1ZIWA

Human toll-like receptor 3 extracellular domain structure
Total Genus 221
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
221
sequence length
635
structure length
629
Chain Sequence
VSHEVADCSHLKLTQVPDDLPTNITVLNLTHNQLRRLPAANFTRYSQLTSLDVGFNTISKLEPELCQKLPMLKVLNLQHNELSQLSDKTFAFCTNLTELHLMSNSIQKIKNNPFVKQKNLITLDLSHNGLSSTKLGTQVQLENLQELLLSNNKIQALKSEELDIFANSSLKKLELSSNQIKEFSPGCFHAIGRLFGLFLNNVQLGPSLTEKLCLELANTSIRNLSLSNSQLSTTSNTTFLGLKWTNLTMLDLSYNNLNVVGNDSFAWLPQLEYFFLEYNNIQHLFSHSLHGLFNVRYLNLKRSFTKQLPKIDDFSFQWLKCLEHLNMEDNDIPGIKSNMFTGLINLKYLSLSNSFTSLRTLTNETFVSLAHSPLHILNLTKNKISKIESDAFSWLGHLEVLDLGLNEIGQELTGQEWRGLENIFEIYLSYNKYLQLTRNSFALVPSLQRLMLRRVALKNVDSSPSPFQPLRNLTILDLSNNNIANINDDMLEGLEKLEILDLQHNNLARLWKHANPGGPIYFLKGLSHLHILNLESNGFDEIPVEVFKDLFELKIIDLGLNNLNTLPASVFNNQVSLKSLNLQKNLITSVEKKVFGPAFRNLTELDMRFNPFDCTCESIAWFVNWINET
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Immune system
molecule keywords Toll-like receptor 3
publication title Crystal structure of human toll-like receptor 3 (TLR3) ectodomain.
pubmed doi rcsb
source organism Homo sapiens
total genus 221
structure length 629
sequence length 635
ec nomenclature
pdb deposition date 2005-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13516 LRR_6 Leucine Rich repeat
A PF13855 LRR_8 Leucine rich repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 1ziwA00
4MN8B 1XCDA 3OGKB 4ECNA 2UZXA 4B8CD 1P8TA 1KOOA 5CMNA 4M7EC 5HZLB 2R9UA 5GMFA 3G3AA 4H09A 5IJCA 4R5DA 4GLPA 3O53A 4PERA 3RW6A 4FHOA 4R09A 4NKGA 1O6TA 3OGLB 3CVRA 1OTNA 4HQ1A 2V9SA 4V2DA 4QC0A 4UFRA 4EZGA 1D0BA 3RJ0A 1OZNA 2Y5QA 1XEUA 4L3FA 5B4PA 2Q4GW 2O6QA 1H6UA 3W3MA 4V2EA 3W3JA 3CIYA 4RCAB 4GT6A 2O6SA 5IJBA 5GMHA 4LI2A 4R5CA 1KOHA 1YRGA 2IFGA 4BSUA 5D3IA 2Z66A 3VQ2A 2WQUA 3W3LA 3KJ4A 5AWBA 3E3ZA 3CIGA 4R6AA 3ULVA 5LFNA 5CMPA 4AW4A 3RFJA 2OMUA 2OMTA 1H6TA 4LI1A 2Z82A 4LSCA 3WPGA 3UN9A 5GS0A 1O6SA 4R07A 2V70A 1O6VA 3JB9j 4PKIG 2Z63A 3W3NA 4R0AA 3ULUA 4KNGA 3W3KA 5FTTB 3VQ1A 3BZ5A 4OQTA 3OJAA 3E4GA 3C6OB 4CP6A 3WPIA 2ASSB 4LSXC 3RFSA 4P8SA 1U0ND 4P91A 1A4YA 2JQDA 2Z7XA 1WWLA 2OMZA 5B0NA 4ARRA 4U06A 1OTMA 3G3BA 1P8VA 2ID5A 3RW7A 4Z61C 1M9SA 5AWAA 4J4LA 3RIZA 4K17A 3O6NA 1FT8A 3G04C 3OGMB 4LXSA 1G9UA 3ULAA 3SB4A 4CC4A 3REZA 3WPFA 4FD0A 3ZYIA 4Z8GA 2OMYA 3ZYOA 3ZYNA 4M7EA 4ECOA 1OOKG 3RGZA 3WN4A 2Z64A 4XSQA 4Z64C 2UZYA 4BV4R 5IJDA 1OTOA 4RWTC 2OMXA 3M18A 4CNMA 4KXFB 3G39A 4J0MA 2P1MB 2V9TB 5AWCA 3C6NB 2WQVA 5GQRK 3PMHG 1LTXA 4WP6A 4BSRA 4IM6A 1ZIWA 4C2AB 4R58A 5GS2B 1Z7XW 1OGQA 1XWDC 4FDWA 3M19A 1W8AA 4LSAA 2XOTA 1QYYA 1M9LA 3E2JA 2P1QB 2P1NB 3TSRE 1IO0A 4FS7A 4MQWX 5IYXC 5A5CA 1FQVA 2A0ZA 1P9AG 2Z65A 3GOZA 4R08A 1M10B 4PQ8A 1XECA 3WPHA 4PEQB 4R6JA 4CNCA 3WPCA 4RCWA 4QXEA 4G8AA 4PSJA 2P1OB 4XOSA 2ELLA 4FCGA 4C2BB 1DFJI 4KT1A 5AZ5A 4TZHA 4U08A 4Z94G 4V2CA 3G06A 4AY9X 3RFEA 4L3AA 4ARNA 5B0TA 3A79B 2P1PB 5HDHA 4QBZA 3W3GA 3WPDA 2OMWA 4R6FA 2ASTB 2Z62A 4U7LA 1M0ZA 4Z79A 3RGXA 4BSSA 4WYKA 4LXRA 4FMZA 4I6JB 2WFHA 3C6PB 4LSXA 2BEXA 2RR6A 3OJAB 2FT3A 4Q3IA 1FO1A 2Z81A 3DZEA 3WPEA 5AWDA 1K5GC 3E6JA 2JE0A 1GWBA 3P72A 1FS2A 2Z7XB 2WQWA 1PGVA 2BNHA 3ZYJA 3UL9A 4R6GA 2WQXA 3WPBA 2RA8A 5GMGA 1JL5A 2OMVA 1K5DC 2O6RA 4Q62A 4Y61B 3UL7A 2JE1A 2XWTC 4Q3GA 1DCEA 1A9NA 3UL8A 4NKHA 3FXIA 1XKUA 4CILA 2CA6A 4U09A 4CC4C 1DS9A 1SQ0B 4XGOA 4YEBB
chains in the Genus database with same CATH superfamily
4MN8B 1XCDA 3OGKB 4ECNA 2UZXA 4B8CD 1P8TA 1KOOA 5CMNA 4M7EC 5HZLB 2R9UA 5GMFA 3G3AA 4H09A 5IJCA 4R5DA 4GLPA 3O53A 4PERA 3RW6A 4FHOA 4R09A 4NKGA 1O6TA 3OGLB 3CVRA 1OTNA 4HQ1A 2V9SA 4V2DA 4QC0A 4UFRA 4EZGA 1D0BA 3RJ0A 1OZNA 2Y5QA 1XEUA 4L3FA 5B4PA 2Q4GW 2O6QA 1H6UA 3W3MA 4V2EA 3W3JA 3CIYA 4RCAB 4GT6A 2O6SA 5IJBA 5GMHA 4LI2A 4R5CA 1KOHA 1YRGA 2IFGA 4BSUA 5D3IA 2Z66A 3VQ2A 2WQUA 3W3LA 3KJ4A 5AWBA 3E3ZA 3CIGA 4R6AA 3ULVA 5LFNA 5CMPA 4AW4A 3RFJA 2OMUA 2OMTA 1H6TA 4LI1A 2Z82A 4LSCA 3WPGA 3UN9A 5GS0A 1O6SA 4R07A 2V70A 1O6VA 3JB9j 4PKIG 2Z63A 3W3NA 4R0AA 3ULUA 4KNGA 3W3KA 5FTTB 3VQ1A 3BZ5A 4OQTA 3OJAA 3E4GA 3C6OB 4CP6A 3WPIA 2ASSB 4LSXC 3RFSA 4P8SA 1U0ND 4P91A 1A4YA 2JQDA 2Z7XA 1WWLA 2OMZA 5B0NA 4ARRA 4U06A 1OTMA 3G3BA 1P8VA 2ID5A 3RW7A 4Z61C 1M9SA 5AWAA 4J4LA 3RIZA 4K17A 3O6NA 1FT8A 3G04C 3OGMB 4LXSA 1G9UA 3ULAA 3SB4A 4CC4A 4NZRM 3REZA 3WPFA 4FD0A 3ZYIA 4Z8GA 2OMYA 3ZYOA 3ZYNA 4M7EA 4ECOA 1OOKG 3RGZA 3WN4A 2Z64A 4XSQA 4Z64C 2UZYA 4BV4R 5IJDA 1OTOA 4RWTC 2OMXA 3M18A 4CNMA 4KXFB 3G39A 4J0MA 2P1MB 2V9TB 5AWCA 3C6NB 2WQVA 5GQRK 3PMHG 1LTXA 4WP6A 4BSRA 4IM6A 1ZIWA 4C2AB 4R58A 5GS2B 1Z7XW 1OGQA 1XWDC 4FDWA 3M19A 1W8AA 4LSAA 2XOTA 1QYYA 1M9LA 3E2JA 2P1QB 2P1NB 3TSRE 1IO0A 4FS7A 4MQWX 5IYXC 5A5CA 1FQVA 2A0ZA 1P9AG 2Z65A 3GOZA 4R08A 1M10B 4PQ8A 1XECA 3WPHA 4PEQB 4R6JA 4CNCA 3WPCA 4RCWA 4QXEA 4G8AA 4PSJA 2P1OB 4XOSA 2ELLA 4FCGA 4C2BB 1DFJI 4KT1A 5AZ5A 4TZHA 4U08A 4Z94G 4V2CA 3G06A 4AY9X 3RFEA 4L3AA 4ARNA 5B0TA 3A79B 2P1PB 5HDHA 4QBZA 3W3GA 4NZTM 3WPDA 2OMWA 4R6FA 2ASTB 2Z62A 4U7LA 1M0ZA 4Z79A 3RGXA 4BSSA 4WYKA 4LXRA 4FMZA 4I6JB 2WFHA 3C6PB 4LSXA 2BEXA 2RR6A 3OJAB 2FT3A 4Q3IA 1FO1A 2Z81A 3DZEA 3WPEA 5AWDA 1K5GC 3E6JA 2JE0A 1GWBA 3P72A 1FS2A 2Z7XB 2WQWA 1PGVA 2BNHA 3ZYJA 3UL9A 4R6GA 2WQXA 3WPBA 2RA8A 5GMGA 1JL5A 2OMVA 1K5DC 2O6RA 4Q62A 4Y61B 3UL7A 2JE1A 2XWTC 4Q3GA 1DCEA 1A9NA 3UL8A 4NKHA 3FXIA 1XKUA 4CILA 2CA6A 4U09A 4CC4C 1DS9A 1SQ0B 4XGOA 4YEBB
chains in the Genus database with same CATH topology
4MN8B 1XCDA 3OGKB 4ECNA 2UZXA 4B8CD 1P8TA 1KOOA 5CMNA 4M7EC 5HZLB 2R9UA 5GMFA 3G3AA 4H09A 5IJCA 4R5DA 4GLPA 3O53A 4PERA 3RW6A 4FHOA 4R09A 4NKGA 1O6TA 3OGLB 3CVRA 1OTNA 4HQ1A 2V9SA 4V2DA 4QC0A 4UFRA 4EZGA 1D0BA 3RJ0A 1OZNA 2Y5QA 1XEUA 4L3FA 5B4PA 2Q4GW 2O6QA 1H6UA 3W3MA 4V2EA 3W3JA 3CIYA 4RCAB 4GT6A 2O6SA 5IJBA 5GMHA 4LI2A 4R5CA 1KOHA 1YRGA 2IFGA 4BSUA 5D3IA 2Z66A 3VQ2A 2WQUA 3W3LA 3KJ4A 5AWBA 3E3ZA 3CIGA 4R6AA 3ULVA 5LFNA 5CMPA 4AW4A 3RFJA 2OMUA 2OMTA 1H6TA 4LI1A 2Z82A 4LSCA 3WPGA 3UN9A 5GS0A 1O6SA 4R07A 2V70A 1O6VA 3JB9j 4PKIG 2Z63A 3W3NA 4R0AA 3ULUA 4KNGA 3W3KA 5FTTB 3VQ1A 3BZ5A 4OQTA 3OJAA 3E4GA 3C6OB 4CP6A 3WPIA 2ASSB 4LSXC 3RFSA 4P8SA 1U0ND 4P91A 1A4YA 2JQDA 2Z7XA 1WWLA 2OMZA 5B0NA 4ARRA 4U06A 1OTMA 3G3BA 1P8VA 2ID5A 3RW7A 4Z61C 1M9SA 5AWAA 4J4LA 3RIZA 4K17A 3O6NA 1FT8A 3G04C 3OGMB 4LXSA 1G9UA 3ULAA 3SB4A 4CC4A 3REZA 3WPFA 4FD0A 3ZYIA 4Z8GA 2OMYA 3ZYOA 3ZYNA 4M7EA 4ECOA 1OOKG 3RGZA 3WN4A 2Z64A 4XSQA 4Z64C 2UZYA 4BV4R 5IJDA 1OTOA 4RWTC 2OMXA 3M18A 4CNMA 4KXFB 3G39A 4J0MA 2P1MB 2V9TB 5AWCA 3C6NB 2WQVA 5GQRK 3PMHG 1LTXA 4WP6A 4BSRA 4IM6A 1ZIWA 4C2AB 4R58A 5GS2B 1Z7XW 1OGQA 1XWDC 4FDWA 3M19A 1W8AA 4LSAA 2XOTA 1QYYA 1M9LA 3E2JA 2P1QB 2P1NB 3TSRE 1IO0A 4FS7A 4MQWX 5IYXC 5A5CA 1FQVA 2A0ZA 1P9AG 2Z65A 3GOZA 4R08A 1M10B 4PQ8A 1XECA 3WPHA 4PEQB 4R6JA 4CNCA 3WPCA 4RCWA 4QXEA 4G8AA 4PSJA 2P1OB 4XOSA 2ELLA 4FCGA 4C2BB 1DFJI 4KT1A 5AZ5A 4TZHA 4U08A 4Z94G 4V2CA 3G06A 4AY9X 3RFEA 4L3AA 4ARNA 5B0TA 3A79B 2P1PB 5HDHA 4QBZA 3W3GA 3WPDA 2OMWA 4R6FA 2ASTB 2Z62A 4U7LA 1M0ZA 4Z79A 3RGXA 4BSSA 4WYKA 4LXRA 4FMZA 4I6JB 2WFHA 3C6PB 4LSXA 2BEXA 2RR6A 3OJAB 2FT3A 4Q3IA 1FO1A 2Z81A 3DZEA 3WPEA 5AWDA 1K5GC 3E6JA 2JE0A 1GWBA 3P72A 1FS2A 2Z7XB 2WQWA 1PGVA 2BNHA 3ZYJA 3UL9A 4R6GA 2WQXA 3WPBA 2RA8A 5GMGA 1JL5A 2OMVA 1K5DC 2O6RA 4Q62A 4Y61B 3UL7A 2JE1A 2XWTC 4Q3GA 1DCEA 1A9NA 3UL8A 4NKHA 3FXIA 1XKUA 4CILA 2CA6A 4U09A 4CC4C 1DS9A 1SQ0B 4XGOA 4YEBB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MN8 B;  1XCD A;  3OGK B;  4ECN A;  2UZX A;  4B8C D;  1P8T A;  1KOO A;  5CMN A;  4M7E C;  5HZL B;  2R9U A;  5GMF A;  3G3A A;  4H09 A;  5IJC A;  4R5D A;  4GLP A;  3O53 A;  4PER A;  3RW6 A;  4FHO A;  4R09 A;  4NKG A;  1O6T A;  3OGL B;  3CVR A;  1OTN A;  4HQ1 A;  2V9S A;  4V2D A;  4QC0 A;  4UFR A;  4EZG A;  1D0B A;  3RJ0 A;  1OZN A;  2Y5Q A;  1XEU A;  4L3F A;  5B4P A;  2Q4G W;  2O6Q A;  1H6U A;  3W3M A;  4V2E A;  3W3J A;  3CIY A;  4RCA B;  4GT6 A;  2O6S A;  5IJB A;  5GMH A;  4LI2 A;  4R5C A;  1KOH A;  1YRG A;  2IFG A;  4BSU A;  5D3I A;  2Z66 A;  3VQ2 A;  2WQU A;  3W3L A;  3KJ4 A;  5AWB A;  3E3Z A;  3CIG A;  4R6A A;  3ULV A;  5LFN A;  5CMP A;  4AW4 A;  3RFJ A;  2OMU A;  2OMT A;  1H6T A;  4LI1 A;  2Z82 A;  4LSC A;  3WPG A;  3UN9 A;  5GS0 A;  1O6S A;  4R07 A;  2V70 A;  1O6V A;  3JB9 j;  4PKI G;  2Z63 A;  3W3N A;  4R0A A;  3ULU A;  4KNG A;  3W3K A;  5FTT B;  3VQ1 A;  3BZ5 A;  4OQT A;  3OJA A;  3E4G A;  3C6O B;  4CP6 A;  3WPI A;  2ASS B;  4LSX C;  3RFS A;  4P8S A;  1U0N D;  4P91 A;  1A4Y A;  2JQD A;  2Z7X A;  1WWL A;  2OMZ A;  5B0N A;  4ARR A;  4U06 A;  1OTM A;  3G3B A;  1P8V A;  2ID5 A;  3RW7 A;  4Z61 C;  1M9S A;  5AWA A;  4J4L A;  3RIZ A;  4K17 A;  3O6N A;  1FT8 A;  3G04 C;  3OGM B;  4LXS A;  1G9U A;  3ULA A;  3SB4 A;  4CC4 A;  3REZ A;  3WPF A;  4FD0 A;  3ZYI A;  4Z8G A;  2OMY A;  3ZYO A;  3ZYN A;  4M7E A;  4ECO A;  1OOK G;  3RGZ A;  3WN4 A;  2Z64 A;  4XSQ A;  4Z64 C;  2UZY A;  4BV4 R;  5IJD A;  1OTO A;  4RWT C;  2OMX A;  3M18 A;  4CNM A;  4KXF B;  3G39 A;  4J0M A;  2P1M B;  2V9T B;  5AWC A;  3C6N B;  2WQV A;  5GQR K;  3PMH G;  1LTX A;  4WP6 A;  4BSR A;  4IM6 A;  1ZIW A;  4C2A B;  4R58 A;  5GS2 B;  1Z7X W;  1OGQ A;  1XWD C;  4FDW A;  3M19 A;  1W8A A;  4LSA A;  2XOT A;  1QYY A;  1M9L A;  3E2J A;  2P1Q B;  2P1N B;  3TSR E;  1IO0 A;  4FS7 A;  4MQW X;  5IYX C;  5A5C A;  1FQV A;  2A0Z A;  1P9A G;  2Z65 A;  3GOZ A;  4R08 A;  1M10 B;  4PQ8 A;  1XEC A;  3WPH A;  4PEQ B;  4R6J A;  4CNC A;  3WPC A;  4RCW A;  4QXE A;  4G8A A;  4PSJ A;  2P1O B;  4XOS A;  2ELL A;  4FCG A;  4C2B B;  1DFJ I;  4KT1 A;  5AZ5 A;  4TZH A;  4U08 A;  4Z94 G;  4V2C A;  3G06 A;  4AY9 X;  3RFE A;  4L3A A;  4ARN A;  5B0T A;  3A79 B;  2P1P B;  5HDH A;  4QBZ A;  3W3G A;  3WPD A;  2OMW A;  4R6F A;  2AST B;  2Z62 A;  4U7L A;  1M0Z A;  4Z79 A;  3RGX A;  4BSS A;  4WYK A;  4LXR A;  4FMZ A;  4I6J B;  2WFH A;  3C6P B;  4LSX A;  2BEX A;  2RR6 A;  3OJA B;  2FT3 A;  4Q3I A;  1FO1 A;  2Z81 A;  3DZE A;  3WPE A;  5AWD A;  1K5G C;  3E6J A;  2JE0 A;  1GWB A;  3P72 A;  1FS2 A;  2Z7X B;  2WQW A;  1PGV A;  2BNH A;  3ZYJ A;  3UL9 A;  4R6G A;  2WQX A;  3WPB A;  2RA8 A;  5GMG A;  1JL5 A;  2OMV A;  1K5D C;  2O6R A;  4Q62 A;  4Y61 B;  3UL7 A;  2JE1 A;  2XWT C;  4Q3G A;  1DCE A;  1A9N A;  3UL8 A;  4NKH A;  3FXI A;  1XKU A;  4CIL A;  2CA6 A;  4U09 A;  4CC4 C;  1DS9 A;  1SQ0 B;  4XGO A;  4YEB B; 
#chains in the Genus database with same CATH topology
 4MN8 B;  1XCD A;  3OGK B;  4ECN A;  2UZX A;  4B8C D;  1P8T A;  1KOO A;  5CMN A;  4M7E C;  5HZL B;  2R9U A;  5GMF A;  3G3A A;  4H09 A;  5IJC A;  4R5D A;  4GLP A;  3O53 A;  4PER A;  3RW6 A;  4FHO A;  4R09 A;  4NKG A;  1O6T A;  3OGL B;  3CVR A;  1OTN A;  4HQ1 A;  2V9S A;  4V2D A;  4QC0 A;  4UFR A;  4EZG A;  1D0B A;  3RJ0 A;  1OZN A;  2Y5Q A;  1XEU A;  4L3F A;  5B4P A;  2Q4G W;  2O6Q A;  1H6U A;  3W3M A;  4V2E A;  3W3J A;  3CIY A;  4RCA B;  4GT6 A;  2O6S A;  5IJB A;  5GMH A;  4LI2 A;  4R5C A;  1KOH A;  1YRG A;  2IFG A;  4BSU A;  5D3I A;  2Z66 A;  3VQ2 A;  2WQU A;  3W3L A;  3KJ4 A;  5AWB A;  3E3Z A;  3CIG A;  4R6A A;  3ULV A;  5LFN A;  5CMP A;  4AW4 A;  3RFJ A;  2OMU A;  2OMT A;  1H6T A;  4LI1 A;  2Z82 A;  4LSC A;  3WPG A;  3UN9 A;  5GS0 A;  1O6S A;  4R07 A;  2V70 A;  1O6V A;  3JB9 j;  4PKI G;  2Z63 A;  3W3N A;  4R0A A;  3ULU A;  4KNG A;  3W3K A;  5FTT B;  3VQ1 A;  3BZ5 A;  4OQT A;  3OJA A;  3E4G A;  3C6O B;  4CP6 A;  3WPI A;  2ASS B;  4LSX C;  3RFS A;  4P8S A;  1U0N D;  4P91 A;  1A4Y A;  2JQD A;  2Z7X A;  1WWL A;  2OMZ A;  5B0N A;  4ARR A;  4U06 A;  1OTM A;  3G3B A;  1P8V A;  2ID5 A;  3RW7 A;  4Z61 C;  1M9S A;  5AWA A;  4J4L A;  3RIZ A;  4K17 A;  3O6N A;  1FT8 A;  3G04 C;  3OGM B;  4LXS A;  1G9U A;  3ULA A;  3SB4 A;  4CC4 A;  4NZR M;  3REZ A;  3WPF A;  4FD0 A;  3ZYI A;  4Z8G A;  2OMY A;  3ZYO A;  3ZYN A;  4M7E A;  4ECO A;  1OOK G;  3RGZ A;  3WN4 A;  2Z64 A;  4XSQ A;  4Z64 C;  2UZY A;  4BV4 R;  5IJD A;  1OTO A;  4RWT C;  2OMX A;  3M18 A;  4CNM A;  4KXF B;  3G39 A;  4J0M A;  2P1M B;  2V9T B;  5AWC A;  3C6N B;  2WQV A;  5GQR K;  3PMH G;  1LTX A;  4WP6 A;  4BSR A;  4IM6 A;  1ZIW A;  4C2A B;  4R58 A;  5GS2 B;  1Z7X W;  1OGQ A;  1XWD C;  4FDW A;  3M19 A;  1W8A A;  4LSA A;  2XOT A;  1QYY A;  1M9L A;  3E2J A;  2P1Q B;  2P1N B;  3TSR E;  1IO0 A;  4FS7 A;  4MQW X;  5IYX C;  5A5C A;  1FQV A;  2A0Z A;  1P9A G;  2Z65 A;  3GOZ A;  4R08 A;  1M10 B;  4PQ8 A;  1XEC A;  3WPH A;  4PEQ B;  4R6J A;  4CNC A;  3WPC A;  4RCW A;  4QXE A;  4G8A A;  4PSJ A;  2P1O B;  4XOS A;  2ELL A;  4FCG A;  4C2B B;  1DFJ I;  4KT1 A;  5AZ5 A;  4TZH A;  4U08 A;  4Z94 G;  4V2C A;  3G06 A;  4AY9 X;  3RFE A;  4L3A A;  4ARN A;  5B0T A;  3A79 B;  2P1P B;  5HDH A;  4QBZ A;  3W3G A;  4NZT M;  3WPD A;  2OMW A;  4R6F A;  2AST B;  2Z62 A;  4U7L A;  1M0Z A;  4Z79 A;  3RGX A;  4BSS A;  4WYK A;  4LXR A;  4FMZ A;  4I6J B;  2WFH A;  3C6P B;  4LSX A;  2BEX A;  2RR6 A;  3OJA B;  2FT3 A;  4Q3I A;  1FO1 A;  2Z81 A;  3DZE A;  3WPE A;  5AWD A;  1K5G C;  3E6J A;  2JE0 A;  1GWB A;  3P72 A;  1FS2 A;  2Z7X B;  2WQW A;  1PGV A;  2BNH A;  3ZYJ A;  3UL9 A;  4R6G A;  2WQX A;  3WPB A;  2RA8 A;  5GMG A;  1JL5 A;  2OMV A;  1K5D C;  2O6R A;  4Q62 A;  4Y61 B;  3UL7 A;  2JE1 A;  2XWT C;  4Q3G A;  1DCE A;  1A9N A;  3UL8 A;  4NKH A;  3FXI A;  1XKU A;  4CIL A;  2CA6 A;  4U09 A;  4CC4 C;  1DS9 A;  1SQ0 B;  4XGO A;  4YEB B; 
#chains in the Genus database with same CATH homology
 4MN8 B;  1XCD A;  3OGK B;  4ECN A;  2UZX A;  4B8C D;  1P8T A;  1KOO A;  5CMN A;  4M7E C;  5HZL B;  2R9U A;  5GMF A;  3G3A A;  4H09 A;  5IJC A;  4R5D A;  4GLP A;  3O53 A;  4PER A;  3RW6 A;  4FHO A;  4R09 A;  4NKG A;  1O6T A;  3OGL B;  3CVR A;  1OTN A;  4HQ1 A;  2V9S A;  4V2D A;  4QC0 A;  4UFR A;  4EZG A;  1D0B A;  3RJ0 A;  1OZN A;  2Y5Q A;  1XEU A;  4L3F A;  5B4P A;  2Q4G W;  2O6Q A;  1H6U A;  3W3M A;  4V2E A;  3W3J A;  3CIY A;  4RCA B;  4GT6 A;  2O6S A;  5IJB A;  5GMH A;  4LI2 A;  4R5C A;  1KOH A;  1YRG A;  2IFG A;  4BSU A;  5D3I A;  2Z66 A;  3VQ2 A;  2WQU A;  3W3L A;  3KJ4 A;  5AWB A;  3E3Z A;  3CIG A;  4R6A A;  3ULV A;  5LFN A;  5CMP A;  4AW4 A;  3RFJ A;  2OMU A;  2OMT A;  1H6T A;  4LI1 A;  2Z82 A;  4LSC A;  3WPG A;  3UN9 A;  5GS0 A;  1O6S A;  4R07 A;  2V70 A;  1O6V A;  3JB9 j;  4PKI G;  2Z63 A;  3W3N A;  4R0A A;  3ULU A;  4KNG A;  3W3K A;  5FTT B;  3VQ1 A;  3BZ5 A;  4OQT A;  3OJA A;  3E4G A;  3C6O B;  4CP6 A;  3WPI A;  2ASS B;  4LSX C;  3RFS A;  4P8S A;  1U0N D;  4P91 A;  1A4Y A;  2JQD A;  2Z7X A;  1WWL A;  2OMZ A;  5B0N A;  4ARR A;  4U06 A;  1OTM A;  3G3B A;  1P8V A;  2ID5 A;  3RW7 A;  4Z61 C;  1M9S A;  5AWA A;  4J4L A;  3RIZ A;  4K17 A;  3O6N A;  1FT8 A;  3G04 C;  3OGM B;  4LXS A;  1G9U A;  3ULA A;  3SB4 A;  4CC4 A;  3REZ A;  3WPF A;  4FD0 A;  3ZYI A;  4Z8G A;  2OMY A;  3ZYO A;  3ZYN A;  4M7E A;  4ECO A;  1OOK G;  3RGZ A;  3WN4 A;  2Z64 A;  4XSQ A;  4Z64 C;  2UZY A;  4BV4 R;  5IJD A;  1OTO A;  4RWT C;  2OMX A;  3M18 A;  4CNM A;  4KXF B;  3G39 A;  4J0M A;  2P1M B;  2V9T B;  5AWC A;  3C6N B;  2WQV A;  5GQR K;  3PMH G;  1LTX A;  4WP6 A;  4BSR A;  4IM6 A;  1ZIW A;  4C2A B;  4R58 A;  5GS2 B;  1Z7X W;  1OGQ A;  1XWD C;  4FDW A;  3M19 A;  1W8A A;  4LSA A;  2XOT A;  1QYY A;  1M9L A;  3E2J A;  2P1Q B;  2P1N B;  3TSR E;  1IO0 A;  4FS7 A;  4MQW X;  5IYX C;  5A5C A;  1FQV A;  2A0Z A;  1P9A G;  2Z65 A;  3GOZ A;  4R08 A;  1M10 B;  4PQ8 A;  1XEC A;  3WPH A;  4PEQ B;  4R6J A;  4CNC A;  3WPC A;  4RCW A;  4QXE A;  4G8A A;  4PSJ A;  2P1O B;  4XOS A;  2ELL A;  4FCG A;  4C2B B;  1DFJ I;  4KT1 A;  5AZ5 A;  4TZH A;  4U08 A;  4Z94 G;  4V2C A;  3G06 A;  4AY9 X;  3RFE A;  4L3A A;  4ARN A;  5B0T A;  3A79 B;  2P1P B;  5HDH A;  4QBZ A;  3W3G A;  3WPD A;  2OMW A;  4R6F A;  2AST B;  2Z62 A;  4U7L A;  1M0Z A;  4Z79 A;  3RGX A;  4BSS A;  4WYK A;  4LXR A;  4FMZ A;  4I6J B;  2WFH A;  3C6P B;  4LSX A;  2BEX A;  2RR6 A;  3OJA B;  2FT3 A;  4Q3I A;  1FO1 A;  2Z81 A;  3DZE A;  3WPE A;  5AWD A;  1K5G C;  3E6J A;  2JE0 A;  1GWB A;  3P72 A;  1FS2 A;  2Z7X B;  2WQW A;  1PGV A;  2BNH A;  3ZYJ A;  3UL9 A;  4R6G A;  2WQX A;  3WPB A;  2RA8 A;  5GMG A;  1JL5 A;  2OMV A;  1K5D C;  2O6R A;  4Q62 A;  4Y61 B;  3UL7 A;  2JE1 A;  2XWT C;  4Q3G A;  1DCE A;  1A9N A;  3UL8 A;  4NKH A;  3FXI A;  1XKU A;  4CIL A;  2CA6 A;  4U09 A;  4CC4 C;  1DS9 A;  1SQ0 B;  4XGO A;  4YEB B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...