5A5CA

Structure of an engineered neuronal lrrtm2 adhesion molecule
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
330
structure length
330
Chain Sequence
MACPPKCRCEKLLFYCDSQGFHSVPNGLPSQLLGLSLRHNQLQSLPNGVFDKLTQLTWLHLDHNQLQSLPNGVFDKLTKLTELILSSNQLQSLPNGTFDKLTNLQNLDLSFNQLQSLPNGVFDKLTNLQTLHLRSNQLQSLPNGVFDKLTSLTFLDLSTNQLQSLPNGVFDKLTNLRELHLEHNQLQSLPNGVFDKLTSLTTLFLQWNQLQSLPNGVFDKLTNLEKLDLTGNQLQSLPNGVFDKLTNLKILLLDNNQLQSLPNGVFDKLKSLTTVGLSGNLWECSPRVCALASWLGSFQGRWEHSILCHSPDHTQGEDILDAVHGFQLCW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords LRRTM
publication title Crystal Structure of an Engineered Lrrtm2 Synaptic Adhesion Molecule and a Model for Neurexin Binding.
pubmed doi rcsb
source organism Synthetic construct
total genus 102
structure length 330
sequence length 330
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-06-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 5a5cA00
3ULUA 3WN4A 5AWCA 4U08A 4HQ1A 4MQWX 4OQTA 2CA6A 3W3NA 4R09A 3WPIA 2R9UA 2Z7XA 3GOZA 1K5DC 4XOSA 2ASTB 4Q3GA 4FDWA 2Z82A 2A0ZA 3WPDA 4U7LA 5IJBA 1P8TA 4LSAA 4FD0A 3O53A 4H09A 3M19A 5IYXC 1XKUA 3RGXA 4R5DA 3KJ4A 4U09A 4M7EC 1OTNA 3BZ5A 3RIZA 4R5CA 3UL9A 2Z64A 2OMUA 2OMZA 4Z79A 2P1OB 5AWBA 3G3BA 1XCDA 3ZYNA 1DFJI 1M10B 2OMYA 4PEQB 4R0AA 3VQ1A 4FHOA 1YRGA 5GS0A 2OMXA 2RA8A 2Q4GW 1H6UA 1A9NA 2ELLA 3CVRA 1OGQA 4R07A 3RW7A 2WQVA 4C2BB 2V9SA 1XWDC 4NKHA 3RFJA 3OJAB 3E4GA 4Q62A 4R6JA 3WPCA 1OTOA 3C6PB 5D3IA 4Y61B 3ZYJA 4AY9X 3UL7A 5IJDA 2P1NB 2O6QA 1G9UA 1QYYA 3DZEA 3G06A 4P8SA 2Z66A 4Z94G 2Y5QA 1FQVA 4QC0A 4EZGA 4FS7A 2OMTA 3E6JA 1ZIWA 3P72A 3G39A 4LSXA 4Z61C 1OZNA 4RCAB 4ARNA 4Z64C 1SQ0B 4KT1A 2WQUA 3W3GA 4CC4A 5B0TA 4CP6A 5LFNA 3REZA 1U0ND 4R6FA 4LI1A 3RFSA 1K5GC 3RW6A 5GS2B 3O6NA 2P1QB 4V2EA 4QXEA 4C2AB 5HZLB 2JE1A 2FT3A 3VQ2A 1D0BA 4V2DA 2O6RA 3E3ZA 3RGZA 3ZYOA 4I6JB 3WPGA 4PSJA 4NKGA 3JB9j 1JL5A 2V9TB 1O6TA 4BSUA 5A5CA 1LTXA 5GQRK 5FTTB 2UZXA 2IFGA 1IO0A 2ID5A 2Z81A 3ULAA 3G04C 5AZ5A 3UL8A 5AWAA 4U06A 3RJ0A 4TZHA 1XECA 4RWTC 4WYKA 4BSRA 2Z65A 1M0ZA 1FS2A 1H6TA 4CNMA 1XEUA 4FCGA 4K17A 4Z8GA 2OMVA 4KNGA 1O6VA 3ZYIA 4B8CD 2Z63A 4FMZA 4G8AA 3RFEA 2BNHA 1KOHA 3OGMB 3WPFA 3CIYA 5CMNA 5GMGA 3WPEA 2P1MB 4LXRA 2XOTA 4R6GA 4WP6A 3SB4A 2BEXA 4GLPA 4J0MA 4M7EA 5GMFA 2JE0A 2WQWA 3OGLB 2Z7XB 3UN9A 1DCEA 1DS9A 5IJCA 3C6NB 4AW4A 3TSRE 3OGKB 3FXIA 3WPHA 4KXFB 1OTMA 4UFRA 3PMHG 4PKIG 4GT6A 4Q3IA 2Z62A 1A4YA 4ARRA 4CNCA 3G3AA 1M9LA 4J4LA 3ULVA 4QBZA 2XWTC 4LSXC 4P91A 2V70A 4L3FA 2OMWA 1Z7XW 1P9AG 2JQDA 4V2CA 2RR6A 4MN8B 4XGOA 4LXSA 3M18A 2O6SA 1FO1A 4ECOA 4CC4C 4RCWA 5AWDA 3W3KA 4LI2A 4R08A 3E2JA 4L3AA 5B0NA 1PGVA 3A79B 5CMPA 4R58A 4CILA 5B4PA 4PQ8A 4BSSA 1OOKG 2ASSB 2P1PB 3CIGA 1GWBA 4LSCA 4YEBB 4BV4R 2WQXA 1KOOA 1P8VA 3OJAA 1FT8A 3W3JA 4IM6A 1M9SA 3WPBA 5GMHA 3W3MA 4ECNA 1O6SA 1WWLA 2WFHA 4R6AA 3W3LA 4XSQA 3C6OB 5HDHA 2UZYA 1W8AA 4PERA
chains in the Genus database with same CATH superfamily
3ULUA 3WN4A 5AWCA 4U08A 4HQ1A 4MQWX 4OQTA 2CA6A 3W3NA 4R09A 3WPIA 2R9UA 2Z7XA 3GOZA 1K5DC 4XOSA 2ASTB 4Q3GA 4FDWA 2Z82A 2A0ZA 3WPDA 4U7LA 5IJBA 1P8TA 4LSAA 4FD0A 3O53A 4H09A 3M19A 5IYXC 1XKUA 3RGXA 4R5DA 3KJ4A 4U09A 4M7EC 1OTNA 3BZ5A 3RIZA 4R5CA 3UL9A 2Z64A 2OMUA 2OMZA 4Z79A 2P1OB 5AWBA 3G3BA 1XCDA 3ZYNA 1DFJI 1M10B 2OMYA 4PEQB 4R0AA 3VQ1A 4FHOA 1YRGA 5GS0A 2OMXA 2RA8A 2Q4GW 1H6UA 1A9NA 2ELLA 3CVRA 1OGQA 4R07A 3RW7A 2WQVA 4C2BB 2V9SA 1XWDC 4NKHA 3RFJA 3OJAB 3E4GA 4Q62A 4R6JA 3WPCA 1OTOA 3C6PB 5D3IA 4Y61B 3ZYJA 4AY9X 3UL7A 5IJDA 2P1NB 2O6QA 1G9UA 1QYYA 3DZEA 3G06A 4P8SA 2Z66A 4Z94G 2Y5QA 1FQVA 4QC0A 4EZGA 4FS7A 2OMTA 3E6JA 1ZIWA 3P72A 3G39A 4LSXA 4NZTM 4Z61C 1OZNA 4RCAB 4ARNA 4Z64C 1SQ0B 4KT1A 2WQUA 3W3GA 4CC4A 5B0TA 4CP6A 5LFNA 3REZA 1U0ND 4R6FA 4LI1A 3RFSA 1K5GC 3RW6A 5GS2B 3O6NA 2P1QB 4V2EA 4QXEA 4C2AB 5HZLB 2JE1A 2FT3A 3VQ2A 1D0BA 4V2DA 2O6RA 3E3ZA 3RGZA 3ZYOA 4I6JB 3WPGA 4PSJA 4NKGA 3JB9j 1JL5A 2V9TB 1O6TA 4BSUA 5A5CA 1LTXA 5GQRK 5FTTB 2UZXA 2IFGA 1IO0A 2ID5A 2Z81A 3ULAA 3G04C 5AZ5A 3UL8A 5AWAA 4U06A 3RJ0A 4TZHA 1XECA 4RWTC 4WYKA 4BSRA 2Z65A 1M0ZA 1FS2A 1H6TA 4CNMA 1XEUA 4FCGA 4K17A 4Z8GA 2OMVA 4KNGA 1O6VA 3ZYIA 4B8CD 2Z63A 4FMZA 4G8AA 3RFEA 2BNHA 1KOHA 3OGMB 3WPFA 3CIYA 5CMNA 5GMGA 3WPEA 2P1MB 4LXRA 2XOTA 4R6GA 4WP6A 3SB4A 2BEXA 4GLPA 4J0MA 4M7EA 4NZRM 5GMFA 2JE0A 2WQWA 3OGLB 2Z7XB 3UN9A 1DCEA 1DS9A 5IJCA 3C6NB 4AW4A 3TSRE 3OGKB 3FXIA 3WPHA 4KXFB 1OTMA 4UFRA 3PMHG 4PKIG 4GT6A 4Q3IA 2Z62A 1A4YA 4ARRA 4CNCA 3G3AA 1M9LA 4J4LA 3ULVA 4QBZA 2XWTC 4LSXC 4P91A 2V70A 4L3FA 2OMWA 1Z7XW 1P9AG 2JQDA 4V2CA 2RR6A 4MN8B 4XGOA 4LXSA 3M18A 2O6SA 1FO1A 4ECOA 4CC4C 4RCWA 5AWDA 3W3KA 4LI2A 4R08A 3E2JA 4L3AA 5B0NA 1PGVA 3A79B 5CMPA 4R58A 4CILA 5B4PA 4PQ8A 4BSSA 1OOKG 2ASSB 2P1PB 3CIGA 1GWBA 4LSCA 4YEBB 4BV4R 2WQXA 1KOOA 1P8VA 3OJAA 1FT8A 3W3JA 4IM6A 1M9SA 3WPBA 5GMHA 3W3MA 4ECNA 1O6SA 1WWLA 2WFHA 4R6AA 3W3LA 4XSQA 3C6OB 5HDHA 2UZYA 1W8AA 4PERA
chains in the Genus database with same CATH topology
3ULUA 3WN4A 5AWCA 4U08A 4HQ1A 4MQWX 4OQTA 2CA6A 3W3NA 4R09A 3WPIA 2R9UA 2Z7XA 3GOZA 1K5DC 4XOSA 2ASTB 4Q3GA 4FDWA 2Z82A 2A0ZA 3WPDA 4U7LA 5IJBA 1P8TA 4LSAA 4FD0A 3O53A 4H09A 3M19A 5IYXC 1XKUA 3RGXA 4R5DA 3KJ4A 4U09A 4M7EC 1OTNA 3BZ5A 3RIZA 4R5CA 3UL9A 2Z64A 2OMUA 2OMZA 4Z79A 2P1OB 5AWBA 3G3BA 1XCDA 3ZYNA 1DFJI 1M10B 2OMYA 4PEQB 4R0AA 3VQ1A 4FHOA 1YRGA 5GS0A 2OMXA 2RA8A 2Q4GW 1H6UA 1A9NA 2ELLA 3CVRA 1OGQA 4R07A 3RW7A 2WQVA 4C2BB 2V9SA 1XWDC 4NKHA 3RFJA 3OJAB 3E4GA 4Q62A 4R6JA 3WPCA 1OTOA 3C6PB 5D3IA 4Y61B 3ZYJA 4AY9X 3UL7A 5IJDA 2P1NB 2O6QA 1G9UA 1QYYA 3DZEA 3G06A 4P8SA 2Z66A 4Z94G 2Y5QA 1FQVA 4QC0A 4EZGA 4FS7A 2OMTA 3E6JA 1ZIWA 3P72A 3G39A 4LSXA 4Z61C 1OZNA 4RCAB 4ARNA 4Z64C 1SQ0B 4KT1A 2WQUA 3W3GA 4CC4A 5B0TA 4CP6A 5LFNA 3REZA 1U0ND 4R6FA 4LI1A 3RFSA 1K5GC 3RW6A 5GS2B 3O6NA 2P1QB 4V2EA 4QXEA 4C2AB 5HZLB 2JE1A 2FT3A 3VQ2A 1D0BA 4V2DA 2O6RA 3E3ZA 3RGZA 3ZYOA 4I6JB 3WPGA 4PSJA 4NKGA 3JB9j 1JL5A 2V9TB 1O6TA 4BSUA 5A5CA 1LTXA 5GQRK 5FTTB 2UZXA 2IFGA 1IO0A 2ID5A 2Z81A 3ULAA 3G04C 5AZ5A 3UL8A 5AWAA 4U06A 3RJ0A 4TZHA 1XECA 4RWTC 4WYKA 4BSRA 2Z65A 1M0ZA 1FS2A 1H6TA 4CNMA 1XEUA 4FCGA 4K17A 4Z8GA 2OMVA 4KNGA 1O6VA 3ZYIA 4B8CD 2Z63A 4FMZA 4G8AA 3RFEA 2BNHA 1KOHA 3OGMB 3WPFA 3CIYA 5CMNA 5GMGA 3WPEA 2P1MB 4LXRA 2XOTA 4R6GA 4WP6A 3SB4A 2BEXA 4GLPA 4J0MA 4M7EA 5GMFA 2JE0A 2WQWA 3OGLB 2Z7XB 3UN9A 1DCEA 1DS9A 5IJCA 3C6NB 4AW4A 3TSRE 3OGKB 3FXIA 3WPHA 4KXFB 1OTMA 4UFRA 3PMHG 4PKIG 4GT6A 4Q3IA 2Z62A 1A4YA 4ARRA 4CNCA 3G3AA 1M9LA 4J4LA 3ULVA 4QBZA 2XWTC 4LSXC 4P91A 2V70A 4L3FA 2OMWA 1Z7XW 1P9AG 2JQDA 4V2CA 2RR6A 4MN8B 4XGOA 4LXSA 3M18A 2O6SA 1FO1A 4ECOA 4CC4C 4RCWA 5AWDA 3W3KA 4LI2A 4R08A 3E2JA 4L3AA 5B0NA 1PGVA 3A79B 5CMPA 4R58A 4CILA 5B4PA 4PQ8A 4BSSA 1OOKG 2ASSB 2P1PB 3CIGA 1GWBA 4LSCA 4YEBB 4BV4R 2WQXA 1KOOA 1P8VA 3OJAA 1FT8A 3W3JA 4IM6A 1M9SA 3WPBA 5GMHA 3W3MA 4ECNA 1O6SA 1WWLA 2WFHA 4R6AA 3W3LA 4XSQA 3C6OB 5HDHA 2UZYA 1W8AA 4PERA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ULU A;  3WN4 A;  5AWC A;  4U08 A;  4HQ1 A;  4MQW X;  4OQT A;  2CA6 A;  3W3N A;  4R09 A;  3WPI A;  2R9U A;  2Z7X A;  3GOZ A;  1K5D C;  4XOS A;  2AST B;  4Q3G A;  4FDW A;  2Z82 A;  2A0Z A;  3WPD A;  4U7L A;  5IJB A;  1P8T A;  4LSA A;  4FD0 A;  3O53 A;  4H09 A;  3M19 A;  5IYX C;  1XKU A;  3RGX A;  4R5D A;  3KJ4 A;  4U09 A;  4M7E C;  1OTN A;  3BZ5 A;  3RIZ A;  4R5C A;  3UL9 A;  2Z64 A;  2OMU A;  2OMZ A;  4Z79 A;  2P1O B;  5AWB A;  3G3B A;  1XCD A;  3ZYN A;  1DFJ I;  1M10 B;  2OMY A;  4PEQ B;  4R0A A;  3VQ1 A;  4FHO A;  1YRG A;  5GS0 A;  2OMX A;  2RA8 A;  2Q4G W;  1H6U A;  1A9N A;  2ELL A;  3CVR A;  1OGQ A;  4R07 A;  3RW7 A;  2WQV A;  4C2B B;  2V9S A;  1XWD C;  4NKH A;  3RFJ A;  3OJA B;  3E4G A;  4Q62 A;  4R6J A;  3WPC A;  1OTO A;  3C6P B;  5D3I A;  4Y61 B;  3ZYJ A;  4AY9 X;  3UL7 A;  5IJD A;  2P1N B;  2O6Q A;  1G9U A;  1QYY A;  3DZE A;  3G06 A;  4P8S A;  2Z66 A;  4Z94 G;  2Y5Q A;  1FQV A;  4QC0 A;  4EZG A;  4FS7 A;  2OMT A;  3E6J A;  1ZIW A;  3P72 A;  3G39 A;  4LSX A;  4Z61 C;  1OZN A;  4RCA B;  4ARN A;  4Z64 C;  1SQ0 B;  4KT1 A;  2WQU A;  3W3G A;  4CC4 A;  5B0T A;  4CP6 A;  5LFN A;  3REZ A;  1U0N D;  4R6F A;  4LI1 A;  3RFS A;  1K5G C;  3RW6 A;  5GS2 B;  3O6N A;  2P1Q B;  4V2E A;  4QXE A;  4C2A B;  5HZL B;  2JE1 A;  2FT3 A;  3VQ2 A;  1D0B A;  4V2D A;  2O6R A;  3E3Z A;  3RGZ A;  3ZYO A;  4I6J B;  3WPG A;  4PSJ A;  4NKG A;  3JB9 j;  1JL5 A;  2V9T B;  1O6T A;  4BSU A;  5A5C A;  1LTX A;  5GQR K;  5FTT B;  2UZX A;  2IFG A;  1IO0 A;  2ID5 A;  2Z81 A;  3ULA A;  3G04 C;  5AZ5 A;  3UL8 A;  5AWA A;  4U06 A;  3RJ0 A;  4TZH A;  1XEC A;  4RWT C;  4WYK A;  4BSR A;  2Z65 A;  1M0Z A;  1FS2 A;  1H6T A;  4CNM A;  1XEU A;  4FCG A;  4K17 A;  4Z8G A;  2OMV A;  4KNG A;  1O6V A;  3ZYI A;  4B8C D;  2Z63 A;  4FMZ A;  4G8A A;  3RFE A;  2BNH A;  1KOH A;  3OGM B;  3WPF A;  3CIY A;  5CMN A;  5GMG A;  3WPE A;  2P1M B;  4LXR A;  2XOT A;  4R6G A;  4WP6 A;  3SB4 A;  2BEX A;  4GLP A;  4J0M A;  4M7E A;  5GMF A;  2JE0 A;  2WQW A;  3OGL B;  2Z7X B;  3UN9 A;  1DCE A;  1DS9 A;  5IJC A;  3C6N B;  4AW4 A;  3TSR E;  3OGK B;  3FXI A;  3WPH A;  4KXF B;  1OTM A;  4UFR A;  3PMH G;  4PKI G;  4GT6 A;  4Q3I A;  2Z62 A;  1A4Y A;  4ARR A;  4CNC A;  3G3A A;  1M9L A;  4J4L A;  3ULV A;  4QBZ A;  2XWT C;  4LSX C;  4P91 A;  2V70 A;  4L3F A;  2OMW A;  1Z7X W;  1P9A G;  2JQD A;  4V2C A;  2RR6 A;  4MN8 B;  4XGO A;  4LXS A;  3M18 A;  2O6S A;  1FO1 A;  4ECO A;  4CC4 C;  4RCW A;  5AWD A;  3W3K A;  4LI2 A;  4R08 A;  3E2J A;  4L3A A;  5B0N A;  1PGV A;  3A79 B;  5CMP A;  4R58 A;  4CIL A;  5B4P A;  4PQ8 A;  4BSS A;  1OOK G;  2ASS B;  2P1P B;  3CIG A;  1GWB A;  4LSC A;  4YEB B;  4BV4 R;  2WQX A;  1KOO A;  1P8V A;  3OJA A;  1FT8 A;  3W3J A;  4IM6 A;  1M9S A;  3WPB A;  5GMH A;  3W3M A;  4ECN A;  1O6S A;  1WWL A;  2WFH A;  4R6A A;  3W3L A;  4XSQ A;  3C6O B;  5HDH A;  2UZY A;  1W8A A;  4PER A; 
#chains in the Genus database with same CATH topology
 3ULU A;  3WN4 A;  5AWC A;  4U08 A;  4HQ1 A;  4MQW X;  4OQT A;  2CA6 A;  3W3N A;  4R09 A;  3WPI A;  2R9U A;  2Z7X A;  3GOZ A;  1K5D C;  4XOS A;  2AST B;  4Q3G A;  4FDW A;  2Z82 A;  2A0Z A;  3WPD A;  4U7L A;  5IJB A;  1P8T A;  4LSA A;  4FD0 A;  3O53 A;  4H09 A;  3M19 A;  5IYX C;  1XKU A;  3RGX A;  4R5D A;  3KJ4 A;  4U09 A;  4M7E C;  1OTN A;  3BZ5 A;  3RIZ A;  4R5C A;  3UL9 A;  2Z64 A;  2OMU A;  2OMZ A;  4Z79 A;  2P1O B;  5AWB A;  3G3B A;  1XCD A;  3ZYN A;  1DFJ I;  1M10 B;  2OMY A;  4PEQ B;  4R0A A;  3VQ1 A;  4FHO A;  1YRG A;  5GS0 A;  2OMX A;  2RA8 A;  2Q4G W;  1H6U A;  1A9N A;  2ELL A;  3CVR A;  1OGQ A;  4R07 A;  3RW7 A;  2WQV A;  4C2B B;  2V9S A;  1XWD C;  4NKH A;  3RFJ A;  3OJA B;  3E4G A;  4Q62 A;  4R6J A;  3WPC A;  1OTO A;  3C6P B;  5D3I A;  4Y61 B;  3ZYJ A;  4AY9 X;  3UL7 A;  5IJD A;  2P1N B;  2O6Q A;  1G9U A;  1QYY A;  3DZE A;  3G06 A;  4P8S A;  2Z66 A;  4Z94 G;  2Y5Q A;  1FQV A;  4QC0 A;  4EZG A;  4FS7 A;  2OMT A;  3E6J A;  1ZIW A;  3P72 A;  3G39 A;  4LSX A;  4NZT M;  4Z61 C;  1OZN A;  4RCA B;  4ARN A;  4Z64 C;  1SQ0 B;  4KT1 A;  2WQU A;  3W3G A;  4CC4 A;  5B0T A;  4CP6 A;  5LFN A;  3REZ A;  1U0N D;  4R6F A;  4LI1 A;  3RFS A;  1K5G C;  3RW6 A;  5GS2 B;  3O6N A;  2P1Q B;  4V2E A;  4QXE A;  4C2A B;  5HZL B;  2JE1 A;  2FT3 A;  3VQ2 A;  1D0B A;  4V2D A;  2O6R A;  3E3Z A;  3RGZ A;  3ZYO A;  4I6J B;  3WPG A;  4PSJ A;  4NKG A;  3JB9 j;  1JL5 A;  2V9T B;  1O6T A;  4BSU A;  5A5C A;  1LTX A;  5GQR K;  5FTT B;  2UZX A;  2IFG A;  1IO0 A;  2ID5 A;  2Z81 A;  3ULA A;  3G04 C;  5AZ5 A;  3UL8 A;  5AWA A;  4U06 A;  3RJ0 A;  4TZH A;  1XEC A;  4RWT C;  4WYK A;  4BSR A;  2Z65 A;  1M0Z A;  1FS2 A;  1H6T A;  4CNM A;  1XEU A;  4FCG A;  4K17 A;  4Z8G A;  2OMV A;  4KNG A;  1O6V A;  3ZYI A;  4B8C D;  2Z63 A;  4FMZ A;  4G8A A;  3RFE A;  2BNH A;  1KOH A;  3OGM B;  3WPF A;  3CIY A;  5CMN A;  5GMG A;  3WPE A;  2P1M B;  4LXR A;  2XOT A;  4R6G A;  4WP6 A;  3SB4 A;  2BEX A;  4GLP A;  4J0M A;  4M7E A;  4NZR M;  5GMF A;  2JE0 A;  2WQW A;  3OGL B;  2Z7X B;  3UN9 A;  1DCE A;  1DS9 A;  5IJC A;  3C6N B;  4AW4 A;  3TSR E;  3OGK B;  3FXI A;  3WPH A;  4KXF B;  1OTM A;  4UFR A;  3PMH G;  4PKI G;  4GT6 A;  4Q3I A;  2Z62 A;  1A4Y A;  4ARR A;  4CNC A;  3G3A A;  1M9L A;  4J4L A;  3ULV A;  4QBZ A;  2XWT C;  4LSX C;  4P91 A;  2V70 A;  4L3F A;  2OMW A;  1Z7X W;  1P9A G;  2JQD A;  4V2C A;  2RR6 A;  4MN8 B;  4XGO A;  4LXS A;  3M18 A;  2O6S A;  1FO1 A;  4ECO A;  4CC4 C;  4RCW A;  5AWD A;  3W3K A;  4LI2 A;  4R08 A;  3E2J A;  4L3A A;  5B0N A;  1PGV A;  3A79 B;  5CMP A;  4R58 A;  4CIL A;  5B4P A;  4PQ8 A;  4BSS A;  1OOK G;  2ASS B;  2P1P B;  3CIG A;  1GWB A;  4LSC A;  4YEB B;  4BV4 R;  2WQX A;  1KOO A;  1P8V A;  3OJA A;  1FT8 A;  3W3J A;  4IM6 A;  1M9S A;  3WPB A;  5GMH A;  3W3M A;  4ECN A;  1O6S A;  1WWL A;  2WFH A;  4R6A A;  3W3L A;  4XSQ A;  3C6O B;  5HDH A;  2UZY A;  1W8A A;  4PER A; 
#chains in the Genus database with same CATH homology
 3ULU A;  3WN4 A;  5AWC A;  4U08 A;  4HQ1 A;  4MQW X;  4OQT A;  2CA6 A;  3W3N A;  4R09 A;  3WPI A;  2R9U A;  2Z7X A;  3GOZ A;  1K5D C;  4XOS A;  2AST B;  4Q3G A;  4FDW A;  2Z82 A;  2A0Z A;  3WPD A;  4U7L A;  5IJB A;  1P8T A;  4LSA A;  4FD0 A;  3O53 A;  4H09 A;  3M19 A;  5IYX C;  1XKU A;  3RGX A;  4R5D A;  3KJ4 A;  4U09 A;  4M7E C;  1OTN A;  3BZ5 A;  3RIZ A;  4R5C A;  3UL9 A;  2Z64 A;  2OMU A;  2OMZ A;  4Z79 A;  2P1O B;  5AWB A;  3G3B A;  1XCD A;  3ZYN A;  1DFJ I;  1M10 B;  2OMY A;  4PEQ B;  4R0A A;  3VQ1 A;  4FHO A;  1YRG A;  5GS0 A;  2OMX A;  2RA8 A;  2Q4G W;  1H6U A;  1A9N A;  2ELL A;  3CVR A;  1OGQ A;  4R07 A;  3RW7 A;  2WQV A;  4C2B B;  2V9S A;  1XWD C;  4NKH A;  3RFJ A;  3OJA B;  3E4G A;  4Q62 A;  4R6J A;  3WPC A;  1OTO A;  3C6P B;  5D3I A;  4Y61 B;  3ZYJ A;  4AY9 X;  3UL7 A;  5IJD A;  2P1N B;  2O6Q A;  1G9U A;  1QYY A;  3DZE A;  3G06 A;  4P8S A;  2Z66 A;  4Z94 G;  2Y5Q A;  1FQV A;  4QC0 A;  4EZG A;  4FS7 A;  2OMT A;  3E6J A;  1ZIW A;  3P72 A;  3G39 A;  4LSX A;  4Z61 C;  1OZN A;  4RCA B;  4ARN A;  4Z64 C;  1SQ0 B;  4KT1 A;  2WQU A;  3W3G A;  4CC4 A;  5B0T A;  4CP6 A;  5LFN A;  3REZ A;  1U0N D;  4R6F A;  4LI1 A;  3RFS A;  1K5G C;  3RW6 A;  5GS2 B;  3O6N A;  2P1Q B;  4V2E A;  4QXE A;  4C2A B;  5HZL B;  2JE1 A;  2FT3 A;  3VQ2 A;  1D0B A;  4V2D A;  2O6R A;  3E3Z A;  3RGZ A;  3ZYO A;  4I6J B;  3WPG A;  4PSJ A;  4NKG A;  3JB9 j;  1JL5 A;  2V9T B;  1O6T A;  4BSU A;  5A5C A;  1LTX A;  5GQR K;  5FTT B;  2UZX A;  2IFG A;  1IO0 A;  2ID5 A;  2Z81 A;  3ULA A;  3G04 C;  5AZ5 A;  3UL8 A;  5AWA A;  4U06 A;  3RJ0 A;  4TZH A;  1XEC A;  4RWT C;  4WYK A;  4BSR A;  2Z65 A;  1M0Z A;  1FS2 A;  1H6T A;  4CNM A;  1XEU A;  4FCG A;  4K17 A;  4Z8G A;  2OMV A;  4KNG A;  1O6V A;  3ZYI A;  4B8C D;  2Z63 A;  4FMZ A;  4G8A A;  3RFE A;  2BNH A;  1KOH A;  3OGM B;  3WPF A;  3CIY A;  5CMN A;  5GMG A;  3WPE A;  2P1M B;  4LXR A;  2XOT A;  4R6G A;  4WP6 A;  3SB4 A;  2BEX A;  4GLP A;  4J0M A;  4M7E A;  5GMF A;  2JE0 A;  2WQW A;  3OGL B;  2Z7X B;  3UN9 A;  1DCE A;  1DS9 A;  5IJC A;  3C6N B;  4AW4 A;  3TSR E;  3OGK B;  3FXI A;  3WPH A;  4KXF B;  1OTM A;  4UFR A;  3PMH G;  4PKI G;  4GT6 A;  4Q3I A;  2Z62 A;  1A4Y A;  4ARR A;  4CNC A;  3G3A A;  1M9L A;  4J4L A;  3ULV A;  4QBZ A;  2XWT C;  4LSX C;  4P91 A;  2V70 A;  4L3F A;  2OMW A;  1Z7X W;  1P9A G;  2JQD A;  4V2C A;  2RR6 A;  4MN8 B;  4XGO A;  4LXS A;  3M18 A;  2O6S A;  1FO1 A;  4ECO A;  4CC4 C;  4RCW A;  5AWD A;  3W3K A;  4LI2 A;  4R08 A;  3E2J A;  4L3A A;  5B0N A;  1PGV A;  3A79 B;  5CMP A;  4R58 A;  4CIL A;  5B4P A;  4PQ8 A;  4BSS A;  1OOK G;  2ASS B;  2P1P B;  3CIG A;  1GWB A;  4LSC A;  4YEB B;  4BV4 R;  2WQX A;  1KOO A;  1P8V A;  3OJA A;  1FT8 A;  3W3J A;  4IM6 A;  1M9S A;  3WPB A;  5GMH A;  3W3M A;  4ECN A;  1O6S A;  1WWL A;  2WFH A;  4R6A A;  3W3L A;  4XSQ A;  3C6O B;  5HDH A;  2UZY A;  1W8A A;  4PER A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...