OGL B;  4MQW X;  4R5C A;  4Z79 A;  1KOO A;  2OMU A;  2OMW A;  5D3I A;  1M10 B;  2ID5 A;  3RFS A;  2Z82 A;  2XWT C;  4PKI G;  4LXR A;  2FT3 A;  1DS9 A;  1OOK G;  4PQ8 A;  3CIY A;  3W3N A;  4PSJ A;  3M19 A;  4CC4 C;  3C6P B;  2UZY A;  3UL8 A;  4PER A;  1IO0 A;  1WWL A;  2CA6 A;  3BZ5 A;  3M18 A;  2P1N B;  4LI2 A;  2OMZ A;  3FXI A;  3A79 B;  1H6T A;  4LSA A;  4J4L A;  3SB4 A;  1U0N D;  5AWD A;  3G06 A;  2RR6 A;  4XSQ A;  4H09 A;  1DCE A;  4NKH A;  1O6T A;  4LSC A;  4AW4 A;  3UN9 A;  4I6J B;  3RGZ A;  3DZE A;  4ARR A;  2WQU A;  1KOH A;  3KJ4 A;  4OQT A;  3CVR A;  5CMN A;  3UL7 A;  2A0Z A;  4U09 A;  4WP6 A;  3GOZ A;  4C2A B;  4R6J A;  4FDW A;  4P91 A;  4XGO A;  1K5D C;  4CIL A;  1FS2 A;  2AST B;  2JQD A;  4QBZ A;  3W3M A;  5GMF A;  3OGM B;  3G04 C;  3WPD A;  2ASS B;  4Q3G A;  3G3A A;  2WQV A;  4R58 A;  4R6G A;  2OMV A;  4BSS A;  2Z81 A;  4GT6 A;  3W3G A;  3WPI A;  4QC0 A;  2OMX A;  2V9T B;  5AZ5 A;  1QYY A;  4BSU A;  4J0M A;  2XOT A;  4R6A A;  1OTN A;  4LSX C;  1GWB A;  4NZT M;  5HZL B;  3REZ A;  4FD0 A; 
#chains in the Genus database with same CATH homology
 3E2J A;  3P72 A;  1FQV A;  1OTM A;  3ZYN A;  3RGX A;  4CNM A;  1M9L A;  3WN4 A;  1XWD C;  5AWC A;  3G39 A;  3PMH G;  4R08 A;  4V2E A;  3VQ2 A;  4BV4 R;  1M9S A;  2BNH A;  4ARN A;  2O6R A;  4KXF B;  4XOS A;  2V70 A;  3ULU A;  2V9S A;  5GS0 A;  3OGK B;  4R5D A;  3RIZ A;  2OMT A;  1M0Z A;  4R07 A;  4YEB B;  1Z7X W;  4LI1 A;  1PGV A;  4BSR A;  4Q62 A;  5IJD A;  2UZX A;  2Z65 A;  1ZIW A;  5AWB A;  4M7E A;  1OTO A;  3W3J A;  4HQ1 A;  4Y61 B;  4IM6 A;  4QXE A;  4PEQ B;  4R6F A;  4NKG A;  4FMZ A;  3UL9 A;  4FHO A;  4P8S A;  2OMY A;  2Z66 A;  3JB9 j;  3OJA B;  1DFJ I;  5GMH A;  1FO1 A;  4AY9 X;  5A5C A;  1OGQ A;  3O53 A;  1W8A A;  4R0A A;  4Z61 C;  3VQ1 A;  2Z62 A;  4ECN A;  2BEX A;  4U06 A;  4CC4 A;  2Z63 A;  1O6S A;  1XKU A;  4GLP A;  4RCW A;  4MN8 B;  5LFN A;  3OJA A;  2R9U A;  3RW7 A;  1G9U A;  2P1Q B;  5FTT B;  2Z7X B;  2WQW A;  3RW6 A;  1XEU A;  5B0T A;  1P9A G;  4FCG A;  3ZYI A;  2WFH A;  1XEC A;  1P8V A;  5GS2 B;  5IJB A;  3WPE A;  3C6N B;  1O6V A;  5IYX C;  4CP6 A;  3E6J A;  4U08 A;  4Z64 C;  1LTX A;  2RA8 A;  4RCA B;  1SQ0 B;  3E4G A;  3RFJ A;  3ULV A;  4U7L A;  4K17 A;  1XCD A;  4KNG A;  2Z7X A;  3G3B A;  2P1O B;  2JE1 A;  5HDH A;  3WPG A;  4B8C D;  3ZYO A;  3RJ0 A;  2ELL A;  3CIG A;  3WPB A;  4G8A A;  2JE0 A;  1FT8 A;  4UFR A;  4WYK A;  4ECO A;  4CNC A;  3O6N A;  3TSR E;  3ULA A;  3WPH A;  3W3K A;  4L3A A;  4Z94 G;  1YRG A;  5GMG A;  1A9N A;  1P8T A;  4V2C A;  2Q4G W;  4Q3I A;  5AWA A;  3ZYJ A;  1D0B A;  3WPC A;  4R09 A;  3W3L A;  4V2D A;  5CMP A;  3WPF A;  4RWT C;  2O6Q A;  3RFE A;  4LXS A;  4LSX A;  1OZN A;  2IFG A;  2P1P B;  3C6O B;  4M7E C;  5B0N A;  1H6U A;  5B4P A;  4Z8G A;  3E3Z A;  1A4Y A;  1K5G C;  4L3F A;  2Y5Q A;  2Z64 A;  2WQX A;  4C2B B;  4EZG A;  5IJC A;  2P1M B;  4TZH A;  5GQR K;  4FS7 A;  4KT1 A;  1JL5 A;  2O6S A;  3OGL B;  4MQW X;  4R5C A;  4Z79 A;  1KOO A;  2OMU A;  2OMW A;  5D3I A;  1M10 B;  2ID5 A;  3RFS A;  2Z82 A;  2XWT C;  4PKI G;  4LXR A;  2FT3 A;  1DS9 A;  1OOK G;  4PQ8 A;  3CIY A;  3W3N A;  4PSJ A;  3M19 A;  4CC4 C;  3C6P B;  2UZY A;  3UL8 A;  4PER A;  1IO0 A;  1WWL A;  2CA6 A;  3BZ5 A;  3M18 A;  2P1N B;  4LI2 A;  2OMZ A;  3FXI A;  3A79 B;  1H6T A;  4LSA A;  4J4L A;  3SB4 A;  1U0N D;  5AWD A;  3G06 A;  2RR6 A;  4XSQ A;  4H09 A;  1DCE A;  4NKH A;  1O6T A;  4LSC A;  4AW4 A;  3UN9 A;  4I6J B;  3RGZ A;  3DZE A;  4ARR A;  2WQU A;  1KOH A;  3KJ4 A;  4OQT A;  3CVR A;  5CMN A;  3UL7 A;  2A0Z A;  4U09 A;  4WP6 A;  3GOZ A;  4C2A B;  4R6J A;  4FDW A;  4P91 A;  4XGO A;  1K5D C;  4CIL A;  1FS2 A;  2AST B;  2JQD A;  4QBZ A;  3W3M A;  5GMF A;  3OGM B;  3G04 C;  3WPD A;  2ASS B;  4Q3G A;  3G3A A;  2WQV A;  4R58 A;  4R6G A;  2OMV A;  4BSS A;  2Z81 A;  4GT6 A;  3W3G A;  3WPI A;  4QC0 A;  2OMX A;  2V9T B;  5AZ5 A;  1QYY A;  4BSU A;  4J0M A;  2XOT A;  4R6A A;  1OTN A;  4LSX C;  1GWB A;  5HZL B;  3REZ A;  4FD0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...