3ULAA

Crystal structure of the tv3 mutant f63w-md-2-eritoran complex
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
276
structure length
276
Chain Sequence
EPCVEVVPNITYQCMELNFYKIPDNLPFSTKNLDLSWNPLRHLGSYSFFSFPELQVLDLSRCEIQTIEDGAYQSLSHLSTLILTGNPIQSLALGAFSGLSSLQKLVAVETNLASLENFPIGHLKTLKELNVAHNLIQSFKLPEYFSNLTNLEHLDLSSNKIQSIYCTDLRVLHQMPLLNLSLDLSLNPMNFIQPGAFKEIRLKELALDTNQLKSVPDGIFDRLTSLQKIWLHTNPWDCSCPRIDYLSRWLNKNSQKEQGSAKCSGSGKPVRSIICP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Toll-like receptor 4, Variable lymphocyte receptor B
publication title Structure-Based Rational Design of a Toll-like Receptor 4 (TLR4) Decoy Receptor with High Binding Affinity for a Target Protein.
pubmed doi rcsb
source organism Homo sapiens
total genus 76
structure length 276
sequence length 276
chains with identical sequence C
ec nomenclature
pdb deposition date 2011-11-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13855 LRR_8 Leucine rich repeat
A PF13855 LRR_8 Leucine rich repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 3ulaA00
4R07A 3PMHG 2WFHA 4R5CA 3WPHA 2FT3A 4BSRA 4XOSA 4CP6A 3CIGA 3E6JA 2O6SA 2OMUA 3E4GA 5FTTB 2O6QA 2V9TB 5HDHA 4YEBB 1OTOA 4CC4C 1OGQA 2JE1A 5GS0A 2CA6A 3JB9j 1FS2A 4HQ1A 4V2EA 3ULVA 1O6TA 3G39A 1DCEA 2IFGA 2OMTA 4XSQA 4PEQB 5CMNA 1OZNA 2OMZA 4Z79A 2ASTB 2XOTA 2P1OB 5GMFA 5B0TA 1K5DC 3RW6A 4Q3IA 1PGVA 3G04C 4R6JA 1U0ND 3RFSA 4FCGA 2Z63A 4R6AA 2WQUA 5IJCA 2Q4GW 4LXSA 4PERA 4QBZA 1H6TA 2RR6A 3FXIA 4CC4A 3RW7A 3RIZA 5GS2B 4LXRA 3P72A 3WPIA 2ID5A 2JQDA 3O6NA 1LTXA 4L3FA 5GQRK 5LFNA 4Q3GA 2P1QB 4R6FA 4WYKA 1P8TA 4PQ8A 3RFJA 3RFEA 2P1NB 3VQ2A 4IM6A 3WN4A 3C6NB 4C2BB 4OQTA 4C2AB 2Z65A 4BV4R 1M9SA 3W3JA 1IO0A 4RCAB 4LI2A 5AZ5A 5D3IA 3WPFA 3ZYIA 1DS9A 4Q62A 1O6SA 4CILA 5AWBA 4H09A 4QXEA 4KT1A 1XKUA 3G06A 4R58A 4CNMA 1OTNA 2UZXA 4FD0A 2XWTC 3G3AA 4M7EC 1XECA 1OOKG 4G8AA 1K5GC 1XWDC 3DZEA 3W3KA 2Z7XA 3A79B 3UL7A 1M0ZA 3WPEA 1FO1A 3WPBA 2V9SA 1GWBA 1M9LA 2OMWA 4FHOA 4NKHA 4QC0A 4Z64C 1M10B 1D0BA 3C6OB 2Z7XB 1Z7XW 4R08A 5AWCA 4P8SA 4R0AA 5GMGA 3O53A 4BSSA 1FQVA 4LI1A 4U08A 1ZIWA 4RWTC 2V70A 3E3ZA 3ZYJA 4J4LA 4L3AA 4WP6A 4M7EA 4FS7A 4J0MA 3WPCA 3ULAA 2Z64A 4ECNA 4R6GA 3ZYNA 3M19A 4R09A 1A9NA 2P1MB 5B0NA 2O6RA 3RJ0A 4ARNA 4Y61B 4GLPA 4NKGA 4MQWX 5HZLB 4FDWA 1W8AA 4Z94G 4KXFB 1QYYA 3REZA 4PKIG 4TZHA 5A5CA 2Y5QA 4LSXC 4Z61C 1P8VA 3OGKB 3W3GA 3RGZA 2P1PB 3OGLB 5AWAA 2OMXA 3OJAA 1JL5A 3ULUA 2Z82A 1XEUA 4ARRA 5CMPA 1G9UA 3UN9A 1H6UA 2RA8A 1KOHA 3W3LA 2Z62A 3E2JA 3OJAB 3TSRE 2Z66A 4V2CA 3ZYOA 4UFRA 4MN8B 2ELLA 4U09A 2BEXA 1SQ0B 3BZ5A 1YRGA 4GT6A 2WQWA 1OTMA 3RGXA 4U06A 5B4PA 4I6JB 3GOZA 4XGOA 5IJBA 3SB4A 2OMYA 4LSXA 4LSCA 1FT8A 5IYXC 3KJ4A 4B8CD 1A4YA 4BSUA 4K17A 3UL8A 5AWDA 1KOOA 5GMHA 4P91A 2OMVA 3CVRA 3M18A 1XCDA 4Z8GA 3WPGA 3UL9A 1P9AG 2BNHA 4LSAA 3C6PB 4V2DA 4ECOA 3W3MA 3CIYA 1DFJI 3OGMB 2WQVA 1O6VA 2A0ZA 3G3BA 4AY9X 5IJDA 4KNGA 4R5DA 4CNCA 1WWLA 2Z81A 4AW4A 4PSJA 4U7LA 3VQ1A 4FMZA 4EZGA 2JE0A 4RCWA 2R9UA 2UZYA 3WPDA 2ASSB 2WQXA 3W3NA
chains in the Genus database with same CATH superfamily
4R07A 3PMHG 2WFHA 4R5CA 3WPHA 2FT3A 4BSRA 4XOSA 4CP6A 3CIGA 3E6JA 2O6SA 2OMUA 3E4GA 5FTTB 2O6QA 2V9TB 5HDHA 4YEBB 1OTOA 4CC4C 1OGQA 2JE1A 5GS0A 2CA6A 3JB9j 4NZTM 1FS2A 4HQ1A 4V2EA 3ULVA 1O6TA 3G39A 1DCEA 2IFGA 2OMTA 4XSQA 4PEQB 5CMNA 1OZNA 2OMZA 4Z79A 2ASTB 2XOTA 2P1OB 5GMFA 5B0TA 1K5DC 3RW6A 4Q3IA 1PGVA 3G04C 4R6JA 1U0ND 3RFSA 4FCGA 2Z63A 4R6AA 2WQUA 5IJCA 2Q4GW 4LXSA 4PERA 4QBZA 1H6TA 2RR6A 3FXIA 4CC4A 3RW7A 3RIZA 5GS2B 4LXRA 3P72A 3WPIA 2ID5A 2JQDA 3O6NA 1LTXA 4L3FA 5GQRK 5LFNA 4Q3GA 2P1QB 4R6FA 4WYKA 1P8TA 4PQ8A 3RFJA 3RFEA 2P1NB 3VQ2A 4IM6A 3WN4A 3C6NB 4NZRM 4C2BB 4OQTA 4C2AB 2Z65A 4BV4R 1M9SA 3W3JA 1IO0A 4RCAB 4LI2A 5AZ5A 5D3IA 3WPFA 3ZYIA 1DS9A 4Q62A 1O6SA 4CILA 5AWBA 4H09A 4QXEA 4KT1A 1XKUA 3G06A 4R58A 4CNMA 1OTNA 2UZXA 4FD0A 2XWTC 3G3AA 4M7EC 1XECA 1OOKG 4G8AA 1K5GC 1XWDC 3DZEA 3W3KA 2Z7XA 3A79B 3UL7A 1M0ZA 3WPEA 1FO1A 3WPBA 2V9SA 1GWBA 1M9LA 2OMWA 4FHOA 4NKHA 4QC0A 4Z64C 1M10B 1D0BA 3C6OB 2Z7XB 1Z7XW 4R08A 5AWCA 4P8SA 4R0AA 5GMGA 3O53A 4BSSA 1FQVA 4LI1A 4U08A 1ZIWA 4RWTC 2V70A 3E3ZA 3ZYJA 4J4LA 4L3AA 4WP6A 4M7EA 4FS7A 4J0MA 3WPCA 3ULAA 2Z64A 4ECNA 4R6GA 3ZYNA 3M19A 4R09A 1A9NA 2P1MB 5B0NA 2O6RA 3RJ0A 4ARNA 4Y61B 4GLPA 4NKGA 4MQWX 5HZLB 4FDWA 1W8AA 4Z94G 4KXFB 1QYYA 3REZA 4PKIG 4TZHA 5A5CA 2Y5QA 4LSXC 4Z61C 1P8VA 3OGKB 3W3GA 3RGZA 2P1PB 3OGLB 5AWAA 2OMXA 3OJAA 1JL5A 3ULUA 2Z82A 1XEUA 4ARRA 5CMPA 1G9UA 3UN9A 1H6UA 2RA8A 1KOHA 3W3LA 2Z62A 3E2JA 3OJAB 3TSRE 2Z66A 4V2CA 3ZYOA 4UFRA 4MN8B 2ELLA 4U09A 2BEXA 1SQ0B 3BZ5A 1YRGA 4GT6A 2WQWA 1OTMA 3RGXA 4U06A 5B4PA 4I6JB 3GOZA 4XGOA 5IJBA 3SB4A 2OMYA 4LSXA 4LSCA 1FT8A 5IYXC 3KJ4A 4B8CD 1A4YA 4BSUA 4K17A 3UL8A 5AWDA 1KOOA 5GMHA 4P91A 2OMVA 3CVRA 3M18A 1XCDA 4Z8GA 3WPGA 3UL9A 1P9AG 2BNHA 4LSAA 3C6PB 4V2DA 4ECOA 3W3MA 3CIYA 1DFJI 3OGMB 2WQVA 1O6VA 2A0ZA 3G3BA 4AY9X 5IJDA 4KNGA 4R5DA 4CNCA 1WWLA 2Z81A 4AW4A 4PSJA 4U7LA 3VQ1A 4FMZA 4EZGA 2JE0A 4RCWA 2R9UA 2UZYA 3WPDA 2ASSB 2WQXA 3W3NA
chains in the Genus database with same CATH topology
4R07A 3PMHG 2WFHA 4R5CA 3WPHA 2FT3A 4BSRA 4XOSA 4CP6A 3CIGA 3E6JA 2O6SA 2OMUA 3E4GA 5FTTB 2O6QA 2V9TB 5HDHA 4YEBB 1OTOA 4CC4C 1OGQA 2JE1A 5GS0A 2CA6A 3JB9j 1FS2A 4HQ1A 4V2EA 3ULVA 1O6TA 3G39A 1DCEA 2IFGA 2OMTA 4XSQA 4PEQB 5CMNA 1OZNA 2OMZA 4Z79A 2ASTB 2XOTA 2P1OB 5GMFA 5B0TA 1K5DC 3RW6A 4Q3IA 1PGVA 3G04C 4R6JA 1U0ND 3RFSA 4FCGA 2Z63A 4R6AA 2WQUA 5IJCA 2Q4GW 4LXSA 4PERA 4QBZA 1H6TA 2RR6A 3FXIA 4CC4A 3RW7A 3RIZA 5GS2B 4LXRA 3P72A 3WPIA 2ID5A 2JQDA 3O6NA 1LTXA 4L3FA 5GQRK 5LFNA 4Q3GA 2P1QB 4R6FA 4WYKA 1P8TA 4PQ8A 3RFJA 3RFEA 2P1NB 3VQ2A 4IM6A 3WN4A 3C6NB 4C2BB 4OQTA 4C2AB 2Z65A 4BV4R 1M9SA 3W3JA 1IO0A 4RCAB 4LI2A 5AZ5A 5D3IA 3WPFA 3ZYIA 1DS9A 4Q62A 1O6SA 4CILA 5AWBA 4H09A 4QXEA 4KT1A 1XKUA 3G06A 4R58A 4CNMA 1OTNA 2UZXA 4FD0A 2XWTC 3G3AA 4M7EC 1XECA 1OOKG 4G8AA 1K5GC 1XWDC 3DZEA 3W3KA 2Z7XA 3A79B 3UL7A 1M0ZA 3WPEA 1FO1A 3WPBA 2V9SA 1GWBA 1M9LA 2OMWA 4FHOA 4NKHA 4QC0A 4Z64C 1M10B 1D0BA 3C6OB 2Z7XB 1Z7XW 4R08A 5AWCA 4P8SA 4R0AA 5GMGA 3O53A 4BSSA 1FQVA 4LI1A 4U08A 1ZIWA 4RWTC 2V70A 3E3ZA 3ZYJA 4J4LA 4L3AA 4WP6A 4M7EA 4FS7A 4J0MA 3WPCA 3ULAA 2Z64A 4ECNA 4R6GA 3ZYNA 3M19A 4R09A 1A9NA 2P1MB 5B0NA 2O6RA 3RJ0A 4ARNA 4Y61B 4GLPA 4NKGA 4MQWX 5HZLB 4FDWA 1W8AA 4Z94G 4KXFB 1QYYA 3REZA 4PKIG 4TZHA 5A5CA 2Y5QA 4LSXC 4Z61C 1P8VA 3OGKB 3W3GA 3RGZA 2P1PB 3OGLB 5AWAA 2OMXA 3OJAA 1JL5A 3ULUA 2Z82A 1XEUA 4ARRA 5CMPA 1G9UA 3UN9A 1H6UA 2RA8A 1KOHA 3W3LA 2Z62A 3E2JA 3OJAB 3TSRE 2Z66A 4V2CA 3ZYOA 4UFRA 4MN8B 2ELLA 4U09A 2BEXA 1SQ0B 3BZ5A 1YRGA 4GT6A 2WQWA 1OTMA 3RGXA 4U06A 5B4PA 4I6JB 3GOZA 4XGOA 5IJBA 3SB4A 2OMYA 4LSXA 4LSCA 1FT8A 5IYXC 3KJ4A 4B8CD 1A4YA 4BSUA 4K17A 3UL8A 5AWDA 1KOOA 5GMHA 4P91A 2OMVA 3CVRA 3M18A 1XCDA 4Z8GA 3WPGA 3UL9A 1P9AG 2BNHA 4LSAA 3C6PB 4V2DA 4ECOA 3W3MA 3CIYA 1DFJI 3OGMB 2WQVA 1O6VA 2A0ZA 3G3BA 4AY9X 5IJDA 4KNGA 4R5DA 4CNCA 1WWLA 2Z81A 4AW4A 4PSJA 4U7LA 3VQ1A 4FMZA 4EZGA 2JE0A 4RCWA 2R9UA 2UZYA 3WPDA 2ASSB 2WQXA 3W3NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4R07 A;  3PMH G;  2WFH A;  4R5C A;  3WPH A;  2FT3 A;  4BSR A;  4XOS A;  4CP6 A;  3CIG A;  3E6J A;  2O6S A;  2OMU A;  3E4G A;  5FTT B;  2O6Q A;  2V9T B;  5HDH A;  4YEB B;  1OTO A;  4CC4 C;  1OGQ A;  2JE1 A;  5GS0 A;  2CA6 A;  3JB9 j;  1FS2 A;  4HQ1 A;  4V2E A;  3ULV A;  1O6T A;  3G39 A;  1DCE A;  2IFG A;  2OMT A;  4XSQ A;  4PEQ B;  5CMN A;  1OZN A;  2OMZ A;  4Z79 A;  2AST B;  2XOT A;  2P1O B;  5GMF A;  5B0T A;  1K5D C;  3RW6 A;  4Q3I A;  1PGV A;  3G04 C;  4R6J A;  1U0N D;  3RFS A;  4FCG A;  2Z63 A;  4R6A A;  2WQU A;  5IJC A;  2Q4G W;  4LXS A;  4PER A;  4QBZ A;  1H6T A;  2RR6 A;  3FXI A;  4CC4 A;  3RW7 A;  3RIZ A;  5GS2 B;  4LXR A;  3P72 A;  3WPI A;  2ID5 A;  2JQD A;  3O6N A;  1LTX A;  4L3F A;  5GQR K;  5LFN A;  4Q3G A;  2P1Q B;  4R6F A;  4WYK A;  1P8T A;  4PQ8 A;  3RFJ A;  3RFE A;  2P1N B;  3VQ2 A;  4IM6 A;  3WN4 A;  3C6N B;  4C2B B;  4OQT A;  4C2A B;  2Z65 A;  4BV4 R;  1M9S A;  3W3J A;  1IO0 A;  4RCA B;  4LI2 A;  5AZ5 A;  5D3I A;  3WPF A;  3ZYI A;  1DS9 A;  4Q62 A;  1O6S A;  4CIL A;  5AWB A;  4H09 A;  4QXE A;  4KT1 A;  1XKU A;  3G06 A;  4R58 A;  4CNM A;  1OTN A;  2UZX A;  4FD0 A;  2XWT C;  3G3A A;  4M7E C;  1XEC A;  1OOK G;  4G8A A;  1K5G C;  1XWD C;  3DZE A;  3W3K A;  2Z7X A;  3A79 B;  3UL7 A;  1M0Z A;  3WPE A;  1FO1 A;  3WPB A;  2V9S A;  1GWB A;  1M9L A;  2OMW A;  4FHO A;  4NKH A;  4QC0 A;  4Z64 C;  1M10 B;  1D0B A;  3C6O B;  2Z7X B;  1Z7X W;  4R08 A;  5AWC A;  4P8S A;  4R0A A;  5GMG A;  3O53 A;  4BSS A;  1FQV A;  4LI1 A;  4U08 A;  1ZIW A;  4RWT C;  2V70 A;  3E3Z A;  3ZYJ A;  4J4L A;  4L3A A;  4WP6 A;  4M7E A;  4FS7 A;  4J0M A;  3WPC A;  3ULA A;  2Z64 A;  4ECN A;  4R6G A;  3ZYN A;  3M19 A;  4R09 A;  1A9N A;  2P1M B;  5B0N A;  2O6R A;  3RJ0 A;  4ARN A;  4Y61 B;  4GLP A;  4NKG A;  4MQW X;  5HZL B;  4FDW A;  1W8A A;  4Z94 G;  4KXF B;  1QYY A;  3REZ A;  4PKI G;  4TZH A;  5A5C A;  2Y5Q A;  4LSX C;  4Z61 C;  1P8V A;  3OGK B;  3W3G A;  3RGZ A;  2P1P B;  3OGL B;  5AWA A;  2OMX A;  3OJA A;  1JL5 A;  3ULU A;  2Z82 A;  1XEU A;  4ARR A;  5CMP A;  1G9U A;  3UN9 A;  1H6U A;  2RA8 A;  1KOH A;  3W3L A;  2Z62 A;  3E2J A;  3OJA B;  3TSR E;  2Z66 A;  4V2C A;  3ZYO A;  4UFR A;  4MN8 B;  2ELL A;  4U09 A;  2BEX A;  1SQ0 B;  3BZ5 A;  1YRG A;  4GT6 A;  2WQW A;  1OTM A;  3RGX A;  4U06 A;  5B4P A;  4I6J B;  3GOZ A;  4XGO A;  5IJB A;  3SB4 A;  2OMY A;  4LSX A;  4LSC A;  1FT8 A;  5IYX C;  3KJ4 A;  4B8C D;  1A4Y A;  4BSU A;  4K17 A;  3UL8 A;  5AWD A;  1KOO A;  5GMH A;  4P91 A;  2OMV A;  3CVR A;  3M18 A;  1XCD A;  4Z8G A;  3WPG A;  3UL9 A;  1P9A G;  2BNH A;  4LSA A;  3C6P B;  4V2D A;  4ECO A;  3W3M A;  3CIY A;  1DFJ I;  3OGM B;  2WQV A;  1O6V A;  2A0Z A;  3G3B A;  4AY9 X;  5IJD A;  4KNG A;  4R5D A;  4CNC A;  1WWL A;  2Z81 A;  4AW4 A;  4PSJ A;  4U7L A;  3VQ1 A;  4FMZ A;  4EZG A;  2JE0 A;  4RCW A;  2R9U A;  2UZY A;  3WPD A;  2ASS B;  2WQX A;  3W3N A; 
#chains in the Genus database with same CATH topology
 4R07 A;  3PMH G;  2WFH A;  4R5C A;  3WPH A;  2FT3 A;  4BSR A;  4XOS A;  4CP6 A;  3CIG A;  3E6J A;  2O6S A;  2OMU A;  3E4G A;  5FTT B;  2O6Q A;  2V9T B;  5HDH A;  4YEB B;  1OTO A;  4CC4 C;  1OGQ A;  2JE1 A;  5GS0 A;  2CA6 A;  3JB9 j;  4NZT M;  1FS2 A;  4HQ1 A;  4V2E A;  3ULV A;  1O6T A;  3G39 A;  1DCE A;  2IFG A;  2OMT A;  4XSQ A;  4PEQ B;  5CMN A;  1OZN A;  2OMZ A;  4Z79 A;  2AST B;  2XOT A;  2P1O B;  5GMF A;  5B0T A;  1K5D C;  3RW6 A;  4Q3I A;  1PGV A;  3G04 C;  4R6J A;  1U0N D;  3RFS A;  4FCG A;  2Z63 A;  4R6A A;  2WQU A;  5IJC A;  2Q4G W;  4LXS A;  4PER A;  4QBZ A;  1H6T A;  2RR6 A;  3FXI A;  4CC4 A;  3RW7 A;  3RIZ A;  5GS2 B;  4LXR A;  3P72 A;  3WPI A;  2ID5 A;  2JQD A;  3O6N A;  1LTX A;  4L3F A;  5GQR K;  5LFN A;  4Q3G A;  2P1Q B;  4R6F A;  4WYK A;  1P8T A;  4PQ8 A;  3RFJ A;  3RFE A;  2P1N B;  3VQ2 A;  4IM6 A;  3WN4 A;  3C6N B;  4NZR M;  4C2B B;  4OQT A;  4C2A B;  2Z65 A;  4BV4 R;  1M9S A;  3W3J A;  1IO0 A;  4RCA B;  4LI2 A;  5AZ5 A;  5D3I A;  3WPF A;  3ZYI A;  1DS9 A;  4Q62 A;  1O6S A;  4CIL A;  5AWB A;  4H09 A;  4QXE A;  4KT1 A;  1XKU A;  3G06 A;  4R58 A;  4CNM A;  1OTN A;  2UZX A;  4FD0 A;  2XWT C;  3G3A A;  4M7E C;  1XEC A;  1OOK G;  4G8A A;  1K5G C;  1XWD C;  3DZE A;  3W3K A;  2Z7X A;  3A79 B;  3UL7 A;  1M0Z A;  3WPE A;  1FO1 A;  3WPB A;  2V9S A;  1GWB A;  1M9L A;  2OMW A;  4FHO A;  4NKH A;  4QC0 A;  4Z64 C;  1M10 B;  1D0B A;  3C6O B;  2Z7X B;  1Z7X W;  4R08 A;  5AWC A;  4P8S A;  4R0A A;  5GMG A;  3O53 A;  4BSS A;  1FQV A;  4LI1 A;  4U08 A;  1ZIW A;  4RWT C;  2V70 A;  3E3Z A;  3ZYJ A;  4J4L A;  4L3A A;  4WP6 A;  4M7E A;  4FS7 A;  4J0M A;  3WPC A;  3ULA A;  2Z64 A;  4ECN A;  4R6G A;  3ZYN A;  3M19 A;  4R09 A;  1A9N A;  2P1M B;  5B0N A;  2O6R A;  3RJ0 A;  4ARN A;  4Y61 B;  4GLP A;  4NKG A;  4MQW X;  5HZL B;  4FDW A;  1W8A A;  4Z94 G;  4KXF B;  1QYY A;  3REZ A;  4PKI G;  4TZH A;  5A5C A;  2Y5Q A;  4LSX C;  4Z61 C;  1P8V A;  3OGK B;  3W3G A;  3RGZ A;  2P1P B;  3OGL B;  5AWA A;  2OMX A;  3OJA A;  1JL5 A;  3ULU A;  2Z82 A;  1XEU A;  4ARR A;  5CMP A;  1G9U A;  3UN9 A;  1H6U A;  2RA8 A;  1KOH A;  3W3L A;  2Z62 A;  3E2J A;  3OJA B;  3TSR E;  2Z66 A;  4V2C A;  3ZYO A;  4UFR A;  4MN8 B;  2ELL A;  4U09 A;  2BEX A;  1SQ0 B;  3BZ5 A;  1YRG A;  4GT6 A;  2WQW A;  1OTM A;  3RGX A;  4U06 A;  5B4P A;  4I6J B;  3GOZ A;  4XGO A;  5IJB A;  3SB4 A;  2OMY A;  4LSX A;  4LSC A;  1FT8 A;  5IYX C;  3KJ4 A;  4B8C D;  1A4Y A;  4BSU A;  4K17 A;  3UL8 A;  5AWD A;  1KOO A;  5GMH A;  4P91 A;  2OMV A;  3CVR A;  3M18 A;  1XCD A;  4Z8G A;  3WPG A;  3UL9 A;  1P9A G;  2BNH A;  4LSA A;  3C6P B;  4V2D A;  4ECO A;  3W3M A;  3CIY A;  1DFJ I;  3OGM B;  2WQV A;  1O6V A;  2A0Z A;  3G3B A;  4AY9 X;  5IJD A;  4KNG A;  4R5D A;  4CNC A;  1WWL A;  2Z81 A;  4AW4 A;  4PSJ A;  4U7L A;  3VQ1 A;  4FMZ A;  4EZG A;  2JE0 A;  4RCW A;  2R9U A;  2UZY A;  3WPD A;  2ASS B;  2WQX A;  3W3N A; 
#chains in the Genus database with same CATH homology
 4R07 A;  3PMH G;  2WFH A;  4R5C A;  3WPH A;  2FT3 A;  4BSR A;  4XOS A;  4CP6 A;  3CIG A;  3E6J A;  2O6S A;  2OMU A;  3E4G A;  5FTT B;  2O6Q A;  2V9T B;  5HDH A;  4YEB B;  1OTO A;  4CC4 C;  1OGQ A;  2JE1 A;  5GS0 A;  2CA6 A;  3JB9 j;  1FS2 A;  4HQ1 A;  4V2E A;  3ULV A;  1O6T A;  3G39 A;  1DCE A;  2IFG A;  2OMT A;  4XSQ A;  4PEQ B;  5CMN A;  1OZN A;  2OMZ A;  4Z79 A;  2AST B;  2XOT A;  2P1O B;  5GMF A;  5B0T A;  1K5D C;  3RW6 A;  4Q3I A;  1PGV A;  3G04 C;  4R6J A;  1U0N D;  3RFS A;  4FCG A;  2Z63 A;  4R6A A;  2WQU A;  5IJC A;  2Q4G W;  4LXS A;  4PER A;  4QBZ A;  1H6T A;  2RR6 A;  3FXI A;  4CC4 A;  3RW7 A;  3RIZ A;  5GS2 B;  4LXR A;  3P72 A;  3WPI A;  2ID5 A;  2JQD A;  3O6N A;  1LTX A;  4L3F A;  5GQR K;  5LFN A;  4Q3G A;  2P1Q B;  4R6F A;  4WYK A;  1P8T A;  4PQ8 A;  3RFJ A;  3RFE A;  2P1N B;  3VQ2 A;  4IM6 A;  3WN4 A;  3C6N B;  4C2B B;  4OQT A;  4C2A B;  2Z65 A;  4BV4 R;  1M9S A;  3W3J A;  1IO0 A;  4RCA B;  4LI2 A;  5AZ5 A;  5D3I A;  3WPF A;  3ZYI A;  1DS9 A;  4Q62 A;  1O6S A;  4CIL A;  5AWB A;  4H09 A;  4QXE A;  4KT1 A;  1XKU A;  3G06 A;  4R58 A;  4CNM A;  1OTN A;  2UZX A;  4FD0 A;  2XWT C;  3G3A A;  4M7E C;  1XEC A;  1OOK G;  4G8A A;  1K5G C;  1XWD C;  3DZE A;  3W3K A;  2Z7X A;  3A79 B;  3UL7 A;  1M0Z A;  3WPE A;  1FO1 A;  3WPB A;  2V9S A;  1GWB A;  1M9L A;  2OMW A;  4FHO A;  4NKH A;  4QC0 A;  4Z64 C;  1M10 B;  1D0B A;  3C6O B;  2Z7X B;  1Z7X W;  4R08 A;  5AWC A;  4P8S A;  4R0A A;  5GMG A;  3O53 A;  4BSS A;  1FQV A;  4LI1 A;  4U08 A;  1ZIW A;  4RWT C;  2V70 A;  3E3Z A;  3ZYJ A;  4J4L A;  4L3A A;  4WP6 A;  4M7E A;  4FS7 A;  4J0M A;  3WPC A;  3ULA A;  2Z64 A;  4ECN A;  4R6G A;  3ZYN A;  3M19 A;  4R09 A;  1A9N A;  2P1M B;  5B0N A;  2O6R A;  3RJ0 A;  4ARN A;  4Y61 B;  4GLP A;  4NKG A;  4MQW X;  5HZL B;  4FDW A;  1W8A A;  4Z94 G;  4KXF B;  1QYY A;  3REZ A;  4PKI G;  4TZH A;  5A5C A;  2Y5Q A;  4LSX C;  4Z61 C;  1P8V A;  3OGK B;  3W3G A;  3RGZ A;  2P1P B;  3OGL B;  5AWA A;  2OMX A;  3OJA A;  1JL5 A;  3ULU A;  2Z82 A;  1XEU A;  4ARR A;  5CMP A;  1G9U A;  3UN9 A;  1H6U A;  2RA8 A;  1KOH A;  3W3L A;  2Z62 A;  3E2J A;  3OJA B;  3TSR E;  2Z66 A;  4V2C A;  3ZYO A;  4UFR A;  4MN8 B;  2ELL A;  4U09 A;  2BEX A;  1SQ0 B;  3BZ5 A;  1YRG A;  4GT6 A;  2WQW A;  1OTM A;  3RGX A;  4U06 A;  5B4P A;  4I6J B;  3GOZ A;  4XGO A;  5IJB A;  3SB4 A;  2OMY A;  4LSX A;  4LSC A;  1FT8 A;  5IYX C;  3KJ4 A;  4B8C D;  1A4Y A;  4BSU A;  4K17 A;  3UL8 A;  5AWD A;  1KOO A;  5GMH A;  4P91 A;  2OMV A;  3CVR A;  3M18 A;  1XCD A;  4Z8G A;  3WPG A;  3UL9 A;  1P9A G;  2BNH A;  4LSA A;  3C6P B;  4V2D A;  4ECO A;  3W3M A;  3CIY A;  1DFJ I;  3OGM B;  2WQV A;  1O6V A;  2A0Z A;  3G3B A;  4AY9 X;  5IJD A;  4KNG A;  4R5D A;  4CNC A;  1WWL A;  2Z81 A;  4AW4 A;  4PSJ A;  4U7L A;  3VQ1 A;  4FMZ A;  4EZG A;  2JE0 A;  4RCW A;  2R9U A;  2UZY A;  3WPD A;  2ASS B;  2WQX A;  3W3N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...