4Z61C

The plant peptide hormone receptor complex
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
185
structure length
185
Chain Sequence
NMEGDALHSLRANLVDPNNVLQSWDPTLVNPCTWFHVTCNNENSVIRVDLGNADLSGQLVPQLGQLKNLQYLELYSNNITGPVPSDLGNLTNLVSLDLYLNSFTGPIPDSLGKLFKLRFLRLNNNSLTGPIPMSLTNIMTLQVLDLSNNRLSGSVPDNGSFSLFTPISFANNLDLCGPVTSRPCP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Phytosulfokine receptor 1
publication title Allosteric receptor activation by the plant peptide hormone phytosulfokine
pubmed doi rcsb
source organism Daucus carota
total genus 57
structure length 185
sequence length 185
chains with identical sequence D
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2015-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF08263 LRRNT_2 Leucine rich repeat N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 4z61C00
2IFGA 3RGXA 5CMNA 2Q4GW 4Z94G 4R6FA 3CVRA 4RWTC 4AW4A 4Z79A 3G39A 3RIZA 4U08A 1W8AA 4YEBB 4KT1A 3WPFA 3ULAA 4PSJA 5B0TA 4CC4A 2UZXA 3W3JA 2WQXA 4R5DA 1XEUA 1YRGA 4LI2A 4BSSA 3RFEA 4BSRA 4P8SA 3OGKB 1A4YA 3RFSA 4Q3GA 2UZYA 4CNCA 3ULVA 2ASSB 2Z7XA 1SQ0B 5IJDA 4R6AA 1D0BA 3ZYJA 1KOHA 2Y5QA 4PERA 2WQWA 4V2DA 2Z7XB 4P91A 3E3ZA 2CA6A 2Z62A 1XECA 3JB9j 1K5DC 2OMXA 3CIYA 3KJ4A 2Z65A 4NKGA 3E2JA 1XKUA 5AWDA 1KOOA 1P9AG 3ZYOA 1H6UA 4ARNA 4M7EA 1A9NA 2R9UA 3A79B 3BZ5A 2Z82A 4U09A 3W3NA 3UN9A 1JL5A 1IO0A 5D3IA 1OTMA 2XOTA 2O6QA 5AWAA 1LTXA 3E4GA 2OMVA 4L3FA 3FXIA 1DCEA 4AY9X 2BEXA 3C6PB 1XCDA 1PGVA 1P8TA 5AZ5A 4XOSA 3O53A 3OGLB 3OGMB 2V9TB 1P8VA 4CC4C 4GT6A 4QC0A 4GLPA 1OZNA 4K17A 5GS2B 1K5GC 4BV4R 3GOZA 4UFRA 4Z61C 4FHOA 5B4PA 1OGQA 3RFJA 2O6SA 3SB4A 2P1QB 3VQ2A 2WQVA 4LXRA 2P1MB 5FTTB 4Z8GA 5HZLB 2A0ZA 2V70A 3TSRE 4XSQA 1M9SA 5IJBA 3ZYNA 1H6TA 4L3AA 4MQWX 5GMHA 4FD0A 2ELLA 1O6SA 4XGOA 4LXSA 5GQRK 3WPGA 4R0AA 4R08A 2Z66A 2WFHA 1G9UA 2FT3A 4Z64C 5A5CA 3RJ0A 4R09A 4V2CA 4M7EC 1ZIWA 4C2BB 1OTOA 4LSAA 1Z7XW 2OMUA 3RW6A 3UL8A 4PQ8A 4ECNA 1QYYA 4OQTA 4TZHA 4EZGA 4PEQB 2WQUA 1OTNA 3E6JA 3UL9A 4FMZA 4FCGA 4NKHA 3UL7A 2Z81A 4J4LA 2XWTC 3DZEA 3RGZA 4R58A 3ZYIA 2JE1A 3G3AA 4R5CA 5GS0A 4R07A 5IYXC 5B0NA 1U0ND 3VQ1A 2OMYA 1O6VA 3W3GA 2P1NB 4H09A 1XWDC 4CILA 4LSXA 3ULUA 3RW7A 1FT8A 3O6NA 3WPDA 2ID5A 1FQVA 3WPBA 3W3KA 2JE0A 3W3LA 1WWLA 4B8CD 4QBZA 4FDWA 4WYKA 5IJCA 3WPHA 4V2EA 3CIGA 4CP6A 1M9LA 1O6TA 2RR6A 4RCAB 5HDHA 4U7LA 2JQDA 4KNGA 4Q3IA 3M19A 1DS9A 4WP6A 4C2AB 2OMZA 4Q62A 3G06A 3OJAA 2OMTA 4U06A 5GMGA 2V9SA 2ASTB 3OJAB 3WN4A 4I6JB 4R6GA 1DFJI 3WPIA 3PMHG 4KXFB 2RA8A 5AWBA 3W3MA 4FS7A 3C6NB 3M18A 4PKIG 2P1PB 3WPCA 3WPEA 1M10B 3P72A 3G04C 4R6JA 2O6RA 4BSUA 4G8AA 5CMPA 5AWCA 2Z64A 4MN8B 2OMWA 1M0ZA 5LFNA 3C6OB 1OOKG 4ECOA 4LI1A 4ARRA 4QXEA 1GWBA 4LSXC 2P1OB 4RCWA 1FS2A 2Z63A 4Y61B 5GMFA 2BNHA 4HQ1A 4CNMA 4LSCA 4IM6A 4J0MA 1FO1A 3REZA 3G3BA
chains in the Genus database with same CATH superfamily
2IFGA 3RGXA 5CMNA 2Q4GW 4Z94G 4R6FA 3CVRA 4RWTC 4AW4A 4Z79A 3G39A 3RIZA 4NZTM 4U08A 1W8AA 4YEBB 4KT1A 3WPFA 3ULAA 4PSJA 5B0TA 4CC4A 2UZXA 3W3JA 4NZRM 2WQXA 4R5DA 1XEUA 1YRGA 4LI2A 4BSSA 3RFEA 4BSRA 4P8SA 3OGKB 1A4YA 3RFSA 4Q3GA 2UZYA 4CNCA 3ULVA 2ASSB 2Z7XA 1SQ0B 5IJDA 4R6AA 1D0BA 3ZYJA 1KOHA 2Y5QA 4PERA 2WQWA 4V2DA 2Z7XB 4P91A 3E3ZA 2CA6A 2Z62A 1XECA 3JB9j 1K5DC 2OMXA 3CIYA 3KJ4A 2Z65A 4NKGA 3E2JA 1XKUA 5AWDA 1KOOA 1P9AG 3ZYOA 1H6UA 4ARNA 4M7EA 1A9NA 2R9UA 3A79B 3BZ5A 2Z82A 4U09A 3W3NA 3UN9A 1JL5A 1IO0A 5D3IA 1OTMA 2XOTA 2O6QA 5AWAA 1LTXA 3E4GA 2OMVA 4L3FA 3FXIA 1DCEA 4AY9X 2BEXA 3C6PB 1XCDA 1PGVA 1P8TA 5AZ5A 4XOSA 3O53A 3OGLB 3OGMB 2V9TB 1P8VA 4CC4C 4GT6A 4QC0A 4GLPA 1OZNA 4K17A 5GS2B 1K5GC 4BV4R 3GOZA 4UFRA 4Z61C 4FHOA 5B4PA 1OGQA 3RFJA 2O6SA 3SB4A 2P1QB 3VQ2A 2WQVA 4LXRA 2P1MB 5FTTB 4Z8GA 5HZLB 2A0ZA 2V70A 3TSRE 4XSQA 1M9SA 5IJBA 3ZYNA 1H6TA 4L3AA 4MQWX 5GMHA 4FD0A 2ELLA 1O6SA 4XGOA 4LXSA 5GQRK 3WPGA 4R0AA 4R08A 2Z66A 2WFHA 1G9UA 2FT3A 4Z64C 5A5CA 3RJ0A 4R09A 4V2CA 4M7EC 1ZIWA 4C2BB 1OTOA 4LSAA 1Z7XW 2OMUA 3RW6A 3UL8A 4PQ8A 4ECNA 1QYYA 4OQTA 4TZHA 4EZGA 4PEQB 2WQUA 1OTNA 3E6JA 3UL9A 4FMZA 4FCGA 4NKHA 3UL7A 2Z81A 4J4LA 2XWTC 3DZEA 3RGZA 4R58A 3ZYIA 2JE1A 3G3AA 4R5CA 5GS0A 4R07A 5IYXC 5B0NA 1U0ND 3VQ1A 2OMYA 1O6VA 3W3GA 2P1NB 4H09A 1XWDC 4CILA 4LSXA 3ULUA 3RW7A 1FT8A 3O6NA 3WPDA 2ID5A 1FQVA 3WPBA 3W3KA 2JE0A 3W3LA 1WWLA 4B8CD 4QBZA 4FDWA 4WYKA 5IJCA 3WPHA 4V2EA 3CIGA 4CP6A 1M9LA 1O6TA 2RR6A 4RCAB 5HDHA 4U7LA 2JQDA 4KNGA 4Q3IA 3M19A 1DS9A 4WP6A 4C2AB 2OMZA 4Q62A 3G06A 3OJAA 2OMTA 4U06A 5GMGA 2V9SA 2ASTB 3OJAB 3WN4A 4I6JB 4R6GA 1DFJI 3WPIA 3PMHG 4KXFB 2RA8A 5AWBA 3W3MA 4FS7A 3C6NB 3M18A 4PKIG 2P1PB 3WPCA 3WPEA 1M10B 3P72A 3G04C 4R6JA 2O6RA 4BSUA 4G8AA 5CMPA 5AWCA 2Z64A 4MN8B 2OMWA 1M0ZA 5LFNA 3C6OB 1OOKG 4ECOA 4LI1A 4ARRA 4QXEA 1GWBA 4LSXC 2P1OB 4RCWA 1FS2A 2Z63A 4Y61B 5GMFA 2BNHA 4HQ1A 4CNMA 4LSCA 4IM6A 4J0MA 1FO1A 3REZA 3G3BA
chains in the Genus database with same CATH topology
2IFGA 3RGXA 5CMNA 2Q4GW 4Z94G 4R6FA 3CVRA 4RWTC 4AW4A 4Z79A 3G39A 3RIZA 4U08A 1W8AA 4YEBB 4KT1A 3WPFA 3ULAA 4PSJA 5B0TA 4CC4A 2UZXA 3W3JA 2WQXA 4R5DA 1XEUA 1YRGA 4LI2A 4BSSA 3RFEA 4BSRA 4P8SA 3OGKB 1A4YA 3RFSA 4Q3GA 2UZYA 4CNCA 3ULVA 2ASSB 2Z7XA 1SQ0B 5IJDA 4R6AA 1D0BA 3ZYJA 1KOHA 2Y5QA 4PERA 2WQWA 4V2DA 2Z7XB 4P91A 3E3ZA 2CA6A 2Z62A 1XECA 3JB9j 1K5DC 2OMXA 3CIYA 3KJ4A 2Z65A 4NKGA 3E2JA 1XKUA 5AWDA 1KOOA 1P9AG 3ZYOA 1H6UA 4ARNA 4M7EA 1A9NA 2R9UA 3A79B 3BZ5A 2Z82A 4U09A 3W3NA 3UN9A 1JL5A 1IO0A 5D3IA 1OTMA 2XOTA 2O6QA 5AWAA 1LTXA 3E4GA 2OMVA 4L3FA 3FXIA 1DCEA 4AY9X 2BEXA 3C6PB 1XCDA 1PGVA 1P8TA 5AZ5A 4XOSA 3O53A 3OGLB 3OGMB 2V9TB 1P8VA 4CC4C 4GT6A 4QC0A 4GLPA 1OZNA 4K17A 5GS2B 1K5GC 4BV4R 3GOZA 4UFRA 4Z61C 4FHOA 5B4PA 1OGQA 3RFJA 2O6SA 3SB4A 2P1QB 3VQ2A 2WQVA 4LXRA 2P1MB 5FTTB 4Z8GA 5HZLB 2A0ZA 2V70A 3TSRE 4XSQA 1M9SA 5IJBA 3ZYNA 1H6TA 4L3AA 4MQWX 5GMHA 4FD0A 2ELLA 1O6SA 4XGOA 4LXSA 5GQRK 3WPGA 4R0AA 4R08A 2Z66A 2WFHA 1G9UA 2FT3A 4Z64C 5A5CA 3RJ0A 4R09A 4V2CA 4M7EC 1ZIWA 4C2BB 1OTOA 4LSAA 1Z7XW 2OMUA 3RW6A 3UL8A 4PQ8A 4ECNA 1QYYA 4OQTA 4TZHA 4EZGA 4PEQB 2WQUA 1OTNA 3E6JA 3UL9A 4FMZA 4FCGA 4NKHA 3UL7A 2Z81A 4J4LA 2XWTC 3DZEA 3RGZA 4R58A 3ZYIA 2JE1A 3G3AA 4R5CA 5GS0A 4R07A 5IYXC 5B0NA 1U0ND 3VQ1A 2OMYA 1O6VA 3W3GA 2P1NB 4H09A 1XWDC 4CILA 4LSXA 3ULUA 3RW7A 1FT8A 3O6NA 3WPDA 2ID5A 1FQVA 3WPBA 3W3KA 2JE0A 3W3LA 1WWLA 4B8CD 4QBZA 4FDWA 4WYKA 5IJCA 3WPHA 4V2EA 3CIGA 4CP6A 1M9LA 1O6TA 2RR6A 4RCAB 5HDHA 4U7LA 2JQDA 4KNGA 4Q3IA 3M19A 1DS9A 4WP6A 4C2AB 2OMZA 4Q62A 3G06A 3OJAA 2OMTA 4U06A 5GMGA 2V9SA 2ASTB 3OJAB 3WN4A 4I6JB 4R6GA 1DFJI 3WPIA 3PMHG 4KXFB 2RA8A 5AWBA 3W3MA 4FS7A 3C6NB 3M18A 4PKIG 2P1PB 3WPCA 3WPEA 1M10B 3P72A 3G04C 4R6JA 2O6RA 4BSUA 4G8AA 5CMPA 5AWCA 2Z64A 4MN8B 2OMWA 1M0ZA 5LFNA 3C6OB 1OOKG 4ECOA 4LI1A 4ARRA 4QXEA 1GWBA 4LSXC 2P1OB 4RCWA 1FS2A 2Z63A 4Y61B 5GMFA 2BNHA 4HQ1A 4CNMA 4LSCA 4IM6A 4J0MA 1FO1A 3REZA 3G3BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IFG A;  3RGX A;  5CMN A;  2Q4G W;  4Z94 G;  4R6F A;  3CVR A;  4RWT C;  4AW4 A;  4Z79 A;  3G39 A;  3RIZ A;  4U08 A;  1W8A A;  4YEB B;  4KT1 A;  3WPF A;  3ULA A;  4PSJ A;  5B0T A;  4CC4 A;  2UZX A;  3W3J A;  2WQX A;  4R5D A;  1XEU A;  1YRG A;  4LI2 A;  4BSS A;  3RFE A;  4BSR A;  4P8S A;  3OGK B;  1A4Y A;  3RFS A;  4Q3G A;  2UZY A;  4CNC A;  3ULV A;  2ASS B;  2Z7X A;  1SQ0 B;  5IJD A;  4R6A A;  1D0B A;  3ZYJ A;  1KOH A;  2Y5Q A;  4PER A;  2WQW A;  4V2D A;  2Z7X B;  4P91 A;  3E3Z A;  2CA6 A;  2Z62 A;  1XEC A;  3JB9 j;  1K5D C;  2OMX A;  3CIY A;  3KJ4 A;  2Z65 A;  4NKG A;  3E2J A;  1XKU A;  5AWD A;  1KOO A;  1P9A G;  3ZYO A;  1H6U A;  4ARN A;  4M7E A;  1A9N A;  2R9U A;  3A79 B;  3BZ5 A;  2Z82 A;  4U09 A;  3W3N A;  3UN9 A;  1JL5 A;  1IO0 A;  5D3I A;  1OTM A;  2XOT A;  2O6Q A;  5AWA A;  1LTX A;  3E4G A;  2OMV A;  4L3F A;  3FXI A;  1DCE A;  4AY9 X;  2BEX A;  3C6P B;  1XCD A;  1PGV A;  1P8T A;  5AZ5 A;  4XOS A;  3O53 A;  3OGL B;  3OGM B;  2V9T B;  1P8V A;  4CC4 C;  4GT6 A;  4QC0 A;  4GLP A;  1OZN A;  4K17 A;  5GS2 B;  1K5G C;  4BV4 R;  3GOZ A;  4UFR A;  4Z61 C;  4FHO A;  5B4P A;  1OGQ A;  3RFJ A;  2O6S A;  3SB4 A;  2P1Q B;  3VQ2 A;  2WQV A;  4LXR A;  2P1M B;  5FTT B;  4Z8G A;  5HZL B;  2A0Z A;  2V70 A;  3TSR E;  4XSQ A;  1M9S A;  5IJB A;  3ZYN A;  1H6T A;  4L3A A;  4MQW X;  5GMH A;  4FD0 A;  2ELL A;  1O6S A;  4XGO A;  4LXS A;  5GQR K;  3WPG A;  4R0A A;  4R08 A;  2Z66 A;  2WFH A;  1G9U A;  2FT3 A;  4Z64 C;  5A5C A;  3RJ0 A;  4R09 A;  4V2C A;  4M7E C;  1ZIW A;  4C2B B;  1OTO A;  4LSA A;  1Z7X W;  2OMU A;  3RW6 A;  3UL8 A;  4PQ8 A;  4ECN A;  1QYY A;  4OQT A;  4TZH A;  4EZG A;  4PEQ B;  2WQU A;  1OTN A;  3E6J A;  3UL9 A;  4FMZ A;  4FCG A;  4NKH A;  3UL7 A;  2Z81 A;  4J4L A;  2XWT C;  3DZE A;  3RGZ A;  4R58 A;  3ZYI A;  2JE1 A;  3G3A A;  4R5C A;  5GS0 A;  4R07 A;  5IYX C;  5B0N A;  1U0N D;  3VQ1 A;  2OMY A;  1O6V A;  3W3G A;  2P1N B;  4H09 A;  1XWD C;  4CIL A;  4LSX A;  3ULU A;  3RW7 A;  1FT8 A;  3O6N A;  3WPD A;  2ID5 A;  1FQV A;  3WPB A;  3W3K A;  2JE0 A;  3W3L A;  1WWL A;  4B8C D;  4QBZ A;  4FDW A;  4WYK A;  5IJC A;  3WPH A;  4V2E A;  3CIG A;  4CP6 A;  1M9L A;  1O6T A;  2RR6 A;  4RCA B;  5HDH A;  4U7L A;  2JQD A;  4KNG A;  4Q3I A;  3M19 A;  1DS9 A;  4WP6 A;  4C2A B;  2OMZ A;  4Q62 A;  3G06 A;  3OJA A;  2OMT A;  4U06 A;  5GMG A;  2V9S A;  2AST B;  3OJA B;  3WN4 A;  4I6J B;  4R6G A;  1DFJ I;  3WPI A;  3PMH G;  4KXF B;  2RA8 A;  5AWB A;  3W3M A;  4FS7 A;  3C6N B;  3M18 A;  4PKI G;  2P1P B;  3WPC A;  3WPE A;  1M10 B;  3P72 A;  3G04 C;  4R6J A;  2O6R A;  4BSU A;  4G8A A;  5CMP A;  5AWC A;  2Z64 A;  4MN8 B;  2OMW A;  1M0Z A;  5LFN A;  3C6O B;  1OOK G;  4ECO A;  4LI1 A;  4ARR A;  4QXE A;  1GWB A;  4LSX C;  2P1O B;  4RCW A;  1FS2 A;  2Z63 A;  4Y61 B;  5GMF A;  2BNH A;  4HQ1 A;  4CNM A;  4LSC A;  4IM6 A;  4J0M A;  1FO1 A;  3REZ A;  3G3B A; 
#chains in the Genus database with same CATH topology
 2IFG A;  3RGX A;  5CMN A;  2Q4G W;  4Z94 G;  4R6F A;  3CVR A;  4RWT C;  4AW4 A;  4Z79 A;  3G39 A;  3RIZ A;  4NZT M;  4U08 A;  1W8A A;  4YEB B;  4KT1 A;  3WPF A;  3ULA A;  4PSJ A;  5B0T A;  4CC4 A;  2UZX A;  3W3J A;  4NZR M;  2WQX A;  4R5D A;  1XEU A;  1YRG A;  4LI2 A;  4BSS A;  3RFE A;  4BSR A;  4P8S A;  3OGK B;  1A4Y A;  3RFS A;  4Q3G A;  2UZY A;  4CNC A;  3ULV A;  2ASS B;  2Z7X A;  1SQ0 B;  5IJD A;  4R6A A;  1D0B A;  3ZYJ A;  1KOH A;  2Y5Q A;  4PER A;  2WQW A;  4V2D A;  2Z7X B;  4P91 A;  3E3Z A;  2CA6 A;  2Z62 A;  1XEC A;  3JB9 j;  1K5D C;  2OMX A;  3CIY A;  3KJ4 A;  2Z65 A;  4NKG A;  3E2J A;  1XKU A;  5AWD A;  1KOO A;  1P9A G;  3ZYO A;  1H6U A;  4ARN A;  4M7E A;  1A9N A;  2R9U A;  3A79 B;  3BZ5 A;  2Z82 A;  4U09 A;  3W3N A;  3UN9 A;  1JL5 A;  1IO0 A;  5D3I A;  1OTM A;  2XOT A;  2O6Q A;  5AWA A;  1LTX A;  3E4G A;  2OMV A;  4L3F A;  3FXI A;  1DCE A;  4AY9 X;  2BEX A;  3C6P B;  1XCD A;  1PGV A;  1P8T A;  5AZ5 A;  4XOS A;  3O53 A;  3OGL B;  3OGM B;  2V9T B;  1P8V A;  4CC4 C;  4GT6 A;  4QC0 A;  4GLP A;  1OZN A;  4K17 A;  5GS2 B;  1K5G C;  4BV4 R;  3GOZ A;  4UFR A;  4Z61 C;  4FHO A;  5B4P A;  1OGQ A;  3RFJ A;  2O6S A;  3SB4 A;  2P1Q B;  3VQ2 A;  2WQV A;  4LXR A;  2P1M B;  5FTT B;  4Z8G A;  5HZL B;  2A0Z A;  2V70 A;  3TSR E;  4XSQ A;  1M9S A;  5IJB A;  3ZYN A;  1H6T A;  4L3A A;  4MQW X;  5GMH A;  4FD0 A;  2ELL A;  1O6S A;  4XGO A;  4LXS A;  5GQR K;  3WPG A;  4R0A A;  4R08 A;  2Z66 A;  2WFH A;  1G9U A;  2FT3 A;  4Z64 C;  5A5C A;  3RJ0 A;  4R09 A;  4V2C A;  4M7E C;  1ZIW A;  4C2B B;  1OTO A;  4LSA A;  1Z7X W;  2OMU A;  3RW6 A;  3UL8 A;  4PQ8 A;  4ECN A;  1QYY A;  4OQT A;  4TZH A;  4EZG A;  4PEQ B;  2WQU A;  1OTN A;  3E6J A;  3UL9 A;  4FMZ A;  4FCG A;  4NKH A;  3UL7 A;  2Z81 A;  4J4L A;  2XWT C;  3DZE A;  3RGZ A;  4R58 A;  3ZYI A;  2JE1 A;  3G3A A;  4R5C A;  5GS0 A;  4R07 A;  5IYX C;  5B0N A;  1U0N D;  3VQ1 A;  2OMY A;  1O6V A;  3W3G A;  2P1N B;  4H09 A;  1XWD C;  4CIL A;  4LSX A;  3ULU A;  3RW7 A;  1FT8 A;  3O6N A;  3WPD A;  2ID5 A;  1FQV A;  3WPB A;  3W3K A;  2JE0 A;  3W3L A;  1WWL A;  4B8C D;  4QBZ A;  4FDW A;  4WYK A;  5IJC A;  3WPH A;  4V2E A;  3CIG A;  4CP6 A;  1M9L A;  1O6T A;  2RR6 A;  4RCA B;  5HDH A;  4U7L A;  2JQD A;  4KNG A;  4Q3I A;  3M19 A;  1DS9 A;  4WP6 A;  4C2A B;  2OMZ A;  4Q62 A;  3G06 A;  3OJA A;  2OMT A;  4U06 A;  5GMG A;  2V9S A;  2AST B;  3OJA B;  3WN4 A;  4I6J B;  4R6G A;  1DFJ I;  3WPI A;  3PMH G;  4KXF B;  2RA8 A;  5AWB A;  3W3M A;  4FS7 A;  3C6N B;  3M18 A;  4PKI G;  2P1P B;  3WPC A;  3WPE A;  1M10 B;  3P72 A;  3G04 C;  4R6J A;  2O6R A;  4BSU A;  4G8A A;  5CMP A;  5AWC A;  2Z64 A;  4MN8 B;  2OMW A;  1M0Z A;  5LFN A;  3C6O B;  1OOK G;  4ECO A;  4LI1 A;  4ARR A;  4QXE A;  1GWB A;  4LSX C;  2P1O B;  4RCW A;  1FS2 A;  2Z63 A;  4Y61 B;  5GMF A;  2BNH A;  4HQ1 A;  4CNM A;  4LSC A;  4IM6 A;  4J0M A;  1FO1 A;  3REZ A;  3G3B A; 
#chains in the Genus database with same CATH homology
 2IFG A;  3RGX A;  5CMN A;  2Q4G W;  4Z94 G;  4R6F A;  3CVR A;  4RWT C;  4AW4 A;  4Z79 A;  3G39 A;  3RIZ A;  4U08 A;  1W8A A;  4YEB B;  4KT1 A;  3WPF A;  3ULA A;  4PSJ A;  5B0T A;  4CC4 A;  2UZX A;  3W3J A;  2WQX A;  4R5D A;  1XEU A;  1YRG A;  4LI2 A;  4BSS A;  3RFE A;  4BSR A;  4P8S A;  3OGK B;  1A4Y A;  3RFS A;  4Q3G A;  2UZY A;  4CNC A;  3ULV A;  2ASS B;  2Z7X A;  1SQ0 B;  5IJD A;  4R6A A;  1D0B A;  3ZYJ A;  1KOH A;  2Y5Q A;  4PER A;  2WQW A;  4V2D A;  2Z7X B;  4P91 A;  3E3Z A;  2CA6 A;  2Z62 A;  1XEC A;  3JB9 j;  1K5D C;  2OMX A;  3CIY A;  3KJ4 A;  2Z65 A;  4NKG A;  3E2J A;  1XKU A;  5AWD A;  1KOO A;  1P9A G;  3ZYO A;  1H6U A;  4ARN A;  4M7E A;  1A9N A;  2R9U A;  3A79 B;  3BZ5 A;  2Z82 A;  4U09 A;  3W3N A;  3UN9 A;  1JL5 A;  1IO0 A;  5D3I A;  1OTM A;  2XOT A;  2O6Q A;  5AWA A;  1LTX A;  3E4G A;  2OMV A;  4L3F A;  3FXI A;  1DCE A;  4AY9 X;  2BEX A;  3C6P B;  1XCD A;  1PGV A;  1P8T A;  5AZ5 A;  4XOS A;  3O53 A;  3OGL B;  3OGM B;  2V9T B;  1P8V A;  4CC4 C;  4GT6 A;  4QC0 A;  4GLP A;  1OZN A;  4K17 A;  5GS2 B;  1K5G C;  4BV4 R;  3GOZ A;  4UFR A;  4Z61 C;  4FHO A;  5B4P A;  1OGQ A;  3RFJ A;  2O6S A;  3SB4 A;  2P1Q B;  3VQ2 A;  2WQV A;  4LXR A;  2P1M B;  5FTT B;  4Z8G A;  5HZL B;  2A0Z A;  2V70 A;  3TSR E;  4XSQ A;  1M9S A;  5IJB A;  3ZYN A;  1H6T A;  4L3A A;  4MQW X;  5GMH A;  4FD0 A;  2ELL A;  1O6S A;  4XGO A;  4LXS A;  5GQR K;  3WPG A;  4R0A A;  4R08 A;  2Z66 A;  2WFH A;  1G9U A;  2FT3 A;  4Z64 C;  5A5C A;  3RJ0 A;  4R09 A;  4V2C A;  4M7E C;  1ZIW A;  4C2B B;  1OTO A;  4LSA A;  1Z7X W;  2OMU A;  3RW6 A;  3UL8 A;  4PQ8 A;  4ECN A;  1QYY A;  4OQT A;  4TZH A;  4EZG A;  4PEQ B;  2WQU A;  1OTN A;  3E6J A;  3UL9 A;  4FMZ A;  4FCG A;  4NKH A;  3UL7 A;  2Z81 A;  4J4L A;  2XWT C;  3DZE A;  3RGZ A;  4R58 A;  3ZYI A;  2JE1 A;  3G3A A;  4R5C A;  5GS0 A;  4R07 A;  5IYX C;  5B0N A;  1U0N D;  3VQ1 A;  2OMY A;  1O6V A;  3W3G A;  2P1N B;  4H09 A;  1XWD C;  4CIL A;  4LSX A;  3ULU A;  3RW7 A;  1FT8 A;  3O6N A;  3WPD A;  2ID5 A;  1FQV A;  3WPB A;  3W3K A;  2JE0 A;  3W3L A;  1WWL A;  4B8C D;  4QBZ A;  4FDW A;  4WYK A;  5IJC A;  3WPH A;  4V2E A;  3CIG A;  4CP6 A;  1M9L A;  1O6T A;  2RR6 A;  4RCA B;  5HDH A;  4U7L A;  2JQD A;  4KNG A;  4Q3I A;  3M19 A;  1DS9 A;  4WP6 A;  4C2A B;  2OMZ A;  4Q62 A;  3G06 A;  3OJA A;  2OMT A;  4U06 A;  5GMG A;  2V9S A;  2AST B;  3OJA B;  3WN4 A;  4I6J B;  4R6G A;  1DFJ I;  3WPI A;  3PMH G;  4KXF B;  2RA8 A;  5AWB A;  3W3M A;  4FS7 A;  3C6N B;  3M18 A;  4PKI G;  2P1P B;  3WPC A;  3WPE A;  1M10 B;  3P72 A;  3G04 C;  4R6J A;  2O6R A;  4BSU A;  4G8A A;  5CMP A;  5AWC A;  2Z64 A;  4MN8 B;  2OMW A;  1M0Z A;  5LFN A;  3C6O B;  1OOK G;  4ECO A;  4LI1 A;  4ARR A;  4QXE A;  1GWB A;  4LSX C;  2P1O B;  4RCW A;  1FS2 A;  2Z63 A;  4Y61 B;  5GMF A;  2BNH A;  4HQ1 A;  4CNM A;  4LSC A;  4IM6 A;  4J0M A;  1FO1 A;  3REZ A;  3G3B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...