5GMFA

Crystal structure of monkey tlr7 in complex with guanosine and polyu
Total Genus 259
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
259
sequence length
810
structure length
776
Chain Sequence
SPWARWFPKTLPCDVTLDVSKNHVIVDCTDKHLTEIPGGIPTNTTNLTLTINHIPDISPASFHRLVHLVEIDFRCNCVPIRLGSKSNMCPRRLQIKPRSFSGLTYLKSLYLDGNQLLEIPQGLPPSLQLLSLEANNIFSIRKEQLTELANIEILYLGQNCYYRNPCYVSYSIEKDAFLNLTKLKVLSLKDNNVTTVPTVLPSTLTELYLYNNMIAEIQEDDFNNLNQLQILDLSGNCPRCYNAPFPCTPCKNNSPLQIPVNAFDALTELKVLRLHSNSLQHVPPRWFKNINNLQELDLSQNFLAKEIGDAKFLHFLPNLIQLDLSFNFELQVYRASMNLSQAFSSLKSLKILRIRGYVFKELKSFQLSPLHNLQNLEVLDLGTNFIKIANLSMFKQFKRLKVIDLSVNKISPVLEQLYYFRYDKYARSCRFKSCYKYGQTLDLSKNSIFFIKSSDFQHLSFLKCLNLSGNLISQTLNGSEFQPLAELRYLDFSNNRLDLLHSTAFEELRKLEVLDISSNSHYFQSEGITHMLNFTKNLKVLQKLMMNDNDISSSTSRTMESESLRTLEFRGNHLDVLWRDGDNRYLQLFKNLLKLEELDISKNSLSFLPSGVFDGMPPNLKNLSLAKNGLKSFIWEKLRYLKNLETLDLSHNQLTTVPERLSNCSRSLKNLILKNNQIRSLTKYFLQDAFQLRYLDLSSNKIQMIQKTSFPENVLNNLKMLLLHHNRFLCTCDAVWFVWWVQHTEVTIPYLATDVTCVGPGAHKGQSVISLDLYTC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Immune system/rna
molecule keywords Toll-like receptor 7
publication title Structural Analysis Reveals that Toll-like Receptor 7 Is a Dual Receptor for Guanosine and Single-Stranded RNA
pubmed doi rcsb
source organism Macaca mulatta
total genus 259
structure length 776
sequence length 810
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2016-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13306 LRR_5 BspA type Leucine rich repeat region (6 copies)
A PF13855 LRR_8 Leucine rich repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 5gmfA00
3UL8A 1A4YA 3JB9j 5D3IA 4MQWX 2A0ZA 2WQWA 3RW6A 3RGZA 5GQRK 2Z63A 1LTXA 3ULAA 2WQXA 4R0AA 2WQUA 1U0ND 1D0BA 2BNHA 4V2EA 2Z65A 3CIYA 3O6NA 3RIZA 4Z94G 3ULUA 4R09A 2V70A 4LI2A 4KXFB 3FXIA 3GOZA 1DS9A 4LXSA 1WWLA 4U09A 2V9SA 4UFRA 4QXEA 4R5CA 4QBZA 2BEXA 2P1MB 2UZXA 4CC4A 4R6GA 4FCGA 1GWBA 1K5GC 3W3MA 4PEQB 1IO0A 2P1OB 3E6JA 3P72A 2JE0A 3G3BA 4Z61C 2ASSB 2OMTA 1M0ZA 4LSXA 3OGMB 2Z64A 5A5CA 4FMZA 4TZHA 4J4LA 5IJDA 2JE1A 2RR6A 3ZYNA 5AWDA 4Q3GA 4IM6A 3VQ1A 4AW4A 3W3LA 2P1QB 3CIGA 5IJBA 5CMPA 1M9SA 2ASTB 1FT8A 5AWAA 4U7LA 2O6RA 3M19A 1YRGA 4PQ8A 3RFSA 5GS2B 2O6SA 4L3AA 2P1PB 1PGVA 3E4GA 3OGKB 2Z62A 1KOHA 3KJ4A 1FQVA 2Q4GW 4C2AB 5B0TA 3O53A 3RFJA 1O6SA 3WPHA 3UL9A 4Z64C 3OJAA 4PKIG 1FO1A 4RWTC 5AWBA 3W3GA 3W3KA 1XECA 3OJAB 3TSRE 4R58A 4Q3IA 3C6OB 2Y5QA 3WPBA 2Z7XA 4EZGA 4K17A 3BZ5A 4V2DA 4RCWA 4LSCA 2Z7XB 1DCEA 4R6FA 3VQ2A 2WQVA 3C6NB 1M9LA 2UZYA 4WP6A 3WPDA 4P8SA 1OZNA 4ECNA 1XEUA 3G3AA 4U06A 1M10B 2ID5A 1FS2A 3E2JA 4KNGA 1O6TA 4C2BB 3WPGA 5GMHA 2O6QA 2OMVA 2R9UA 3REZA 4P91A 4Q62A 2CA6A 2Z82A 5GS0A 3RFEA 3RW7A 1K5DC 4CNCA 5B4PA 4YEBB 4FDWA 4CP6A 2FT3A 4ARRA 1G9UA 5HDHA 1XCDA 1XWDC 4FHOA 4Z8GA 4BSSA 1O6VA 5HZLB 5GMGA 2Z81A 4HQ1A 4V2CA 3ZYIA 1QYYA 3SB4A 2IFGA 1P9AG 1OGQA 3WPIA 3M18A 2WFHA 4LXRA 1OTNA 3RJ0A 4WYKA 4U08A 2JQDA 4R5DA 3ZYOA 4I6JB 1Z7XW 4MN8B 4CNMA 1ZIWA 3ZYJA 4BSRA 1OTOA 4PERA 4AY9X 1W8AA 5CMNA 3A79B 5FTTB 4CC4C 5AWCA 1OOKG 3DZEA 4BSUA 3RGXA 2OMZA 4FS7A 4B8CD 1XKUA 3W3JA 4OQTA 4FD0A 3G39A 4LSXC 3G06A 4ECOA 1H6UA 4NKHA 4Y61B 5GMFA 3UL7A 4ARNA 5AZ5A 4H09A 4BV4R 3WPEA 3WN4A 3CVRA 1P8TA 2Z66A 4J0MA 5LFNA 4NKGA 4QC0A 4GLPA 2RA8A 2V9TB 3WPFA 1OTMA 2OMUA 4PSJA 5IYXC 1JL5A 2OMWA 1A9NA 2ELLA 4M7EC 4G8AA 4L3FA 3OGLB 4LI1A 3G04C 2XWTC 2P1NB 1DFJI 1KOOA 4Z79A 1P8VA 3UN9A 2OMYA 4XGOA 3C6PB 3W3NA 3PMHG 4GT6A 4LSAA 4R6AA 3WPCA 3ULVA 4KT1A 4RCAB 2OMXA 4CILA 4R08A 5IJCA 4XSQA 4M7EA 2XOTA 4R07A 3E3ZA 4R6JA 4XOSA 1SQ0B 5B0NA 1H6TA
chains in the Genus database with same CATH superfamily
3UL8A 1A4YA 3JB9j 5D3IA 4MQWX 2A0ZA 2WQWA 3RW6A 3RGZA 5GQRK 2Z63A 1LTXA 3ULAA 2WQXA 4R0AA 2WQUA 1U0ND 1D0BA 2BNHA 4V2EA 2Z65A 3CIYA 3O6NA 3RIZA 4Z94G 3ULUA 4R09A 2V70A 4LI2A 4KXFB 3FXIA 3GOZA 1DS9A 4LXSA 1WWLA 4U09A 2V9SA 4UFRA 4QXEA 4R5CA 4QBZA 2BEXA 2P1MB 2UZXA 4CC4A 4R6GA 4FCGA 1GWBA 1K5GC 3W3MA 4PEQB 1IO0A 2P1OB 3E6JA 3P72A 2JE0A 3G3BA 4Z61C 2ASSB 2OMTA 1M0ZA 4LSXA 3OGMB 2Z64A 5A5CA 4FMZA 4TZHA 4J4LA 5IJDA 2JE1A 2RR6A 3ZYNA 5AWDA 4NZTM 4Q3GA 4IM6A 3VQ1A 4AW4A 3W3LA 2P1QB 3CIGA 5IJBA 5CMPA 1M9SA 2ASTB 1FT8A 5AWAA 4U7LA 2O6RA 3M19A 1YRGA 4PQ8A 3RFSA 5GS2B 2O6SA 4L3AA 2P1PB 1PGVA 3E4GA 3OGKB 2Z62A 1KOHA 3KJ4A 1FQVA 2Q4GW 4C2AB 5B0TA 3O53A 3RFJA 1O6SA 3WPHA 3UL9A 4Z64C 3OJAA 4PKIG 1FO1A 4RWTC 5AWBA 3W3GA 3W3KA 1XECA 3OJAB 3TSRE 4R58A 4Q3IA 3C6OB 2Y5QA 4NZRM 3WPBA 2Z7XA 4EZGA 4K17A 3BZ5A 4V2DA 4RCWA 4LSCA 2Z7XB 1DCEA 4R6FA 3VQ2A 2WQVA 3C6NB 1M9LA 2UZYA 4WP6A 3WPDA 4P8SA 1OZNA 4ECNA 1XEUA 3G3AA 4U06A 1M10B 2ID5A 1FS2A 3E2JA 4KNGA 1O6TA 4C2BB 3WPGA 5GMHA 2O6QA 2OMVA 2R9UA 3REZA 4P91A 4Q62A 2CA6A 2Z82A 5GS0A 3RFEA 3RW7A 1K5DC 4CNCA 5B4PA 4YEBB 4FDWA 4CP6A 2FT3A 4ARRA 1G9UA 5HDHA 1XCDA 1XWDC 4FHOA 4Z8GA 4BSSA 1O6VA 5HZLB 5GMGA 2Z81A 4HQ1A 4V2CA 3ZYIA 1QYYA 3SB4A 2IFGA 1P9AG 1OGQA 3WPIA 3M18A 2WFHA 4LXRA 1OTNA 3RJ0A 4WYKA 4U08A 2JQDA 4R5DA 3ZYOA 4I6JB 1Z7XW 4MN8B 4CNMA 1ZIWA 3ZYJA 4BSRA 1OTOA 4PERA 4AY9X 1W8AA 5CMNA 3A79B 5FTTB 4CC4C 5AWCA 1OOKG 3DZEA 4BSUA 3RGXA 2OMZA 4FS7A 4B8CD 1XKUA 3W3JA 4OQTA 4FD0A 3G39A 4LSXC 3G06A 4ECOA 1H6UA 4NKHA 4Y61B 5GMFA 3UL7A 4ARNA 5AZ5A 4H09A 4BV4R 3WPEA 3WN4A 3CVRA 1P8TA 2Z66A 4J0MA 5LFNA 4NKGA 4QC0A 4GLPA 2RA8A 2V9TB 3WPFA 1OTMA 2OMUA 4PSJA 5IYXC 1JL5A 2OMWA 1A9NA 2ELLA 4M7EC 4G8AA 4L3FA 3OGLB 4LI1A 3G04C 2XWTC 2P1NB 1DFJI 1KOOA 4Z79A 1P8VA 3UN9A 2OMYA 4XGOA 3C6PB 3W3NA 3PMHG 4GT6A 4LSAA 4R6AA 3WPCA 3ULVA 4KT1A 4RCAB 2OMXA 4CILA 4R08A 5IJCA 4XSQA 4M7EA 2XOTA 4R07A 3E3ZA 4R6JA 4XOSA 1SQ0B 5B0NA 1H6TA
chains in the Genus database with same CATH topology
3UL8A 1A4YA 3JB9j 5D3IA 4MQWX 2A0ZA 2WQWA 3RW6A 3RGZA 5GQRK 2Z63A 1LTXA 3ULAA 2WQXA 4R0AA 2WQUA 1U0ND 1D0BA 2BNHA 4V2EA 2Z65A 3CIYA 3O6NA 3RIZA 4Z94G 3ULUA 4R09A 2V70A 4LI2A 4KXFB 3FXIA 3GOZA 1DS9A 4LXSA 1WWLA 4U09A 2V9SA 4UFRA 4QXEA 4R5CA 4QBZA 2BEXA 2P1MB 2UZXA 4CC4A 4R6GA 4FCGA 1GWBA 1K5GC 3W3MA 4PEQB 1IO0A 2P1OB 3E6JA 3P72A 2JE0A 3G3BA 4Z61C 2ASSB 2OMTA 1M0ZA 4LSXA 3OGMB 2Z64A 5A5CA 4FMZA 4TZHA 4J4LA 5IJDA 2JE1A 2RR6A 3ZYNA 5AWDA 4Q3GA 4IM6A 3VQ1A 4AW4A 3W3LA 2P1QB 3CIGA 5IJBA 5CMPA 1M9SA 2ASTB 1FT8A 5AWAA 4U7LA 2O6RA 3M19A 1YRGA 4PQ8A 3RFSA 5GS2B 2O6SA 4L3AA 2P1PB 1PGVA 3E4GA 3OGKB 2Z62A 1KOHA 3KJ4A 1FQVA 2Q4GW 4C2AB 5B0TA 3O53A 3RFJA 1O6SA 3WPHA 3UL9A 4Z64C 3OJAA 4PKIG 1FO1A 4RWTC 5AWBA 3W3GA 3W3KA 1XECA 3OJAB 3TSRE 4R58A 4Q3IA 3C6OB 2Y5QA 3WPBA 2Z7XA 4EZGA 4K17A 3BZ5A 4V2DA 4RCWA 4LSCA 2Z7XB 1DCEA 4R6FA 3VQ2A 2WQVA 3C6NB 1M9LA 2UZYA 4WP6A 3WPDA 4P8SA 1OZNA 4ECNA 1XEUA 3G3AA 4U06A 1M10B 2ID5A 1FS2A 3E2JA 4KNGA 1O6TA 4C2BB 3WPGA 5GMHA 2O6QA 2OMVA 2R9UA 3REZA 4P91A 4Q62A 2CA6A 2Z82A 5GS0A 3RFEA 3RW7A 1K5DC 4CNCA 5B4PA 4YEBB 4FDWA 4CP6A 2FT3A 4ARRA 1G9UA 5HDHA 1XCDA 1XWDC 4FHOA 4Z8GA 4BSSA 1O6VA 5HZLB 5GMGA 2Z81A 4HQ1A 4V2CA 3ZYIA 1QYYA 3SB4A 2IFGA 1P9AG 1OGQA 3WPIA 3M18A 2WFHA 4LXRA 1OTNA 3RJ0A 4WYKA 4U08A 2JQDA 4R5DA 3ZYOA 4I6JB 1Z7XW 4MN8B 4CNMA 1ZIWA 3ZYJA 4BSRA 1OTOA 4PERA 4AY9X 1W8AA 5CMNA 3A79B 5FTTB 4CC4C 5AWCA 1OOKG 3DZEA 4BSUA 3RGXA 2OMZA 4FS7A 4B8CD 1XKUA 3W3JA 4OQTA 4FD0A 3G39A 4LSXC 3G06A 4ECOA 1H6UA 4NKHA 4Y61B 5GMFA 3UL7A 4ARNA 5AZ5A 4H09A 4BV4R 3WPEA 3WN4A 3CVRA 1P8TA 2Z66A 4J0MA 5LFNA 4NKGA 4QC0A 4GLPA 2RA8A 2V9TB 3WPFA 1OTMA 2OMUA 4PSJA 5IYXC 1JL5A 2OMWA 1A9NA 2ELLA 4M7EC 4G8AA 4L3FA 3OGLB 4LI1A 3G04C 2XWTC 2P1NB 1DFJI 1KOOA 4Z79A 1P8VA 3UN9A 2OMYA 4XGOA 3C6PB 3W3NA 3PMHG 4GT6A 4LSAA 4R6AA 3WPCA 3ULVA 4KT1A 4RCAB 2OMXA 4CILA 4R08A 5IJCA 4XSQA 4M7EA 2XOTA 4R07A 3E3ZA 4R6JA 4XOSA 1SQ0B 5B0NA 1H6TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UL8 A;  1A4Y A;  3JB9 j;  5D3I A;  4MQW X;  2A0Z A;  2WQW A;  3RW6 A;  3RGZ A;  5GQR K;  2Z63 A;  1LTX A;  3ULA A;  2WQX A;  4R0A A;  2WQU A;  1U0N D;  1D0B A;  2BNH A;  4V2E A;  2Z65 A;  3CIY A;  3O6N A;  3RIZ A;  4Z94 G;  3ULU A;  4R09 A;  2V70 A;  4LI2 A;  4KXF B;  3FXI A;  3GOZ A;  1DS9 A;  4LXS A;  1WWL A;  4U09 A;  2V9S A;  4UFR A;  4QXE A;  4R5C A;  4QBZ A;  2BEX A;  2P1M B;  2UZX A;  4CC4 A;  4R6G A;  4FCG A;  1GWB A;  1K5G C;  3W3M A;  4PEQ B;  1IO0 A;  2P1O B;  3E6J A;  3P72 A;  2JE0 A;  3G3B A;  4Z61 C;  2ASS B;  2OMT A;  1M0Z A;  4LSX A;  3OGM B;  2Z64 A;  5A5C A;  4FMZ A;  4TZH A;  4J4L A;  5IJD A;  2JE1 A;  2RR6 A;  3ZYN A;  5AWD A;  4Q3G A;  4IM6 A;  3VQ1 A;  4AW4 A;  3W3L A;  2P1Q B;  3CIG A;  5IJB A;  5CMP A;  1M9S A;  2AST B;  1FT8 A;  5AWA A;  4U7L A;  2O6R A;  3M19 A;  1YRG A;  4PQ8 A;  3RFS A;  5GS2 B;  2O6S A;  4L3A A;  2P1P B;  1PGV A;  3E4G A;  3OGK B;  2Z62 A;  1KOH A;  3KJ4 A;  1FQV A;  2Q4G W;  4C2A B;  5B0T A;  3O53 A;  3RFJ A;  1O6S A;  3WPH A;  3UL9 A;  4Z64 C;  3OJA A;  4PKI G;  1FO1 A;  4RWT C;  5AWB A;  3W3G A;  3W3K A;  1XEC A;  3OJA B;  3TSR E;  4R58 A;  4Q3I A;  3C6O B;  2Y5Q A;  3WPB A;  2Z7X A;  4EZG A;  4K17 A;  3BZ5 A;  4V2D A;  4RCW A;  4LSC A;  2Z7X B;  1DCE A;  4R6F A;  3VQ2 A;  2WQV A;  3C6N B;  1M9L A;  2UZY A;  4WP6 A;  3WPD A;  4P8S A;  1OZN A;  4ECN A;  1XEU A;  3G3A A;  4U06 A;  1M10 B;  2ID5 A;  1FS2 A;  3E2J A;  4KNG A;  1O6T A;  4C2B B;  3WPG A;  5GMH A;  2O6Q A;  2OMV A;  2R9U A;  3REZ A;  4P91 A;  4Q62 A;  2CA6 A;  2Z82 A;  5GS0 A;  3RFE A;  3RW7 A;  1K5D C;  4CNC A;  5B4P A;  4YEB B;  4FDW A;  4CP6 A;  2FT3 A;  4ARR A;  1G9U A;  5HDH A;  1XCD A;  1XWD C;  4FHO A;  4Z8G A;  4BSS A;  1O6V A;  5HZL B;  5GMG A;  2Z81 A;  4HQ1 A;  4V2C A;  3ZYI A;  1QYY A;  3SB4 A;  2IFG A;  1P9A G;  1OGQ A;  3WPI A;  3M18 A;  2WFH A;  4LXR A;  1OTN A;  3RJ0 A;  4WYK A;  4U08 A;  2JQD A;  4R5D A;  3ZYO A;  4I6J B;  1Z7X W;  4MN8 B;  4CNM A;  1ZIW A;  3ZYJ A;  4BSR A;  1OTO A;  4PER A;  4AY9 X;  1W8A A;  5CMN A;  3A79 B;  5FTT B;  4CC4 C;  5AWC A;  1OOK G;  3DZE A;  4BSU A;  3RGX A;  2OMZ A;  4FS7 A;  4B8C D;  1XKU A;  3W3J A;  4OQT A;  4FD0 A;  3G39 A;  4LSX C;  3G06 A;  4ECO A;  1H6U A;  4NKH A;  4Y61 B;  5GMF A;  3UL7 A;  4ARN A;  5AZ5 A;  4H09 A;  4BV4 R;  3WPE A;  3WN4 A;  3CVR A;  1P8T A;  2Z66 A;  4J0M A;  5LFN A;  4NKG A;  4QC0 A;  4GLP A;  2RA8 A;  2V9T B;  3WPF A;  1OTM A;  2OMU A;  4PSJ A;  5IYX C;  1JL5 A;  2OMW A;  1A9N A;  2ELL A;  4M7E C;  4G8A A;  4L3F A;  3OGL B;  4LI1 A;  3G04 C;  2XWT C;  2P1N B;  1DFJ I;  1KOO A;  4Z79 A;  1P8V A;  3UN9 A;  2OMY A;  4XGO A;  3C6P B;  3W3N A;  3PMH G;  4GT6 A;  4LSA A;  4R6A A;  3WPC A;  3ULV A;  4KT1 A;  4RCA B;  2OMX A;  4CIL A;  4R08 A;  5IJC A;  4XSQ A;  4M7E A;  2XOT A;  4R07 A;  3E3Z A;  4R6J A;  4XOS A;  1SQ0 B;  5B0N A;  1H6T A; 
#chains in the Genus database with same CATH topology
 3UL8 A;  1A4Y A;  3JB9 j;  5D3I A;  4MQW X;  2A0Z A;  2WQW A;  3RW6 A;  3RGZ A;  5GQR K;  2Z63 A;  1LTX A;  3ULA A;  2WQX A;  4R0A A;  2WQU A;  1U0N D;  1D0B A;  2BNH A;  4V2E A;  2Z65 A;  3CIY A;  3O6N A;  3RIZ A;  4Z94 G;  3ULU A;  4R09 A;  2V70 A;  4LI2 A;  4KXF B;  3FXI A;  3GOZ A;  1DS9 A;  4LXS A;  1WWL A;  4U09 A;  2V9S A;  4UFR A;  4QXE A;  4R5C A;  4QBZ A;  2BEX A;  2P1M B;  2UZX A;  4CC4 A;  4R6G A;  4FCG A;  1GWB A;  1K5G C;  3W3M A;  4PEQ B;  1IO0 A;  2P1O B;  3E6J A;  3P72 A;  2JE0 A;  3G3B A;  4Z61 C;  2ASS B;  2OMT A;  1M0Z A;  4LSX A;  3OGM B;  2Z64 A;  5A5C A;  4FMZ A;  4TZH A;  4J4L A;  5IJD A;  2JE1 A;  2RR6 A;  3ZYN A;  5AWD A;  4NZT M;  4Q3G A;  4IM6 A;  3VQ1 A;  4AW4 A;  3W3L A;  2P1Q B;  3CIG A;  5IJB A;  5CMP A;  1M9S A;  2AST B;  1FT8 A;  5AWA A;  4U7L A;  2O6R A;  3M19 A;  1YRG A;  4PQ8 A;  3RFS A;  5GS2 B;  2O6S A;  4L3A A;  2P1P B;  1PGV A;  3E4G A;  3OGK B;  2Z62 A;  1KOH A;  3KJ4 A;  1FQV A;  2Q4G W;  4C2A B;  5B0T A;  3O53 A;  3RFJ A;  1O6S A;  3WPH A;  3UL9 A;  4Z64 C;  3OJA A;  4PKI G;  1FO1 A;  4RWT C;  5AWB A;  3W3G A;  3W3K A;  1XEC A;  3OJA B;  3TSR E;  4R58 A;  4Q3I A;  3C6O B;  2Y5Q A;  4NZR M;  3WPB A;  2Z7X A;  4EZG A;  4K17 A;  3BZ5 A;  4V2D A;  4RCW A;  4LSC A;  2Z7X B;  1DCE A;  4R6F A;  3VQ2 A;  2WQV A;  3C6N B;  1M9L A;  2UZY A;  4WP6 A;  3WPD A;  4P8S A;  1OZN A;  4ECN A;  1XEU A;  3G3A A;  4U06 A;  1M10 B;  2ID5 A;  1FS2 A;  3E2J A;  4KNG A;  1O6T A;  4C2B B;  3WPG A;  5GMH A;  2O6Q A;  2OMV A;  2R9U A;  3REZ A;  4P91 A;  4Q62 A;  2CA6 A;  2Z82 A;  5GS0 A;  3RFE A;  3RW7 A;  1K5D C;  4CNC A;  5B4P A;  4YEB B;  4FDW A;  4CP6 A;  2FT3 A;  4ARR A;  1G9U A;  5HDH A;  1XCD A;  1XWD C;  4FHO A;  4Z8G A;  4BSS A;  1O6V A;  5HZL B;  5GMG A;  2Z81 A;  4HQ1 A;  4V2C A;  3ZYI A;  1QYY A;  3SB4 A;  2IFG A;  1P9A G;  1OGQ A;  3WPI A;  3M18 A;  2WFH A;  4LXR A;  1OTN A;  3RJ0 A;  4WYK A;  4U08 A;  2JQD A;  4R5D A;  3ZYO A;  4I6J B;  1Z7X W;  4MN8 B;  4CNM A;  1ZIW A;  3ZYJ A;  4BSR A;  1OTO A;  4PER A;  4AY9 X;  1W8A A;  5CMN A;  3A79 B;  5FTT B;  4CC4 C;  5AWC A;  1OOK G;  3DZE A;  4BSU A;  3RGX A;  2OMZ A;  4FS7 A;  4B8C D;  1XKU A;  3W3J A;  4OQT A;  4FD0 A;  3G39 A;  4LSX C;  3G06 A;  4ECO A;  1H6U A;  4NKH A;  4Y61 B;  5GMF A;  3UL7 A;  4ARN A;  5AZ5 A;  4H09 A;  4BV4 R;  3WPE A;  3WN4 A;  3CVR A;  1P8T A;  2Z66 A;  4J0M A;  5LFN A;  4NKG A;  4QC0 A;  4GLP A;  2RA8 A;  2V9T B;  3WPF A;  1OTM A;  2OMU A;  4PSJ A;  5IYX C;  1JL5 A;  2OMW A;  1A9N A;  2ELL A;  4M7E C;  4G8A A;  4L3F A;  3OGL B;  4LI1 A;  3G04 C;  2XWT C;  2P1N B;  1DFJ I;  1KOO A;  4Z79 A;  1P8V A;  3UN9 A;  2OMY A;  4XGO A;  3C6P B;  3W3N A;  3PMH G;  4GT6 A;  4LSA A;  4R6A A;  3WPC A;  3ULV A;  4KT1 A;  4RCA B;  2OMX A;  4CIL A;  4R08 A;  5IJC A;  4XSQ A;  4M7E A;  2XOT A;  4R07 A;  3E3Z A;  4R6J A;  4XOS A;  1SQ0 B;  5B0N A;  1H6T A; 
#chains in the Genus database with same CATH homology
 3UL8 A;  1A4Y A;  3JB9 j;  5D3I A;  4MQW X;  2A0Z A;  2WQW A;  3RW6 A;  3RGZ A;  5GQR K;  2Z63 A;  1LTX A;  3ULA A;  2WQX A;  4R0A A;  2WQU A;  1U0N D;  1D0B A;  2BNH A;  4V2E A;  2Z65 A;  3CIY A;  3O6N A;  3RIZ A;  4Z94 G;  3ULU A;  4R09 A;  2V70 A;  4LI2 A;  4KXF B;  3FXI A;  3GOZ A;  1DS9 A;  4LXS A;  1WWL A;  4U09 A;  2V9S A;  4UFR A;  4QXE A;  4R5C A;  4QBZ A;  2BEX A;  2P1M B;  2UZX A;  4CC4 A;  4R6G A;  4FCG A;  1GWB A;  1K5G C;  3W3M A;  4PEQ B;  1IO0 A;  2P1O B;  3E6J A;  3P72 A;  2JE0 A;  3G3B A;  4Z61 C;  2ASS B;  2OMT A;  1M0Z A;  4LSX A;  3OGM B;  2Z64 A;  5A5C A;  4FMZ A;  4TZH A;  4J4L A;  5IJD A;  2JE1 A;  2RR6 A;  3ZYN A;  5AWD A;  4Q3G A;  4IM6 A;  3VQ1 A;  4AW4 A;  3W3L A;  2P1Q B;  3CIG A;  5IJB A;  5CMP A;  1M9S A;  2AST B;  1FT8 A;  5AWA A;  4U7L A;  2O6R A;  3M19 A;  1YRG A;  4PQ8 A;  3RFS A;  5GS2 B;  2O6S A;  4L3A A;  2P1P B;  1PGV A;  3E4G A;  3OGK B;  2Z62 A;  1KOH A;  3KJ4 A;  1FQV A;  2Q4G W;  4C2A B;  5B0T A;  3O53 A;  3RFJ A;  1O6S A;  3WPH A;  3UL9 A;  4Z64 C;  3OJA A;  4PKI G;  1FO1 A;  4RWT C;  5AWB A;  3W3G A;  3W3K A;  1XEC A;  3OJA B;  3TSR E;  4R58 A;  4Q3I A;  3C6O B;  2Y5Q A;  3WPB A;  2Z7X A;  4EZG A;  4K17 A;  3BZ5 A;  4V2D A;  4RCW A;  4LSC A;  2Z7X B;  1DCE A;  4R6F A;  3VQ2 A;  2WQV A;  3C6N B;  1M9L A;  2UZY A;  4WP6 A;  3WPD A;  4P8S A;  1OZN A;  4ECN A;  1XEU A;  3G3A A;  4U06 A;  1M10 B;  2ID5 A;  1FS2 A;  3E2J A;  4KNG A;  1O6T A;  4C2B B;  3WPG A;  5GMH A;  2O6Q A;  2OMV A;  2R9U A;  3REZ A;  4P91 A;  4Q62 A;  2CA6 A;  2Z82 A;  5GS0 A;  3RFE A;  3RW7 A;  1K5D C;  4CNC A;  5B4P A;  4YEB B;  4FDW A;  4CP6 A;  2FT3 A;  4ARR A;  1G9U A;  5HDH A;  1XCD A;  1XWD C;  4FHO A;  4Z8G A;  4BSS A;  1O6V A;  5HZL B;  5GMG A;  2Z81 A;  4HQ1 A;  4V2C A;  3ZYI A;  1QYY A;  3SB4 A;  2IFG A;  1P9A G;  1OGQ A;  3WPI A;  3M18 A;  2WFH A;  4LXR A;  1OTN A;  3RJ0 A;  4WYK A;  4U08 A;  2JQD A;  4R5D A;  3ZYO A;  4I6J B;  1Z7X W;  4MN8 B;  4CNM A;  1ZIW A;  3ZYJ A;  4BSR A;  1OTO A;  4PER A;  4AY9 X;  1W8A A;  5CMN A;  3A79 B;  5FTT B;  4CC4 C;  5AWC A;  1OOK G;  3DZE A;  4BSU A;  3RGX A;  2OMZ A;  4FS7 A;  4B8C D;  1XKU A;  3W3J A;  4OQT A;  4FD0 A;  3G39 A;  4LSX C;  3G06 A;  4ECO A;  1H6U A;  4NKH A;  4Y61 B;  5GMF A;  3UL7 A;  4ARN A;  5AZ5 A;  4H09 A;  4BV4 R;  3WPE A;  3WN4 A;  3CVR A;  1P8T A;  2Z66 A;  4J0M A;  5LFN A;  4NKG A;  4QC0 A;  4GLP A;  2RA8 A;  2V9T B;  3WPF A;  1OTM A;  2OMU A;  4PSJ A;  5IYX C;  1JL5 A;  2OMW A;  1A9N A;  2ELL A;  4M7E C;  4G8A A;  4L3F A;  3OGL B;  4LI1 A;  3G04 C;  2XWT C;  2P1N B;  1DFJ I;  1KOO A;  4Z79 A;  1P8V A;  3UN9 A;  2OMY A;  4XGO A;  3C6P B;  3W3N A;  3PMH G;  4GT6 A;  4LSA A;  4R6A A;  3WPC A;  3ULV A;  4KT1 A;  4RCA B;  2OMX A;  4CIL A;  4R08 A;  5IJC A;  4XSQ A;  4M7E A;  2XOT A;  4R07 A;  3E3Z A;  4R6J A;  4XOS A;  1SQ0 B;  5B0N A;  1H6T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...