1A9NA

Crystal structure of the spliceosomal u2b''-u2a' protein complex bound to a fragment of u2 small nuclear rna
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
162
structure length
162
Chain Sequence
VKLTAELIEQAAQYTNAVRDRELDLRGYKIPVIENLGATLDQFDAIDFSDNEIRKLDGFPLLRRLKTLLVNNNRICRIGEGLDQALPDLTELILTNNSLVELGDLDPLASLKSLTYLCILRNPVTNKKHYRLYVIYKVPQVRVLDFQKVKLKERQEAEKMFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein/rna
molecule keywords RNA (5'-R(*CP*CP*UP*GP*GP*UP*AP*UP*UP*GP*CP*AP*GP*UP*AP*CP*C
publication title Crystal structure of the spliceosomal U2B"-U2A' protein complex bound to a fragment of U2 small nuclear RNA.
pubmed doi rcsb
source organism Homo sapiens
total genus 55
structure length 162
sequence length 162
chains with identical sequence C
ec nomenclature
pdb deposition date 1998-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14580 LRR_9 Leucine-rich repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 1a9nA00
3G3BA 2Z66A 1P8VA 3WPDA 3RGXA 1K5GC 1KOOA 4KNGA 3JB9j 1OGQA 1OTMA 4ARRA 2Z65A 2WQVA 4R6FA 4KT1A 3BZ5A 4B8CD 4XSQA 4ECOA 4G8AA 3TSRE 5A5CA 5AWBA 4L3FA 2P1QB 4WP6A 2Z7XA 3G3AA 4LSCA 4GLPA 2OMWA 2FT3A 2OMVA 4LSAA 3WPFA 4ECNA 3SB4A 1H6UA 4CNMA 2XOTA 4R5DA 5CMNA 4KXFB 3W3NA 4LSXA 4PQ8A 4RCAB 1M0ZA 1SQ0B 1W8AA 1O6VA 3E2JA 1FQVA 4CILA 4WYKA 3G39A 5GS0A 4Z94G 3REZA 2OMTA 5D3IA 1IO0A 3W3MA 4R08A 4ARNA 4MQWX 4FHOA 1QYYA 4BSSA 1PGVA 4FMZA 2BEXA 2A0ZA 1GWBA 4YEBB 3RW6A 4FS7A 1P9AG 4UFRA 3CIYA 3M19A 5GMGA 2O6QA 1Z7XW 3RIZA 4V2CA 2OMYA 2WQXA 1KOHA 2JE1A 3WPEA 2WFHA 5GS2B 4R6GA 1M9LA 4IM6A 2UZYA 2V70A 1DCEA 4QC0A 1G9UA 1OTOA 4LXRA 4QXEA 2RA8A 3OJAB 3W3GA 3FXIA 4Z61C 3ZYJA 3DZEA 2IFGA 2OMZA 4V2EA 1DS9A 2P1OB 3A79B 2ID5A 5AWDA 3WPHA 3E4GA 5GQRK 4Q3IA 1A9NA 2R9UA 2UZXA 5HZLB 4RCWA 4AW4A 4QBZA 3C6OB 3WPGA 3E6JA 5B0TA 4BV4R 2P1NB 1XWDC 4V2DA 1OZNA 4Q3GA 4XOSA 4AY9X 4Y61B 3ZYOA 4LI1A 3WPCA 4U08A 2O6RA 5AWCA 2Z82A 3W3KA 2Y5QA 1FS2A 3ULAA 2OMXA 1D0BA 5CMPA 2WQWA 1FT8A 3RW7A 3ZYIA 3RFSA 5B4PA 1K5DC 2ASSB 2Z63A 1ZIWA 2P1MB 4FCGA 4P91A 3PMHG 4J4LA 3P72A 5FTTB 2CA6A 1A4YA 4TZHA 4J0MA 4EZGA 2BNHA 5HDHA 4FD0A 4FDWA 1O6SA 2V9TB 3GOZA 3G04C 4M7EA 4BSRA 4I6JB 5GMFA 3UL7A 1JL5A 3OJAA 3UL8A 3CVRA 3RFEA 5LFNA 1P8TA 4U06A 3OGLB 5IYXC 4LXSA 4C2BB 4R6JA 4Q62A 1XECA 4MN8B 3O6NA 2WQUA 4R6AA 2OMUA 3WPBA 1WWLA 3ULVA 4U09A 4C2AB 1OTNA 2JQDA 4Z8GA 1H6TA 4M7EC 4CP6A 3VQ1A 3W3LA 4CC4C 4L3AA 4R58A 4P8SA 4CNCA 3M18A 3RGZA 4LI2A 3ZYNA 5AZ5A 4XGOA 2JE0A 4Z64C 2Z7XB 1XCDA 2V9SA 3UN9A 3O53A 4OQTA 3RFJA 4H09A 1M9SA 1M10B 5IJCA 4RWTC 4PERA 3CIGA 4K17A 4GT6A 4NKGA 4R5CA 2Q4GW 2P1PB 4Z79A 3ULUA 1O6TA 4NKHA 2Z81A 5AWAA 1LTXA 5B0NA 3VQ2A 4R0AA 4R07A 2ELLA 1XEUA 4PSJA 4HQ1A 5IJDA 3RJ0A 4PEQB 4R09A 1YRGA 2Z62A 3C6PB 1DFJI 3UL9A 2Z64A 3C6NB 1U0ND 2RR6A 5IJBA 3KJ4A 3E3ZA 2ASTB 1XKUA 4U7LA 5GMHA 3WPIA 2O6SA 3OGKB 3WN4A 4CC4A 2XWTC 4BSUA 1OOKG 4LSXC 3G06A 4PKIG 3W3JA 1FO1A 3OGMB
chains in the Genus database with same CATH superfamily
3G3BA 2Z66A 1P8VA 3WPDA 3RGXA 1K5GC 1KOOA 4KNGA 3JB9j 1OGQA 1OTMA 4ARRA 2Z65A 2WQVA 4R6FA 4KT1A 3BZ5A 4B8CD 4XSQA 4ECOA 4G8AA 3TSRE 5A5CA 5AWBA 4L3FA 2P1QB 4WP6A 2Z7XA 3G3AA 4LSCA 4GLPA 2OMWA 2FT3A 2OMVA 4LSAA 3WPFA 4ECNA 3SB4A 1H6UA 4CNMA 2XOTA 4R5DA 5CMNA 4KXFB 3W3NA 4LSXA 4PQ8A 4RCAB 1M0ZA 1SQ0B 1W8AA 1O6VA 3E2JA 1FQVA 4CILA 4WYKA 3G39A 5GS0A 4Z94G 3REZA 2OMTA 5D3IA 1IO0A 3W3MA 4R08A 4ARNA 4MQWX 4FHOA 1QYYA 4BSSA 1PGVA 4FMZA 2BEXA 2A0ZA 1GWBA 4YEBB 3RW6A 4FS7A 1P9AG 4UFRA 3CIYA 3M19A 5GMGA 2O6QA 1Z7XW 3RIZA 4V2CA 2OMYA 2WQXA 1KOHA 2JE1A 4NZTM 3WPEA 2WFHA 5GS2B 4NZRM 4R6GA 1M9LA 4IM6A 2UZYA 2V70A 1DCEA 4QC0A 1G9UA 1OTOA 4LXRA 4QXEA 2RA8A 3OJAB 3W3GA 3FXIA 4Z61C 3ZYJA 3DZEA 2IFGA 2OMZA 4V2EA 1DS9A 2P1OB 3A79B 2ID5A 5AWDA 3WPHA 3E4GA 5GQRK 4Q3IA 1A9NA 2R9UA 2UZXA 5HZLB 4RCWA 4AW4A 4QBZA 3C6OB 3WPGA 3E6JA 5B0TA 4BV4R 2P1NB 1XWDC 4V2DA 1OZNA 4Q3GA 4XOSA 4AY9X 4Y61B 3ZYOA 4LI1A 3WPCA 4U08A 2O6RA 5AWCA 2Z82A 3W3KA 2Y5QA 1FS2A 3ULAA 2OMXA 1D0BA 5CMPA 2WQWA 1FT8A 3RW7A 3ZYIA 3RFSA 5B4PA 1K5DC 2ASSB 2Z63A 1ZIWA 2P1MB 4FCGA 4P91A 3PMHG 4J4LA 3P72A 5FTTB 2CA6A 1A4YA 4TZHA 4J0MA 4EZGA 2BNHA 5HDHA 4FD0A 4FDWA 1O6SA 2V9TB 3GOZA 3G04C 4M7EA 4BSRA 4I6JB 5GMFA 3UL7A 1JL5A 3OJAA 3UL8A 3CVRA 3RFEA 5LFNA 1P8TA 4U06A 3OGLB 5IYXC 4LXSA 4C2BB 4R6JA 4Q62A 1XECA 4MN8B 3O6NA 2WQUA 4R6AA 2OMUA 3WPBA 1WWLA 3ULVA 4U09A 4C2AB 1OTNA 2JQDA 4Z8GA 1H6TA 4M7EC 4CP6A 3VQ1A 3W3LA 4CC4C 4L3AA 4R58A 4P8SA 4CNCA 3M18A 3RGZA 4LI2A 3ZYNA 5AZ5A 4XGOA 2JE0A 4Z64C 2Z7XB 1XCDA 2V9SA 3UN9A 3O53A 4OQTA 3RFJA 4H09A 1M9SA 1M10B 5IJCA 4RWTC 4PERA 3CIGA 4K17A 4GT6A 4NKGA 4R5CA 2Q4GW 2P1PB 4Z79A 3ULUA 1O6TA 4NKHA 2Z81A 5AWAA 1LTXA 5B0NA 3VQ2A 4R0AA 4R07A 2ELLA 1XEUA 4PSJA 4HQ1A 5IJDA 3RJ0A 4PEQB 4R09A 1YRGA 2Z62A 3C6PB 1DFJI 3UL9A 2Z64A 3C6NB 1U0ND 2RR6A 5IJBA 3KJ4A 3E3ZA 2ASTB 1XKUA 4U7LA 5GMHA 3WPIA 2O6SA 3OGKB 3WN4A 4CC4A 2XWTC 4BSUA 1OOKG 4LSXC 3G06A 4PKIG 3W3JA 1FO1A 3OGMB
chains in the Genus database with same CATH topology
3G3BA 2Z66A 1P8VA 3WPDA 3RGXA 1K5GC 1KOOA 4KNGA 3JB9j 1OGQA 1OTMA 4ARRA 2Z65A 2WQVA 4R6FA 4KT1A 3BZ5A 4B8CD 4XSQA 4ECOA 4G8AA 3TSRE 5A5CA 5AWBA 4L3FA 2P1QB 4WP6A 2Z7XA 3G3AA 4LSCA 4GLPA 2OMWA 2FT3A 2OMVA 4LSAA 3WPFA 4ECNA 3SB4A 1H6UA 4CNMA 2XOTA 4R5DA 5CMNA 4KXFB 3W3NA 4LSXA 4PQ8A 4RCAB 1M0ZA 1SQ0B 1W8AA 1O6VA 3E2JA 1FQVA 4CILA 4WYKA 3G39A 5GS0A 4Z94G 3REZA 2OMTA 5D3IA 1IO0A 3W3MA 4R08A 4ARNA 4MQWX 4FHOA 1QYYA 4BSSA 1PGVA 4FMZA 2BEXA 2A0ZA 1GWBA 4YEBB 3RW6A 4FS7A 1P9AG 4UFRA 3CIYA 3M19A 5GMGA 2O6QA 1Z7XW 3RIZA 4V2CA 2OMYA 2WQXA 1KOHA 2JE1A 3WPEA 2WFHA 5GS2B 4R6GA 1M9LA 4IM6A 2UZYA 2V70A 1DCEA 4QC0A 1G9UA 1OTOA 4LXRA 4QXEA 2RA8A 3OJAB 3W3GA 3FXIA 4Z61C 3ZYJA 3DZEA 2IFGA 2OMZA 4V2EA 1DS9A 2P1OB 3A79B 2ID5A 5AWDA 3WPHA 3E4GA 5GQRK 4Q3IA 1A9NA 2R9UA 2UZXA 5HZLB 4RCWA 4AW4A 4QBZA 3C6OB 3WPGA 3E6JA 5B0TA 4BV4R 2P1NB 1XWDC 4V2DA 1OZNA 4Q3GA 4XOSA 4AY9X 4Y61B 3ZYOA 4LI1A 3WPCA 4U08A 2O6RA 5AWCA 2Z82A 3W3KA 2Y5QA 1FS2A 3ULAA 2OMXA 1D0BA 5CMPA 2WQWA 1FT8A 3RW7A 3ZYIA 3RFSA 5B4PA 1K5DC 2ASSB 2Z63A 1ZIWA 2P1MB 4FCGA 4P91A 3PMHG 4J4LA 3P72A 5FTTB 2CA6A 1A4YA 4TZHA 4J0MA 4EZGA 2BNHA 5HDHA 4FD0A 4FDWA 1O6SA 2V9TB 3GOZA 3G04C 4M7EA 4BSRA 4I6JB 5GMFA 3UL7A 1JL5A 3OJAA 3UL8A 3CVRA 3RFEA 5LFNA 1P8TA 4U06A 3OGLB 5IYXC 4LXSA 4C2BB 4R6JA 4Q62A 1XECA 4MN8B 3O6NA 2WQUA 4R6AA 2OMUA 3WPBA 1WWLA 3ULVA 4U09A 4C2AB 1OTNA 2JQDA 4Z8GA 1H6TA 4M7EC 4CP6A 3VQ1A 3W3LA 4CC4C 4L3AA 4R58A 4P8SA 4CNCA 3M18A 3RGZA 4LI2A 3ZYNA 5AZ5A 4XGOA 2JE0A 4Z64C 2Z7XB 1XCDA 2V9SA 3UN9A 3O53A 4OQTA 3RFJA 4H09A 1M9SA 1M10B 5IJCA 4RWTC 4PERA 3CIGA 4K17A 4GT6A 4NKGA 4R5CA 2Q4GW 2P1PB 4Z79A 3ULUA 1O6TA 4NKHA 2Z81A 5AWAA 1LTXA 5B0NA 3VQ2A 4R0AA 4R07A 2ELLA 1XEUA 4PSJA 4HQ1A 5IJDA 3RJ0A 4PEQB 4R09A 1YRGA 2Z62A 3C6PB 1DFJI 3UL9A 2Z64A 3C6NB 1U0ND 2RR6A 5IJBA 3KJ4A 3E3ZA 2ASTB 1XKUA 4U7LA 5GMHA 3WPIA 2O6SA 3OGKB 3WN4A 4CC4A 2XWTC 4BSUA 1OOKG 4LSXC 3G06A 4PKIG 3W3JA 1FO1A 3OGMB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3G3B A;  2Z66 A;  1P8V A;  3WPD A;  3RGX A;  1K5G C;  1KOO A;  4KNG A;  3JB9 j;  1OGQ A;  1OTM A;  4ARR A;  2Z65 A;  2WQV A;  4R6F A;  4KT1 A;  3BZ5 A;  4B8C D;  4XSQ A;  4ECO A;  4G8A A;  3TSR E;  5A5C A;  5AWB A;  4L3F A;  2P1Q B;  4WP6 A;  2Z7X A;  3G3A A;  4LSC A;  4GLP A;  2OMW A;  2FT3 A;  2OMV A;  4LSA A;  3WPF A;  4ECN A;  3SB4 A;  1H6U A;  4CNM A;  2XOT A;  4R5D A;  5CMN A;  4KXF B;  3W3N A;  4LSX A;  4PQ8 A;  4RCA B;  1M0Z A;  1SQ0 B;  1W8A A;  1O6V A;  3E2J A;  1FQV A;  4CIL A;  4WYK A;  3G39 A;  5GS0 A;  4Z94 G;  3REZ A;  2OMT A;  5D3I A;  1IO0 A;  3W3M A;  4R08 A;  4ARN A;  4MQW X;  4FHO A;  1QYY A;  4BSS A;  1PGV A;  4FMZ A;  2BEX A;  2A0Z A;  1GWB A;  4YEB B;  3RW6 A;  4FS7 A;  1P9A G;  4UFR A;  3CIY A;  3M19 A;  5GMG A;  2O6Q A;  1Z7X W;  3RIZ A;  4V2C A;  2OMY A;  2WQX A;  1KOH A;  2JE1 A;  3WPE A;  2WFH A;  5GS2 B;  4R6G A;  1M9L A;  4IM6 A;  2UZY A;  2V70 A;  1DCE A;  4QC0 A;  1G9U A;  1OTO A;  4LXR A;  4QXE A;  2RA8 A;  3OJA B;  3W3G A;  3FXI A;  4Z61 C;  3ZYJ A;  3DZE A;  2IFG A;  2OMZ A;  4V2E A;  1DS9 A;  2P1O B;  3A79 B;  2ID5 A;  5AWD A;  3WPH A;  3E4G A;  5GQR K;  4Q3I A;  1A9N A;  2R9U A;  2UZX A;  5HZL B;  4RCW A;  4AW4 A;  4QBZ A;  3C6O B;  3WPG A;  3E6J A;  5B0T A;  4BV4 R;  2P1N B;  1XWD C;  4V2D A;  1OZN A;  4Q3G A;  4XOS A;  4AY9 X;  4Y61 B;  3ZYO A;  4LI1 A;  3WPC A;  4U08 A;  2O6R A;  5AWC A;  2Z82 A;  3W3K A;  2Y5Q A;  1FS2 A;  3ULA A;  2OMX A;  1D0B A;  5CMP A;  2WQW A;  1FT8 A;  3RW7 A;  3ZYI A;  3RFS A;  5B4P A;  1K5D C;  2ASS B;  2Z63 A;  1ZIW A;  2P1M B;  4FCG A;  4P91 A;  3PMH G;  4J4L A;  3P72 A;  5FTT B;  2CA6 A;  1A4Y A;  4TZH A;  4J0M A;  4EZG A;  2BNH A;  5HDH A;  4FD0 A;  4FDW A;  1O6S A;  2V9T B;  3GOZ A;  3G04 C;  4M7E A;  4BSR A;  4I6J B;  5GMF A;  3UL7 A;  1JL5 A;  3OJA A;  3UL8 A;  3CVR A;  3RFE A;  5LFN A;  1P8T A;  4U06 A;  3OGL B;  5IYX C;  4LXS A;  4C2B B;  4R6J A;  4Q62 A;  1XEC A;  4MN8 B;  3O6N A;  2WQU A;  4R6A A;  2OMU A;  3WPB A;  1WWL A;  3ULV A;  4U09 A;  4C2A B;  1OTN A;  2JQD A;  4Z8G A;  1H6T A;  4M7E C;  4CP6 A;  3VQ1 A;  3W3L A;  4CC4 C;  4L3A A;  4R58 A;  4P8S A;  4CNC A;  3M18 A;  3RGZ A;  4LI2 A;  3ZYN A;  5AZ5 A;  4XGO A;  2JE0 A;  4Z64 C;  2Z7X B;  1XCD A;  2V9S A;  3UN9 A;  3O53 A;  4OQT A;  3RFJ A;  4H09 A;  1M9S A;  1M10 B;  5IJC A;  4RWT C;  4PER A;  3CIG A;  4K17 A;  4GT6 A;  4NKG A;  4R5C A;  2Q4G W;  2P1P B;  4Z79 A;  3ULU A;  1O6T A;  4NKH A;  2Z81 A;  5AWA A;  1LTX A;  5B0N A;  3VQ2 A;  4R0A A;  4R07 A;  2ELL A;  1XEU A;  4PSJ A;  4HQ1 A;  5IJD A;  3RJ0 A;  4PEQ B;  4R09 A;  1YRG A;  2Z62 A;  3C6P B;  1DFJ I;  3UL9 A;  2Z64 A;  3C6N B;  1U0N D;  2RR6 A;  5IJB A;  3KJ4 A;  3E3Z A;  2AST B;  1XKU A;  4U7L A;  5GMH A;  3WPI A;  2O6S A;  3OGK B;  3WN4 A;  4CC4 A;  2XWT C;  4BSU A;  1OOK G;  4LSX C;  3G06 A;  4PKI G;  3W3J A;  1FO1 A;  3OGM B; 
#chains in the Genus database with same CATH topology
 3G3B A;  2Z66 A;  1P8V A;  3WPD A;  3RGX A;  1K5G C;  1KOO A;  4KNG A;  3JB9 j;  1OGQ A;  1OTM A;  4ARR A;  2Z65 A;  2WQV A;  4R6F A;  4KT1 A;  3BZ5 A;  4B8C D;  4XSQ A;  4ECO A;  4G8A A;  3TSR E;  5A5C A;  5AWB A;  4L3F A;  2P1Q B;  4WP6 A;  2Z7X A;  3G3A A;  4LSC A;  4GLP A;  2OMW A;  2FT3 A;  2OMV A;  4LSA A;  3WPF A;  4ECN A;  3SB4 A;  1H6U A;  4CNM A;  2XOT A;  4R5D A;  5CMN A;  4KXF B;  3W3N A;  4LSX A;  4PQ8 A;  4RCA B;  1M0Z A;  1SQ0 B;  1W8A A;  1O6V A;  3E2J A;  1FQV A;  4CIL A;  4WYK A;  3G39 A;  5GS0 A;  4Z94 G;  3REZ A;  2OMT A;  5D3I A;  1IO0 A;  3W3M A;  4R08 A;  4ARN A;  4MQW X;  4FHO A;  1QYY A;  4BSS A;  1PGV A;  4FMZ A;  2BEX A;  2A0Z A;  1GWB A;  4YEB B;  3RW6 A;  4FS7 A;  1P9A G;  4UFR A;  3CIY A;  3M19 A;  5GMG A;  2O6Q A;  1Z7X W;  3RIZ A;  4V2C A;  2OMY A;  2WQX A;  1KOH A;  2JE1 A;  4NZT M;  3WPE A;  2WFH A;  5GS2 B;  4NZR M;  4R6G A;  1M9L A;  4IM6 A;  2UZY A;  2V70 A;  1DCE A;  4QC0 A;  1G9U A;  1OTO A;  4LXR A;  4QXE A;  2RA8 A;  3OJA B;  3W3G A;  3FXI A;  4Z61 C;  3ZYJ A;  3DZE A;  2IFG A;  2OMZ A;  4V2E A;  1DS9 A;  2P1O B;  3A79 B;  2ID5 A;  5AWD A;  3WPH A;  3E4G A;  5GQR K;  4Q3I A;  1A9N A;  2R9U A;  2UZX A;  5HZL B;  4RCW A;  4AW4 A;  4QBZ A;  3C6O B;  3WPG A;  3E6J A;  5B0T A;  4BV4 R;  2P1N B;  1XWD C;  4V2D A;  1OZN A;  4Q3G A;  4XOS A;  4AY9 X;  4Y61 B;  3ZYO A;  4LI1 A;  3WPC A;  4U08 A;  2O6R A;  5AWC A;  2Z82 A;  3W3K A;  2Y5Q A;  1FS2 A;  3ULA A;  2OMX A;  1D0B A;  5CMP A;  2WQW A;  1FT8 A;  3RW7 A;  3ZYI A;  3RFS A;  5B4P A;  1K5D C;  2ASS B;  2Z63 A;  1ZIW A;  2P1M B;  4FCG A;  4P91 A;  3PMH G;  4J4L A;  3P72 A;  5FTT B;  2CA6 A;  1A4Y A;  4TZH A;  4J0M A;  4EZG A;  2BNH A;  5HDH A;  4FD0 A;  4FDW A;  1O6S A;  2V9T B;  3GOZ A;  3G04 C;  4M7E A;  4BSR A;  4I6J B;  5GMF A;  3UL7 A;  1JL5 A;  3OJA A;  3UL8 A;  3CVR A;  3RFE A;  5LFN A;  1P8T A;  4U06 A;  3OGL B;  5IYX C;  4LXS A;  4C2B B;  4R6J A;  4Q62 A;  1XEC A;  4MN8 B;  3O6N A;  2WQU A;  4R6A A;  2OMU A;  3WPB A;  1WWL A;  3ULV A;  4U09 A;  4C2A B;  1OTN A;  2JQD A;  4Z8G A;  1H6T A;  4M7E C;  4CP6 A;  3VQ1 A;  3W3L A;  4CC4 C;  4L3A A;  4R58 A;  4P8S A;  4CNC A;  3M18 A;  3RGZ A;  4LI2 A;  3ZYN A;  5AZ5 A;  4XGO A;  2JE0 A;  4Z64 C;  2Z7X B;  1XCD A;  2V9S A;  3UN9 A;  3O53 A;  4OQT A;  3RFJ A;  4H09 A;  1M9S A;  1M10 B;  5IJC A;  4RWT C;  4PER A;  3CIG A;  4K17 A;  4GT6 A;  4NKG A;  4R5C A;  2Q4G W;  2P1P B;  4Z79 A;  3ULU A;  1O6T A;  4NKH A;  2Z81 A;  5AWA A;  1LTX A;  5B0N A;  3VQ2 A;  4R0A A;  4R07 A;  2ELL A;  1XEU A;  4PSJ A;  4HQ1 A;  5IJD A;  3RJ0 A;  4PEQ B;  4R09 A;  1YRG A;  2Z62 A;  3C6P B;  1DFJ I;  3UL9 A;  2Z64 A;  3C6N B;  1U0N D;  2RR6 A;  5IJB A;  3KJ4 A;  3E3Z A;  2AST B;  1XKU A;  4U7L A;  5GMH A;  3WPI A;  2O6S A;  3OGK B;  3WN4 A;  4CC4 A;  2XWT C;  4BSU A;  1OOK G;  4LSX C;  3G06 A;  4PKI G;  3W3J A;  1FO1 A;  3OGM B; 
#chains in the Genus database with same CATH homology
 3G3B A;  2Z66 A;  1P8V A;  3WPD A;  3RGX A;  1K5G C;  1KOO A;  4KNG A;  3JB9 j;  1OGQ A;  1OTM A;  4ARR A;  2Z65 A;  2WQV A;  4R6F A;  4KT1 A;  3BZ5 A;  4B8C D;  4XSQ A;  4ECO A;  4G8A A;  3TSR E;  5A5C A;  5AWB A;  4L3F A;  2P1Q B;  4WP6 A;  2Z7X A;  3G3A A;  4LSC A;  4GLP A;  2OMW A;  2FT3 A;  2OMV A;  4LSA A;  3WPF A;  4ECN A;  3SB4 A;  1H6U A;  4CNM A;  2XOT A;  4R5D A;  5CMN A;  4KXF B;  3W3N A;  4LSX A;  4PQ8 A;  4RCA B;  1M0Z A;  1SQ0 B;  1W8A A;  1O6V A;  3E2J A;  1FQV A;  4CIL A;  4WYK A;  3G39 A;  5GS0 A;  4Z94 G;  3REZ A;  2OMT A;  5D3I A;  1IO0 A;  3W3M A;  4R08 A;  4ARN A;  4MQW X;  4FHO A;  1QYY A;  4BSS A;  1PGV A;  4FMZ A;  2BEX A;  2A0Z A;  1GWB A;  4YEB B;  3RW6 A;  4FS7 A;  1P9A G;  4UFR A;  3CIY A;  3M19 A;  5GMG A;  2O6Q A;  1Z7X W;  3RIZ A;  4V2C A;  2OMY A;  2WQX A;  1KOH A;  2JE1 A;  3WPE A;  2WFH A;  5GS2 B;  4R6G A;  1M9L A;  4IM6 A;  2UZY A;  2V70 A;  1DCE A;  4QC0 A;  1G9U A;  1OTO A;  4LXR A;  4QXE A;  2RA8 A;  3OJA B;  3W3G A;  3FXI A;  4Z61 C;  3ZYJ A;  3DZE A;  2IFG A;  2OMZ A;  4V2E A;  1DS9 A;  2P1O B;  3A79 B;  2ID5 A;  5AWD A;  3WPH A;  3E4G A;  5GQR K;  4Q3I A;  1A9N A;  2R9U A;  2UZX A;  5HZL B;  4RCW A;  4AW4 A;  4QBZ A;  3C6O B;  3WPG A;  3E6J A;  5B0T A;  4BV4 R;  2P1N B;  1XWD C;  4V2D A;  1OZN A;  4Q3G A;  4XOS A;  4AY9 X;  4Y61 B;  3ZYO A;  4LI1 A;  3WPC A;  4U08 A;  2O6R A;  5AWC A;  2Z82 A;  3W3K A;  2Y5Q A;  1FS2 A;  3ULA A;  2OMX A;  1D0B A;  5CMP A;  2WQW A;  1FT8 A;  3RW7 A;  3ZYI A;  3RFS A;  5B4P A;  1K5D C;  2ASS B;  2Z63 A;  1ZIW A;  2P1M B;  4FCG A;  4P91 A;  3PMH G;  4J4L A;  3P72 A;  5FTT B;  2CA6 A;  1A4Y A;  4TZH A;  4J0M A;  4EZG A;  2BNH A;  5HDH A;  4FD0 A;  4FDW A;  1O6S A;  2V9T B;  3GOZ A;  3G04 C;  4M7E A;  4BSR A;  4I6J B;  5GMF A;  3UL7 A;  1JL5 A;  3OJA A;  3UL8 A;  3CVR A;  3RFE A;  5LFN A;  1P8T A;  4U06 A;  3OGL B;  5IYX C;  4LXS A;  4C2B B;  4R6J A;  4Q62 A;  1XEC A;  4MN8 B;  3O6N A;  2WQU A;  4R6A A;  2OMU A;  3WPB A;  1WWL A;  3ULV A;  4U09 A;  4C2A B;  1OTN A;  2JQD A;  4Z8G A;  1H6T A;  4M7E C;  4CP6 A;  3VQ1 A;  3W3L A;  4CC4 C;  4L3A A;  4R58 A;  4P8S A;  4CNC A;  3M18 A;  3RGZ A;  4LI2 A;  3ZYN A;  5AZ5 A;  4XGO A;  2JE0 A;  4Z64 C;  2Z7X B;  1XCD A;  2V9S A;  3UN9 A;  3O53 A;  4OQT A;  3RFJ A;  4H09 A;  1M9S A;  1M10 B;  5IJC A;  4RWT C;  4PER A;  3CIG A;  4K17 A;  4GT6 A;  4NKG A;  4R5C A;  2Q4G W;  2P1P B;  4Z79 A;  3ULU A;  1O6T A;  4NKH A;  2Z81 A;  5AWA A;  1LTX A;  5B0N A;  3VQ2 A;  4R0A A;  4R07 A;  2ELL A;  1XEU A;  4PSJ A;  4HQ1 A;  5IJD A;  3RJ0 A;  4PEQ B;  4R09 A;  1YRG A;  2Z62 A;  3C6P B;  1DFJ I;  3UL9 A;  2Z64 A;  3C6N B;  1U0N D;  2RR6 A;  5IJB A;  3KJ4 A;  3E3Z A;  2AST B;  1XKU A;  4U7L A;  5GMH A;  3WPI A;  2O6S A;  3OGK B;  3WN4 A;  4CC4 A;  2XWT C;  4BSU A;  1OOK G;  4LSX C;  3G06 A;  4PKI G;  3W3J A;  1FO1 A;  3OGM B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...