5GMGA

Crystal structure of monkey tlr7 in complex with loxoribine and polyu
Total Genus 252
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
252
sequence length
806
structure length
762
Chain Sequence
RWFPKTLPCDVTLDHVIVDCTDKHLTEIPGGIPTNTTNLTLTINHIPDISPASFHRLVHLVEIDFRCNCVPIRLGSKSNMCPRRLQIKPRSFSGLTYLKSLYLDGNQLLEIPQGLPPSLQLLSLEANNIFSIRKEQLTELANIEILYLGQNCYYRNPCYVSYSIEKDAFLNLTKLKVLSLKDNNVTTVPTVLPSTLTELYLYNNMIAEIQEDDFNNLNQLQILDLSGNCPRCYNAPFPCTPCKNNSPLQIPVNAFDALTELKVLRLHSNSLQHVPPRWFKNINNLQELDLSQNFLAKEIGDAKFLHFLPNLIQLDLSFNFELQVYRASMNLSQAFSSLKSLKILRIRGYVFKELKSFQLSPLHNLQNLEVLDLGTNFIKIANLSMFKQFKRLKVIDLSVNKISPLYYFRYDKYARSCRSCYKYGQTLDLSKNSIFFIKSSDFQHLSFLKCLNLSGNLISQTLNGSEFQPLAELRYLDFSNNRLDLLHSTAFEELRKLEVLDISSNSHYFQSEGITHMLNFTKNLKVLQKLMMNDNDISSSTSRTMESESLRTLEFRGNHLDVLWRDGDNRYLQLFKNLLKLEELDISKNSLSFLPSGVFDGMPPNLKNLSLAKNGLKSFIWEKLRYLKNLETLDLSHNQLTTVPERLSNCSRSLKNLILKNNQIRSLTKYFLQDAFQLRYLDLSSNKIQMIQKTSFPENVLNNLKMLLLHHNRFLCTCDAVWFVWWVQHTEVTIPYLATDVTCVGPGAHKGQSVISLDLYTC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Immune system/rna
molecule keywords Toll-like receptor 7
publication title Structural Analysis Reveals that Toll-like Receptor 7 Is a Dual Receptor for Guanosine and Single-Stranded RNA
pubmed doi rcsb
source organism Macaca mulatta
total genus 252
structure length 762
sequence length 806
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13306 LRR_5 BspA type Leucine rich repeat region (6 copies)
A PF13855 LRR_8 Leucine rich repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 5gmgA00
4BV4R 3UL7A 1H6TA 4V2DA 1O6TA 3ZYJA 3RFSA 3UL9A 2OMUA 1DS9A 3PMHG 2O6QA 2ASTB 2O6SA 4LSXC 3W3NA 3E2JA 4EZGA 3ZYOA 4MN8B 3DZEA 3CVRA 4ARRA 2P1OB 4CC4C 5D3IA 1LTXA 2WFHA 4ECOA 1IO0A 4MQWX 2WQWA 4Q62A 1M10B 3GOZA 2Z64A 4R5DA 4Z64C 4G8AA 3G3BA 3OGLB 4PERA 2XWTC 3OJAB 3JB9j 4UFRA 3VQ2A 5AWCA 2A0ZA 3WN4A 3W3GA 4KXFB 4BSRA 4LXRA 5A5CA 3TSRE 2WQVA 2Z82A 2OMVA 4R6AA 2V9TB 2ID5A 3SB4A 1FO1A 1M9SA 2RA8A 4C2BB 4HQ1A 4FS7A 3WPHA 4XOSA 2OMWA 4XGOA 3RGXA 1OTMA 3G3AA 3A79B 2Y5QA 3W3KA 2WQUA 1P8TA 5B0TA 3ZYIA 3WPGA 4GLPA 2JE0A 5GMGA 4P8SA 3W3LA 3P72A 4M7EA 4AW4A 1KOHA 4H09A 3WPDA 4PEQB 4R6GA 4NKHA 1FS2A 3C6PB 4R07A 2O6RA 4RCAB 2CA6A 4CILA 2Z63A 1XKUA 1PGVA 3REZA 1JL5A 1P8VA 4V2CA 4FCGA 5AWBA 1H6UA 1K5GC 2ELLA 5CMPA 2BNHA 4R6JA 2OMXA 1SQ0B 5CMNA 1M0ZA 2Z7XA 2Z66A 3ULUA 4GT6A 4K17A 4B8CD 4FD0A 1XCDA 3ULAA 2OMYA 3G06A 3M18A 4KT1A 4LSCA 3W3JA 3ZYNA 4Z94G 4XSQA 4RWTC 2R9UA 2BEXA 2XOTA 4CNMA 1M9LA 4CC4A 5IJCA 4P91A 4PSJA 4OQTA 4LI2A 1K5DC 2UZXA 5AWDA 2V9SA 3O6NA 2UZYA 3KJ4A 3UL8A 3WPBA 1ZIWA 3O53A 3G39A 2P1PB 1G9UA 4R09A 1XECA 4R5CA 2JE1A 3CIYA 3E6JA 4KNGA 5GMHA 3RJ0A 3E4GA 4LI1A 3BZ5A 1P9AG 5B0NA 5GMFA 2WQXA 2JQDA 4PQ8A 4WYKA 1QYYA 1W8AA 1XEUA 1DCEA 4LXSA 4BSUA 3UN9A 4C2AB 2OMZA 4L3AA 4Z61C 1O6VA 4QC0A 1OTOA 2Z81A 1OOKG 1GWBA 2Z62A 4QXEA 4IM6A 1A9NA 4R6FA 2Z65A 1XWDC 3WPIA 3RIZA 4R08A 5GS0A 3C6NB 1U0ND 2P1MB 4FHOA 4CP6A 1FT8A 3ULVA 4YEBB 5FTTB 4FDWA 4Y61B 1KOOA 3VQ1A 2FT3A 2OMTA 4PKIG 5IJDA 4Q3GA 3RFJA 4U08A 4R0AA 4Z8GA 1Z7XW 3C6OB 2P1QB 3E3ZA 3OGKB 3WPFA 5B4PA 5GS2B 3W3MA 3CIGA 2IFGA 5AWAA 5GQRK 4LSXA 1WWLA 5HZLB 3FXIA 4LSAA 3RW7A 4V2EA 3M19A 5IJBA 3RW6A 3G04C 2RR6A 1FQVA 1OGQA 4J4LA 1OTNA 1YRGA 5AZ5A 4U7LA 4I6JB 4U09A 3WPCA 4ECNA 5LFNA 4QBZA 4R58A 2Z7XB 1OZNA 4M7EC 4U06A 4CNCA 4Q3IA 3OGMB 4Z79A 2P1NB 5IYXC 4BSSA 4J0MA 4RCWA 3WPEA 1O6SA 4TZHA 1DFJI 4FMZA 5HDHA 1D0BA 1A4YA 4ARNA 2Q4GW 4NKGA 3RFEA 3OJAA 4L3FA 4AY9X 2ASSB 2V70A 4WP6A 3RGZA
chains in the Genus database with same CATH superfamily
4BV4R 3UL7A 1H6TA 4V2DA 1O6TA 3ZYJA 3RFSA 3UL9A 2OMUA 1DS9A 3PMHG 2O6QA 2ASTB 2O6SA 4LSXC 3W3NA 3E2JA 4EZGA 3ZYOA 4MN8B 3DZEA 3CVRA 4ARRA 2P1OB 4CC4C 5D3IA 1LTXA 2WFHA 4ECOA 1IO0A 4MQWX 2WQWA 4Q62A 1M10B 3GOZA 2Z64A 4R5DA 4Z64C 4G8AA 3G3BA 3OGLB 4PERA 2XWTC 3OJAB 3JB9j 4UFRA 3VQ2A 5AWCA 2A0ZA 3WN4A 3W3GA 4KXFB 4BSRA 4LXRA 5A5CA 3TSRE 2WQVA 2Z82A 2OMVA 4R6AA 2V9TB 2ID5A 3SB4A 1FO1A 1M9SA 2RA8A 4C2BB 4HQ1A 4FS7A 3WPHA 4XOSA 2OMWA 4XGOA 3RGXA 1OTMA 3G3AA 3A79B 2Y5QA 3W3KA 2WQUA 1P8TA 5B0TA 3ZYIA 3WPGA 4GLPA 2JE0A 5GMGA 4P8SA 3W3LA 3P72A 4M7EA 4AW4A 1KOHA 4H09A 3WPDA 4PEQB 4R6GA 4NKHA 1FS2A 3C6PB 4R07A 2O6RA 4RCAB 2CA6A 4CILA 2Z63A 1XKUA 1PGVA 3REZA 1JL5A 1P8VA 4V2CA 4FCGA 5AWBA 1H6UA 1K5GC 2ELLA 5CMPA 2BNHA 4R6JA 2OMXA 1SQ0B 5CMNA 1M0ZA 2Z7XA 2Z66A 3ULUA 4GT6A 4K17A 4B8CD 4FD0A 1XCDA 3ULAA 2OMYA 3G06A 3M18A 4KT1A 4LSCA 3W3JA 3ZYNA 4Z94G 4XSQA 4RWTC 2R9UA 2BEXA 2XOTA 4CNMA 1M9LA 4CC4A 5IJCA 4P91A 4PSJA 4OQTA 4LI2A 1K5DC 2UZXA 5AWDA 2V9SA 3O6NA 2UZYA 3KJ4A 3UL8A 3WPBA 1ZIWA 3O53A 3G39A 2P1PB 1G9UA 4R09A 1XECA 4R5CA 2JE1A 3CIYA 3E6JA 4KNGA 5GMHA 3RJ0A 3E4GA 4LI1A 3BZ5A 1P9AG 5B0NA 5GMFA 2WQXA 2JQDA 4PQ8A 4WYKA 1QYYA 1W8AA 1XEUA 1DCEA 4LXSA 4BSUA 3UN9A 4C2AB 2OMZA 4L3AA 4Z61C 1O6VA 4QC0A 1OTOA 2Z81A 1OOKG 1GWBA 2Z62A 4QXEA 4IM6A 1A9NA 4R6FA 2Z65A 1XWDC 3WPIA 3RIZA 4R08A 5GS0A 3C6NB 1U0ND 2P1MB 4FHOA 4CP6A 1FT8A 3ULVA 4YEBB 5FTTB 4FDWA 4Y61B 1KOOA 3VQ1A 2FT3A 2OMTA 4PKIG 5IJDA 4Q3GA 3RFJA 4U08A 4R0AA 4Z8GA 1Z7XW 3C6OB 2P1QB 3E3ZA 3OGKB 3WPFA 5B4PA 5GS2B 3W3MA 3CIGA 2IFGA 5AWAA 5GQRK 4LSXA 1WWLA 5HZLB 3FXIA 4LSAA 3RW7A 4V2EA 3M19A 5IJBA 3RW6A 3G04C 2RR6A 1FQVA 1OGQA 4J4LA 1OTNA 1YRGA 5AZ5A 4U7LA 4I6JB 4U09A 3WPCA 4ECNA 5LFNA 4QBZA 4R58A 2Z7XB 1OZNA 4M7EC 4NZRM 4U06A 4CNCA 4Q3IA 3OGMB 4Z79A 2P1NB 5IYXC 4BSSA 4J0MA 4RCWA 4NZTM 3WPEA 1O6SA 4TZHA 1DFJI 4FMZA 5HDHA 1D0BA 1A4YA 4ARNA 2Q4GW 4NKGA 3RFEA 3OJAA 4L3FA 4AY9X 2ASSB 2V70A 4WP6A 3RGZA
chains in the Genus database with same CATH topology
4BV4R 3UL7A 1H6TA 4V2DA 1O6TA 3ZYJA 3RFSA 3UL9A 2OMUA 1DS9A 3PMHG 2O6QA 2ASTB 2O6SA 4LSXC 3W3NA 3E2JA 4EZGA 3ZYOA 4MN8B 3DZEA 3CVRA 4ARRA 2P1OB 4CC4C 5D3IA 1LTXA 2WFHA 4ECOA 1IO0A 4MQWX 2WQWA 4Q62A 1M10B 3GOZA 2Z64A 4R5DA 4Z64C 4G8AA 3G3BA 3OGLB 4PERA 2XWTC 3OJAB 3JB9j 4UFRA 3VQ2A 5AWCA 2A0ZA 3WN4A 3W3GA 4KXFB 4BSRA 4LXRA 5A5CA 3TSRE 2WQVA 2Z82A 2OMVA 4R6AA 2V9TB 2ID5A 3SB4A 1FO1A 1M9SA 2RA8A 4C2BB 4HQ1A 4FS7A 3WPHA 4XOSA 2OMWA 4XGOA 3RGXA 1OTMA 3G3AA 3A79B 2Y5QA 3W3KA 2WQUA 1P8TA 5B0TA 3ZYIA 3WPGA 4GLPA 2JE0A 5GMGA 4P8SA 3W3LA 3P72A 4M7EA 4AW4A 1KOHA 4H09A 3WPDA 4PEQB 4R6GA 4NKHA 1FS2A 3C6PB 4R07A 2O6RA 4RCAB 2CA6A 4CILA 2Z63A 1XKUA 1PGVA 3REZA 1JL5A 1P8VA 4V2CA 4FCGA 5AWBA 1H6UA 1K5GC 2ELLA 5CMPA 2BNHA 4R6JA 2OMXA 1SQ0B 5CMNA 1M0ZA 2Z7XA 2Z66A 3ULUA 4GT6A 4K17A 4B8CD 4FD0A 1XCDA 3ULAA 2OMYA 3G06A 3M18A 4KT1A 4LSCA 3W3JA 3ZYNA 4Z94G 4XSQA 4RWTC 2R9UA 2BEXA 2XOTA 4CNMA 1M9LA 4CC4A 5IJCA 4P91A 4PSJA 4OQTA 4LI2A 1K5DC 2UZXA 5AWDA 2V9SA 3O6NA 2UZYA 3KJ4A 3UL8A 3WPBA 1ZIWA 3O53A 3G39A 2P1PB 1G9UA 4R09A 1XECA 4R5CA 2JE1A 3CIYA 3E6JA 4KNGA 5GMHA 3RJ0A 3E4GA 4LI1A 3BZ5A 1P9AG 5B0NA 5GMFA 2WQXA 2JQDA 4PQ8A 4WYKA 1QYYA 1W8AA 1XEUA 1DCEA 4LXSA 4BSUA 3UN9A 4C2AB 2OMZA 4L3AA 4Z61C 1O6VA 4QC0A 1OTOA 2Z81A 1OOKG 1GWBA 2Z62A 4QXEA 4IM6A 1A9NA 4R6FA 2Z65A 1XWDC 3WPIA 3RIZA 4R08A 5GS0A 3C6NB 1U0ND 2P1MB 4FHOA 4CP6A 1FT8A 3ULVA 4YEBB 5FTTB 4FDWA 4Y61B 1KOOA 3VQ1A 2FT3A 2OMTA 4PKIG 5IJDA 4Q3GA 3RFJA 4U08A 4R0AA 4Z8GA 1Z7XW 3C6OB 2P1QB 3E3ZA 3OGKB 3WPFA 5B4PA 5GS2B 3W3MA 3CIGA 2IFGA 5AWAA 5GQRK 4LSXA 1WWLA 5HZLB 3FXIA 4LSAA 3RW7A 4V2EA 3M19A 5IJBA 3RW6A 3G04C 2RR6A 1FQVA 1OGQA 4J4LA 1OTNA 1YRGA 5AZ5A 4U7LA 4I6JB 4U09A 3WPCA 4ECNA 5LFNA 4QBZA 4R58A 2Z7XB 1OZNA 4M7EC 4U06A 4CNCA 4Q3IA 3OGMB 4Z79A 2P1NB 5IYXC 4BSSA 4J0MA 4RCWA 3WPEA 1O6SA 4TZHA 1DFJI 4FMZA 5HDHA 1D0BA 1A4YA 4ARNA 2Q4GW 4NKGA 3RFEA 3OJAA 4L3FA 4AY9X 2ASSB 2V70A 4WP6A 3RGZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BV4 R;  3UL7 A;  1H6T A;  4V2D A;  1O6T A;  3ZYJ A;  3RFS A;  3UL9 A;  2OMU A;  1DS9 A;  3PMH G;  2O6Q A;  2AST B;  2O6S A;  4LSX C;  3W3N A;  3E2J A;  4EZG A;  3ZYO A;  4MN8 B;  3DZE A;  3CVR A;  4ARR A;  2P1O B;  4CC4 C;  5D3I A;  1LTX A;  2WFH A;  4ECO A;  1IO0 A;  4MQW X;  2WQW A;  4Q62 A;  1M10 B;  3GOZ A;  2Z64 A;  4R5D A;  4Z64 C;  4G8A A;  3G3B A;  3OGL B;  4PER A;  2XWT C;  3OJA B;  3JB9 j;  4UFR A;  3VQ2 A;  5AWC A;  2A0Z A;  3WN4 A;  3W3G A;  4KXF B;  4BSR A;  4LXR A;  5A5C A;  3TSR E;  2WQV A;  2Z82 A;  2OMV A;  4R6A A;  2V9T B;  2ID5 A;  3SB4 A;  1FO1 A;  1M9S A;  2RA8 A;  4C2B B;  4HQ1 A;  4FS7 A;  3WPH A;  4XOS A;  2OMW A;  4XGO A;  3RGX A;  1OTM A;  3G3A A;  3A79 B;  2Y5Q A;  3W3K A;  2WQU A;  1P8T A;  5B0T A;  3ZYI A;  3WPG A;  4GLP A;  2JE0 A;  5GMG A;  4P8S A;  3W3L A;  3P72 A;  4M7E A;  4AW4 A;  1KOH A;  4H09 A;  3WPD A;  4PEQ B;  4R6G A;  4NKH A;  1FS2 A;  3C6P B;  4R07 A;  2O6R A;  4RCA B;  2CA6 A;  4CIL A;  2Z63 A;  1XKU A;  1PGV A;  3REZ A;  1JL5 A;  1P8V A;  4V2C A;  4FCG A;  5AWB A;  1H6U A;  1K5G C;  2ELL A;  5CMP A;  2BNH A;  4R6J A;  2OMX A;  1SQ0 B;  5CMN A;  1M0Z A;  2Z7X A;  2Z66 A;  3ULU A;  4GT6 A;  4K17 A;  4B8C D;  4FD0 A;  1XCD A;  3ULA A;  2OMY A;  3G06 A;  3M18 A;  4KT1 A;  4LSC A;  3W3J A;  3ZYN A;  4Z94 G;  4XSQ A;  4RWT C;  2R9U A;  2BEX A;  2XOT A;  4CNM A;  1M9L A;  4CC4 A;  5IJC A;  4P91 A;  4PSJ A;  4OQT A;  4LI2 A;  1K5D C;  2UZX A;  5AWD A;  2V9S A;  3O6N A;  2UZY A;  3KJ4 A;  3UL8 A;  3WPB A;  1ZIW A;  3O53 A;  3G39 A;  2P1P B;  1G9U A;  4R09 A;  1XEC A;  4R5C A;  2JE1 A;  3CIY A;  3E6J A;  4KNG A;  5GMH A;  3RJ0 A;  3E4G A;  4LI1 A;  3BZ5 A;  1P9A G;  5B0N A;  5GMF A;  2WQX A;  2JQD A;  4PQ8 A;  4WYK A;  1QYY A;  1W8A A;  1XEU A;  1DCE A;  4LXS A;  4BSU A;  3UN9 A;  4C2A B;  2OMZ A;  4L3A A;  4Z61 C;  1O6V A;  4QC0 A;  1OTO A;  2Z81 A;  1OOK G;  1GWB A;  2Z62 A;  4QXE A;  4IM6 A;  1A9N A;  4R6F A;  2Z65 A;  1XWD C;  3WPI A;  3RIZ A;  4R08 A;  5GS0 A;  3C6N B;  1U0N D;  2P1M B;  4FHO A;  4CP6 A;  1FT8 A;  3ULV A;  4YEB B;  5FTT B;  4FDW A;  4Y61 B;  1KOO A;  3VQ1 A;  2FT3 A;  2OMT A;  4PKI G;  5IJD A;  4Q3G A;  3RFJ A;  4U08 A;  4R0A A;  4Z8G A;  1Z7X W;  3C6O B;  2P1Q B;  3E3Z A;  3OGK B;  3WPF A;  5B4P A;  5GS2 B;  3W3M A;  3CIG A;  2IFG A;  5AWA A;  5GQR K;  4LSX A;  1WWL A;  5HZL B;  3FXI A;  4LSA A;  3RW7 A;  4V2E A;  3M19 A;  5IJB A;  3RW6 A;  3G04 C;  2RR6 A;  1FQV A;  1OGQ A;  4J4L A;  1OTN A;  1YRG A;  5AZ5 A;  4U7L A;  4I6J B;  4U09 A;  3WPC A;  4ECN A;  5LFN A;  4QBZ A;  4R58 A;  2Z7X B;  1OZN A;  4M7E C;  4U06 A;  4CNC A;  4Q3I A;  3OGM B;  4Z79 A;  2P1N B;  5IYX C;  4BSS A;  4J0M A;  4RCW A;  3WPE A;  1O6S A;  4TZH A;  1DFJ I;  4FMZ A;  5HDH A;  1D0B A;  1A4Y A;  4ARN A;  2Q4G W;  4NKG A;  3RFE A;  3OJA A;  4L3F A;  4AY9 X;  2ASS B;  2V70 A;  4WP6 A;  3RGZ A; 
#chains in the Genus database with same CATH topology
 4BV4 R;  3UL7 A;  1H6T A;  4V2D A;  1O6T A;  3ZYJ A;  3RFS A;  3UL9 A;  2OMU A;  1DS9 A;  3PMH G;  2O6Q A;  2AST B;  2O6S A;  4LSX C;  3W3N A;  3E2J A;  4EZG A;  3ZYO A;  4MN8 B;  3DZE A;  3CVR A;  4ARR A;  2P1O B;  4CC4 C;  5D3I A;  1LTX A;  2WFH A;  4ECO A;  1IO0 A;  4MQW X;  2WQW A;  4Q62 A;  1M10 B;  3GOZ A;  2Z64 A;  4R5D A;  4Z64 C;  4G8A A;  3G3B A;  3OGL B;  4PER A;  2XWT C;  3OJA B;  3JB9 j;  4UFR A;  3VQ2 A;  5AWC A;  2A0Z A;  3WN4 A;  3W3G A;  4KXF B;  4BSR A;  4LXR A;  5A5C A;  3TSR E;  2WQV A;  2Z82 A;  2OMV A;  4R6A A;  2V9T B;  2ID5 A;  3SB4 A;  1FO1 A;  1M9S A;  2RA8 A;  4C2B B;  4HQ1 A;  4FS7 A;  3WPH A;  4XOS A;  2OMW A;  4XGO A;  3RGX A;  1OTM A;  3G3A A;  3A79 B;  2Y5Q A;  3W3K A;  2WQU A;  1P8T A;  5B0T A;  3ZYI A;  3WPG A;  4GLP A;  2JE0 A;  5GMG A;  4P8S A;  3W3L A;  3P72 A;  4M7E A;  4AW4 A;  1KOH A;  4H09 A;  3WPD A;  4PEQ B;  4R6G A;  4NKH A;  1FS2 A;  3C6P B;  4R07 A;  2O6R A;  4RCA B;  2CA6 A;  4CIL A;  2Z63 A;  1XKU A;  1PGV A;  3REZ A;  1JL5 A;  1P8V A;  4V2C A;  4FCG A;  5AWB A;  1H6U A;  1K5G C;  2ELL A;  5CMP A;  2BNH A;  4R6J A;  2OMX A;  1SQ0 B;  5CMN A;  1M0Z A;  2Z7X A;  2Z66 A;  3ULU A;  4GT6 A;  4K17 A;  4B8C D;  4FD0 A;  1XCD A;  3ULA A;  2OMY A;  3G06 A;  3M18 A;  4KT1 A;  4LSC A;  3W3J A;  3ZYN A;  4Z94 G;  4XSQ A;  4RWT C;  2R9U A;  2BEX A;  2XOT A;  4CNM A;  1M9L A;  4CC4 A;  5IJC A;  4P91 A;  4PSJ A;  4OQT A;  4LI2 A;  1K5D C;  2UZX A;  5AWD A;  2V9S A;  3O6N A;  2UZY A;  3KJ4 A;  3UL8 A;  3WPB A;  1ZIW A;  3O53 A;  3G39 A;  2P1P B;  1G9U A;  4R09 A;  1XEC A;  4R5C A;  2JE1 A;  3CIY A;  3E6J A;  4KNG A;  5GMH A;  3RJ0 A;  3E4G A;  4LI1 A;  3BZ5 A;  1P9A G;  5B0N A;  5GMF A;  2WQX A;  2JQD A;  4PQ8 A;  4WYK A;  1QYY A;  1W8A A;  1XEU A;  1DCE A;  4LXS A;  4BSU A;  3UN9 A;  4C2A B;  2OMZ A;  4L3A A;  4Z61 C;  1O6V A;  4QC0 A;  1OTO A;  2Z81 A;  1OOK G;  1GWB A;  2Z62 A;  4QXE A;  4IM6 A;  1A9N A;  4R6F A;  2Z65 A;  1XWD C;  3WPI A;  3RIZ A;  4R08 A;  5GS0 A;  3C6N B;  1U0N D;  2P1M B;  4FHO A;  4CP6 A;  1FT8 A;  3ULV A;  4YEB B;  5FTT B;  4FDW A;  4Y61 B;  1KOO A;  3VQ1 A;  2FT3 A;  2OMT A;  4PKI G;  5IJD A;  4Q3G A;  3RFJ A;  4U08 A;  4R0A A;  4Z8G A;  1Z7X W;  3C6O B;  2P1Q B;  3E3Z A;  3OGK B;  3WPF A;  5B4P A;  5GS2 B;  3W3M A;  3CIG A;  2IFG A;  5AWA A;  5GQR K;  4LSX A;  1WWL A;  5HZL B;  3FXI A;  4LSA A;  3RW7 A;  4V2E A;  3M19 A;  5IJB A;  3RW6 A;  3G04 C;  2RR6 A;  1FQV A;  1OGQ A;  4J4L A;  1OTN A;  1YRG A;  5AZ5 A;  4U7L A;  4I6J B;  4U09 A;  3WPC A;  4ECN A;  5LFN A;  4QBZ A;  4R58 A;  2Z7X B;  1OZN A;  4M7E C;  4NZR M;  4U06 A;  4CNC A;  4Q3I A;  3OGM B;  4Z79 A;  2P1N B;  5IYX C;  4BSS A;  4J0M A;  4RCW A;  4NZT M;  3WPE A;  1O6S A;  4TZH A;  1DFJ I;  4FMZ A;  5HDH A;  1D0B A;  1A4Y A;  4ARN A;  2Q4G W;  4NKG A;  3RFE A;  3OJA A;  4L3F A;  4AY9 X;  2ASS B;  2V70 A;  4WP6 A;  3RGZ A; 
#chains in the Genus database with same CATH homology
 4BV4 R;  3UL7 A;  1H6T A;  4V2D A;  1O6T A;  3ZYJ A;  3RFS A;  3UL9 A;  2OMU A;  1DS9 A;  3PMH G;  2O6Q A;  2AST B;  2O6S A;  4LSX C;  3W3N A;  3E2J A;  4EZG A;  3ZYO A;  4MN8 B;  3DZE A;  3CVR A;  4ARR A;  2P1O B;  4CC4 C;  5D3I A;  1LTX A;  2WFH A;  4ECO A;  1IO0 A;  4MQW X;  2WQW A;  4Q62 A;  1M10 B;  3GOZ A;  2Z64 A;  4R5D A;  4Z64 C;  4G8A A;  3G3B A;  3OGL B;  4PER A;  2XWT C;  3OJA B;  3JB9 j;  4UFR A;  3VQ2 A;  5AWC A;  2A0Z A;  3WN4 A;  3W3G A;  4KXF B;  4BSR A;  4LXR A;  5A5C A;  3TSR E;  2WQV A;  2Z82 A;  2OMV A;  4R6A A;  2V9T B;  2ID5 A;  3SB4 A;  1FO1 A;  1M9S A;  2RA8 A;  4C2B B;  4HQ1 A;  4FS7 A;  3WPH A;  4XOS A;  2OMW A;  4XGO A;  3RGX A;  1OTM A;  3G3A A;  3A79 B;  2Y5Q A;  3W3K A;  2WQU A;  1P8T A;  5B0T A;  3ZYI A;  3WPG A;  4GLP A;  2JE0 A;  5GMG A;  4P8S A;  3W3L A;  3P72 A;  4M7E A;  4AW4 A;  1KOH A;  4H09 A;  3WPD A;  4PEQ B;  4R6G A;  4NKH A;  1FS2 A;  3C6P B;  4R07 A;  2O6R A;  4RCA B;  2CA6 A;  4CIL A;  2Z63 A;  1XKU A;  1PGV A;  3REZ A;  1JL5 A;  1P8V A;  4V2C A;  4FCG A;  5AWB A;  1H6U A;  1K5G C;  2ELL A;  5CMP A;  2BNH A;  4R6J A;  2OMX A;  1SQ0 B;  5CMN A;  1M0Z A;  2Z7X A;  2Z66 A;  3ULU A;  4GT6 A;  4K17 A;  4B8C D;  4FD0 A;  1XCD A;  3ULA A;  2OMY A;  3G06 A;  3M18 A;  4KT1 A;  4LSC A;  3W3J A;  3ZYN A;  4Z94 G;  4XSQ A;  4RWT C;  2R9U A;  2BEX A;  2XOT A;  4CNM A;  1M9L A;  4CC4 A;  5IJC A;  4P91 A;  4PSJ A;  4OQT A;  4LI2 A;  1K5D C;  2UZX A;  5AWD A;  2V9S A;  3O6N A;  2UZY A;  3KJ4 A;  3UL8 A;  3WPB A;  1ZIW A;  3O53 A;  3G39 A;  2P1P B;  1G9U A;  4R09 A;  1XEC A;  4R5C A;  2JE1 A;  3CIY A;  3E6J A;  4KNG A;  5GMH A;  3RJ0 A;  3E4G A;  4LI1 A;  3BZ5 A;  1P9A G;  5B0N A;  5GMF A;  2WQX A;  2JQD A;  4PQ8 A;  4WYK A;  1QYY A;  1W8A A;  1XEU A;  1DCE A;  4LXS A;  4BSU A;  3UN9 A;  4C2A B;  2OMZ A;  4L3A A;  4Z61 C;  1O6V A;  4QC0 A;  1OTO A;  2Z81 A;  1OOK G;  1GWB A;  2Z62 A;  4QXE A;  4IM6 A;  1A9N A;  4R6F A;  2Z65 A;  1XWD C;  3WPI A;  3RIZ A;  4R08 A;  5GS0 A;  3C6N B;  1U0N D;  2P1M B;  4FHO A;  4CP6 A;  1FT8 A;  3ULV A;  4YEB B;  5FTT B;  4FDW A;  4Y61 B;  1KOO A;  3VQ1 A;  2FT3 A;  2OMT A;  4PKI G;  5IJD A;  4Q3G A;  3RFJ A;  4U08 A;  4R0A A;  4Z8G A;  1Z7X W;  3C6O B;  2P1Q B;  3E3Z A;  3OGK B;  3WPF A;  5B4P A;  5GS2 B;  3W3M A;  3CIG A;  2IFG A;  5AWA A;  5GQR K;  4LSX A;  1WWL A;  5HZL B;  3FXI A;  4LSA A;  3RW7 A;  4V2E A;  3M19 A;  5IJB A;  3RW6 A;  3G04 C;  2RR6 A;  1FQV A;  1OGQ A;  4J4L A;  1OTN A;  1YRG A;  5AZ5 A;  4U7L A;  4I6J B;  4U09 A;  3WPC A;  4ECN A;  5LFN A;  4QBZ A;  4R58 A;  2Z7X B;  1OZN A;  4M7E C;  4U06 A;  4CNC A;  4Q3I A;  3OGM B;  4Z79 A;  2P1N B;  5IYX C;  4BSS A;  4J0M A;  4RCW A;  3WPE A;  1O6S A;  4TZH A;  1DFJ I;  4FMZ A;  5HDH A;  1D0B A;  1A4Y A;  4ARN A;  2Q4G W;  4NKG A;  3RFE A;  3OJA A;  4L3F A;  4AY9 X;  2ASS B;  2V70 A;  4WP6 A;  3RGZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...