5GMGA

Crystal structure of monkey tlr7 in complex with loxoribine and polyu
Total Genus 252
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
252
sequence length
806
structure length
762
Chain Sequence
RWFPKTLPCDVTLDHVIVDCTDKHLTEIPGGIPTNTTNLTLTINHIPDISPASFHRLVHLVEIDFRCNCVPIRLGSKSNMCPRRLQIKPRSFSGLTYLKSLYLDGNQLLEIPQGLPPSLQLLSLEANNIFSIRKEQLTELANIEILYLGQNCYYRNPCYVSYSIEKDAFLNLTKLKVLSLKDNNVTTVPTVLPSTLTELYLYNNMIAEIQEDDFNNLNQLQILDLSGNCPRCYNAPFPCTPCKNNSPLQIPVNAFDALTELKVLRLHSNSLQHVPPRWFKNINNLQELDLSQNFLAKEIGDAKFLHFLPNLIQLDLSFNFELQVYRASMNLSQAFSSLKSLKILRIRGYVFKELKSFQLSPLHNLQNLEVLDLGTNFIKIANLSMFKQFKRLKVIDLSVNKISPLYYFRYDKYARSCRSCYKYGQTLDLSKNSIFFIKSSDFQHLSFLKCLNLSGNLISQTLNGSEFQPLAELRYLDFSNNRLDLLHSTAFEELRKLEVLDISSNSHYFQSEGITHMLNFTKNLKVLQKLMMNDNDISSSTSRTMESESLRTLEFRGNHLDVLWRDGDNRYLQLFKNLLKLEELDISKNSLSFLPSGVFDGMPPNLKNLSLAKNGLKSFIWEKLRYLKNLETLDLSHNQLTTVPERLSNCSRSLKNLILKNNQIRSLTKYFLQDAFQLRYLDLSSNKIQMIQKTSFPENVLNNLKMLLLHHNRFLCTCDAVWFVWWVQHTEVTIPYLATDVTCVGPGAHKGQSVISLDLYTC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Immune system/rna
molecule keywords Toll-like receptor 7
publication title Structural Analysis Reveals that Toll-like Receptor 7 Is a Dual Receptor for Guanosine and Single-Stranded RNA
pubmed doi rcsb
source organism Macaca mulatta
total genus 252
structure length 762
sequence length 806
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13306 LRR_5 BspA type Leucine rich repeat region (6 copies)
A PF13855 LRR_8 Leucine rich repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 5gmgA00
1GWBA 2Z63A 1DFJI 2Z62A 3RW7A 1Z7XW 2Q4GW 5GQRK 3REZA 2OMZA 4Z8GA 3OJAA 2Z64A 4TZHA 1DS9A 2IFGA 4UFRA 3OJAB 4MN8B 4YEBB 1XECA 3WPGA 3WPEA 3M19A 4V2EA 5D3IA 3WPCA 2O6SA 1JL5A 1SQ0B 5AWBA 5GMFA 4FHOA 4EZGA 5GS2B 4XSQA 3DZEA 2V9TB 2WFHA 3RIZA 3A79B 2BNHA 2JQDA 2CA6A 1H6TA 1KOHA 3WPDA 1ZIWA 4BSUA 5IJDA 4AW4A 4C2BB 1OTMA 4CNMA 3W3KA 1XEUA 5FTTB 5AWCA 3VQ1A 3ULUA 4IM6A 4R07A 3M18A 4H09A 3RGXA 1W8AA 4ECOA 2O6RA 3CIYA 3E2JA 5B0TA 5IJBA 1PGVA 5GS0A 3RFJA 2OMUA 3ULAA 2ID5A 2P1NB 3UL9A 4U7LA 4R6GA 1OOKG 5CMPA 1M9LA 4OQTA 3W3LA 4J0MA 4V2CA 3ZYIA 1P8TA 1O6SA 3W3GA 3RFEA 4FCGA 1FS2A 3WPFA 4GT6A 4P91A 1M9SA 4Z94G 2P1QB 2Y5QA 4LSXA 3RW6A 4FMZA 3RJ0A 2Z66A 3TSRE 1M0ZA 1LTXA 3ZYJA 4L3FA 4BSRA 3G3BA 4L3AA 1IO0A 1WWLA 2ASTB 1O6VA 4LXRA 4P8SA 4PQ8A 1XKUA 1K5DC 1YRGA 4U09A 1OTNA 2R9UA 1G9UA 2UZYA 3C6NB 4WP6A 4KT1A 5AWDA 3G39A 4LSCA 2OMVA 3KJ4A 3CIGA 3OGKB 1K5GC 4Z61C 5AZ5A 4I6JB 2P1PB 4RWTC 1KOOA 3FXIA 5CMNA 2OMWA 3WN4A 4BV4R 4FD0A 2V9SA 1OGQA 5B4PA 3G04C 4PSJA 3E6JA 1P8VA 4ECNA 1FO1A 1XCDA 4R6JA 2WQWA 4LSAA 1FT8A 4R0AA 4R5CA 4HQ1A 3RFSA 3W3MA 3BZ5A 4XOSA 5A5CA 4QXEA 4M7EA 2OMTA 1OTOA 4Z64C 1FQVA 4LSXC 4LXSA 2A0ZA 4R6FA 2OMYA 3PMHG 4CP6A 4MQWX 1U0ND 4AY9X 4XGOA 2WQVA 4U06A 4U08A 3WPBA 4CILA 1XWDC 3W3JA 3OGMB 2P1MB 2P1OB 1H6UA 2OMXA 3C6OB 4R08A 3OGLB 4FDWA 2BEXA 2FT3A 4NKGA 3C6PB 3RGZA 3WPHA 3JB9j 3G3AA 4R5DA 1D0BA 1O6TA 2Z82A 4LI2A 4Y61B 2Z81A 5LFNA 3O53A 2JE1A 3GOZA 2RA8A 4C2AB 2WQXA 4FS7A 4RCWA 4RCAB 4CNCA 1A4YA 2O6QA 3SB4A 4Q3IA 3O6NA 2ASSB 4PERA 4R58A 1QYYA 5IYXC 4QBZA 2Z65A 3CVRA 4R09A 3ULVA 3ZYNA 4Q62A 2UZXA 2WQUA 5GMHA 4PKIG 3UN9A 3W3NA 3WPIA 4KNGA 4M7EC 2XOTA 3UL8A 2RR6A 5HDHA 3G06A 1M10B 3UL7A 4Z79A 4Q3GA 2JE0A 4ARNA 4NKHA 4GLPA 3ZYOA 2XWTC 4B8CD 4CC4C 1DCEA 5B0NA 3VQ2A 5IJCA 4BSSA 4R6AA 4V2DA 4QC0A 3E3ZA 2Z7XA 4KXFB 4CC4A 2ELLA 1OZNA 4G8AA 4PEQB 4LI1A 4WYKA 2Z7XB 1P9AG 5HZLB 4ARRA 3E4GA 5AWAA 5GMGA 1A9NA 3P72A 4K17A 4J4LA 2V70A
chains in the Genus database with same CATH superfamily
1GWBA 4NZTM 2Z63A 1DFJI 2Z62A 3RW7A 1Z7XW 2Q4GW 5GQRK 3REZA 2OMZA 4Z8GA 3OJAA 2Z64A 4TZHA 1DS9A 2IFGA 4UFRA 3OJAB 4MN8B 4YEBB 1XECA 3WPGA 3WPEA 3M19A 4V2EA 5D3IA 3WPCA 2O6SA 1JL5A 1SQ0B 5AWBA 5GMFA 4FHOA 4EZGA 5GS2B 4XSQA 3DZEA 2V9TB 2WFHA 3RIZA 3A79B 2BNHA 2JQDA 2CA6A 1H6TA 1KOHA 3WPDA 1ZIWA 4BSUA 5IJDA 4AW4A 4C2BB 1OTMA 4CNMA 3W3KA 1XEUA 5FTTB 5AWCA 3VQ1A 3ULUA 4IM6A 4R07A 3M18A 4H09A 3RGXA 1W8AA 4ECOA 2O6RA 3CIYA 3E2JA 5B0TA 5IJBA 1PGVA 5GS0A 3RFJA 2OMUA 3ULAA 2ID5A 2P1NB 3UL9A 4U7LA 4R6GA 1OOKG 5CMPA 1M9LA 4OQTA 3W3LA 4J0MA 4V2CA 3ZYIA 1P8TA 1O6SA 3W3GA 3RFEA 4FCGA 1FS2A 3WPFA 4GT6A 4P91A 1M9SA 4Z94G 2P1QB 2Y5QA 4LSXA 3RW6A 4FMZA 3RJ0A 2Z66A 3TSRE 1M0ZA 1LTXA 3ZYJA 4L3FA 4BSRA 3G3BA 4L3AA 1IO0A 1WWLA 2ASTB 1O6VA 4LXRA 4P8SA 4PQ8A 1XKUA 1K5DC 1YRGA 4U09A 1OTNA 2R9UA 1G9UA 2UZYA 3C6NB 4WP6A 4KT1A 5AWDA 3G39A 4LSCA 2OMVA 3KJ4A 3CIGA 3OGKB 1K5GC 4Z61C 5AZ5A 4I6JB 2P1PB 4RWTC 1KOOA 3FXIA 5CMNA 2OMWA 3WN4A 4BV4R 4FD0A 2V9SA 1OGQA 5B4PA 3G04C 4PSJA 3E6JA 1P8VA 4ECNA 1FO1A 1XCDA 4NZRM 4R6JA 2WQWA 4LSAA 1FT8A 4R0AA 4R5CA 4HQ1A 3RFSA 3W3MA 3BZ5A 4XOSA 5A5CA 4QXEA 4M7EA 2OMTA 1OTOA 4Z64C 1FQVA 4LSXC 4LXSA 2A0ZA 4R6FA 2OMYA 3PMHG 4CP6A 4MQWX 1U0ND 4AY9X 4XGOA 2WQVA 4U06A 4U08A 3WPBA 4CILA 1XWDC 3W3JA 3OGMB 2P1MB 2P1OB 1H6UA 2OMXA 3C6OB 4R08A 3OGLB 4FDWA 2BEXA 2FT3A 4NKGA 3C6PB 3RGZA 3WPHA 3JB9j 3G3AA 4R5DA 1D0BA 1O6TA 2Z82A 4LI2A 4Y61B 2Z81A 5LFNA 3O53A 2JE1A 3GOZA 2RA8A 4C2AB 2WQXA 4FS7A 4RCWA 4RCAB 4CNCA 1A4YA 2O6QA 3SB4A 4Q3IA 3O6NA 2ASSB 4PERA 4R58A 1QYYA 5IYXC 4QBZA 2Z65A 3CVRA 4R09A 3ULVA 3ZYNA 4Q62A 2UZXA 2WQUA 5GMHA 4PKIG 3UN9A 3W3NA 3WPIA 4KNGA 4M7EC 2XOTA 3UL8A 2RR6A 5HDHA 3G06A 1M10B 3UL7A 4Z79A 4Q3GA 2JE0A 4ARNA 4NKHA 4GLPA 3ZYOA 2XWTC 4B8CD 4CC4C 1DCEA 5B0NA 3VQ2A 5IJCA 4BSSA 4R6AA 4V2DA 4QC0A 3E3ZA 2Z7XA 4KXFB 4CC4A 2ELLA 1OZNA 4G8AA 4PEQB 4LI1A 4WYKA 2Z7XB 1P9AG 5HZLB 4ARRA 3E4GA 5AWAA 5GMGA 1A9NA 3P72A 4K17A 4J4LA 2V70A
chains in the Genus database with same CATH topology
1GWBA 2Z63A 1DFJI 2Z62A 3RW7A 1Z7XW 2Q4GW 5GQRK 3REZA 2OMZA 4Z8GA 3OJAA 2Z64A 4TZHA 1DS9A 2IFGA 4UFRA 3OJAB 4MN8B 4YEBB 1XECA 3WPGA 3WPEA 3M19A 4V2EA 5D3IA 3WPCA 2O6SA 1JL5A 1SQ0B 5AWBA 5GMFA 4FHOA 4EZGA 5GS2B 4XSQA 3DZEA 2V9TB 2WFHA 3RIZA 3A79B 2BNHA 2JQDA 2CA6A 1H6TA 1KOHA 3WPDA 1ZIWA 4BSUA 5IJDA 4AW4A 4C2BB 1OTMA 4CNMA 3W3KA 1XEUA 5FTTB 5AWCA 3VQ1A 3ULUA 4IM6A 4R07A 3M18A 4H09A 3RGXA 1W8AA 4ECOA 2O6RA 3CIYA 3E2JA 5B0TA 5IJBA 1PGVA 5GS0A 3RFJA 2OMUA 3ULAA 2ID5A 2P1NB 3UL9A 4U7LA 4R6GA 1OOKG 5CMPA 1M9LA 4OQTA 3W3LA 4J0MA 4V2CA 3ZYIA 1P8TA 1O6SA 3W3GA 3RFEA 4FCGA 1FS2A 3WPFA 4GT6A 4P91A 1M9SA 4Z94G 2P1QB 2Y5QA 4LSXA 3RW6A 4FMZA 3RJ0A 2Z66A 3TSRE 1M0ZA 1LTXA 3ZYJA 4L3FA 4BSRA 3G3BA 4L3AA 1IO0A 1WWLA 2ASTB 1O6VA 4LXRA 4P8SA 4PQ8A 1XKUA 1K5DC 1YRGA 4U09A 1OTNA 2R9UA 1G9UA 2UZYA 3C6NB 4WP6A 4KT1A 5AWDA 3G39A 4LSCA 2OMVA 3KJ4A 3CIGA 3OGKB 1K5GC 4Z61C 5AZ5A 4I6JB 2P1PB 4RWTC 1KOOA 3FXIA 5CMNA 2OMWA 3WN4A 4BV4R 4FD0A 2V9SA 1OGQA 5B4PA 3G04C 4PSJA 3E6JA 1P8VA 4ECNA 1FO1A 1XCDA 4R6JA 2WQWA 4LSAA 1FT8A 4R0AA 4R5CA 4HQ1A 3RFSA 3W3MA 3BZ5A 4XOSA 5A5CA 4QXEA 4M7EA 2OMTA 1OTOA 4Z64C 1FQVA 4LSXC 4LXSA 2A0ZA 4R6FA 2OMYA 3PMHG 4CP6A 4MQWX 1U0ND 4AY9X 4XGOA 2WQVA 4U06A 4U08A 3WPBA 4CILA 1XWDC 3W3JA 3OGMB 2P1MB 2P1OB 1H6UA 2OMXA 3C6OB 4R08A 3OGLB 4FDWA 2BEXA 2FT3A 4NKGA 3C6PB 3RGZA 3WPHA 3JB9j 3G3AA 4R5DA 1D0BA 1O6TA 2Z82A 4LI2A 4Y61B 2Z81A 5LFNA 3O53A 2JE1A 3GOZA 2RA8A 4C2AB 2WQXA 4FS7A 4RCWA 4RCAB 4CNCA 1A4YA 2O6QA 3SB4A 4Q3IA 3O6NA 2ASSB 4PERA 4R58A 1QYYA 5IYXC 4QBZA 2Z65A 3CVRA 4R09A 3ULVA 3ZYNA 4Q62A 2UZXA 2WQUA 5GMHA 4PKIG 3UN9A 3W3NA 3WPIA 4KNGA 4M7EC 2XOTA 3UL8A 2RR6A 5HDHA 3G06A 1M10B 3UL7A 4Z79A 4Q3GA 2JE0A 4ARNA 4NKHA 4GLPA 3ZYOA 2XWTC 4B8CD 4CC4C 1DCEA 5B0NA 3VQ2A 5IJCA 4BSSA 4R6AA 4V2DA 4QC0A 3E3ZA 2Z7XA 4KXFB 4CC4A 2ELLA 1OZNA 4G8AA 4PEQB 4LI1A 4WYKA 2Z7XB 1P9AG 5HZLB 4ARRA 3E4GA 5AWAA 5GMGA 1A9NA 3P72A 4K17A 4J4LA 2V70A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GWB A;  2Z63 A;  1DFJ I;  2Z62 A;  3RW7 A;  1Z7X W;  2Q4G W;  5GQR K;  3REZ A;  2OMZ A;  4Z8G A;  3OJA A;  2Z64 A;  4TZH A;  1DS9 A;  2IFG A;  4UFR A;  3OJA B;  4MN8 B;  4YEB B;  1XEC A;  3WPG A;  3WPE A;  3M19 A;  4V2E A;  5D3I A;  3WPC A;  2O6S A;  1JL5 A;  1SQ0 B;  5AWB A;  5GMF A;  4FHO A;  4EZG A;  5GS2 B;  4XSQ A;  3DZE A;  2V9T B;  2WFH A;  3RIZ A;  3A79 B;  2BNH A;  2JQD A;  2CA6 A;  1H6T A;  1KOH A;  3WPD A;  1ZIW A;  4BSU A;  5IJD A;  4AW4 A;  4C2B B;  1OTM A;  4CNM A;  3W3K A;  1XEU A;  5FTT B;  5AWC A;  3VQ1 A;  3ULU A;  4IM6 A;  4R07 A;  3M18 A;  4H09 A;  3RGX A;  1W8A A;  4ECO A;  2O6R A;  3CIY A;  3E2J A;  5B0T A;  5IJB A;  1PGV A;  5GS0 A;  3RFJ A;  2OMU A;  3ULA A;  2ID5 A;  2P1N B;  3UL9 A;  4U7L A;  4R6G A;  1OOK G;  5CMP A;  1M9L A;  4OQT A;  3W3L A;  4J0M A;  4V2C A;  3ZYI A;  1P8T A;  1O6S A;  3W3G A;  3RFE A;  4FCG A;  1FS2 A;  3WPF A;  4GT6 A;  4P91 A;  1M9S A;  4Z94 G;  2P1Q B;  2Y5Q A;  4LSX A;  3RW6 A;  4FMZ A;  3RJ0 A;  2Z66 A;  3TSR E;  1M0Z A;  1LTX A;  3ZYJ A;  4L3F A;  4BSR A;  3G3B A;  4L3A A;  1IO0 A;  1WWL A;  2AST B;  1O6V A;  4LXR A;  4P8S A;  4PQ8 A;  1XKU A;  1K5D C;  1YRG A;  4U09 A;  1OTN A;  2R9U A;  1G9U A;  2UZY A;  3C6N B;  4WP6 A;  4KT1 A;  5AWD A;  3G39 A;  4LSC A;  2OMV A;  3KJ4 A;  3CIG A;  3OGK B;  1K5G C;  4Z61 C;  5AZ5 A;  4I6J B;  2P1P B;  4RWT C;  1KOO A;  3FXI A;  5CMN A;  2OMW A;  3WN4 A;  4BV4 R;  4FD0 A;  2V9S A;  1OGQ A;  5B4P A;  3G04 C;  4PSJ A;  3E6J A;  1P8V A;  4ECN A;  1FO1 A;  1XCD A;  4R6J A;  2WQW A;  4LSA A;  1FT8 A;  4R0A A;  4R5C A;  4HQ1 A;  3RFS A;  3W3M A;  3BZ5 A;  4XOS A;  5A5C A;  4QXE A;  4M7E A;  2OMT A;  1OTO A;  4Z64 C;  1FQV A;  4LSX C;  4LXS A;  2A0Z A;  4R6F A;  2OMY A;  3PMH G;  4CP6 A;  4MQW X;  1U0N D;  4AY9 X;  4XGO A;  2WQV A;  4U06 A;  4U08 A;  3WPB A;  4CIL A;  1XWD C;  3W3J A;  3OGM B;  2P1M B;  2P1O B;  1H6U A;  2OMX A;  3C6O B;  4R08 A;  3OGL B;  4FDW A;  2BEX A;  2FT3 A;  4NKG A;  3C6P B;  3RGZ A;  3WPH A;  3JB9 j;  3G3A A;  4R5D A;  1D0B A;  1O6T A;  2Z82 A;  4LI2 A;  4Y61 B;  2Z81 A;  5LFN A;  3O53 A;  2JE1 A;  3GOZ A;  2RA8 A;  4C2A B;  2WQX A;  4FS7 A;  4RCW A;  4RCA B;  4CNC A;  1A4Y A;  2O6Q A;  3SB4 A;  4Q3I A;  3O6N A;  2ASS B;  4PER A;  4R58 A;  1QYY A;  5IYX C;  4QBZ A;  2Z65 A;  3CVR A;  4R09 A;  3ULV A;  3ZYN A;  4Q62 A;  2UZX A;  2WQU A;  5GMH A;  4PKI G;  3UN9 A;  3W3N A;  3WPI A;  4KNG A;  4M7E C;  2XOT A;  3UL8 A;  2RR6 A;  5HDH A;  3G06 A;  1M10 B;  3UL7 A;  4Z79 A;  4Q3G A;  2JE0 A;  4ARN A;  4NKH A;  4GLP A;  3ZYO A;  2XWT C;  4B8C D;  4CC4 C;  1DCE A;  5B0N A;  3VQ2 A;  5IJC A;  4BSS A;  4R6A A;  4V2D A;  4QC0 A;  3E3Z A;  2Z7X A;  4KXF B;  4CC4 A;  2ELL A;  1OZN A;  4G8A A;  4PEQ B;  4LI1 A;  4WYK A;  2Z7X B;  1P9A G;  5HZL B;  4ARR A;  3E4G A;  5AWA A;  5GMG A;  1A9N A;  3P72 A;  4K17 A;  4J4L A;  2V70 A; 
#chains in the Genus database with same CATH topology
 1GWB A;  4NZT M;  2Z63 A;  1DFJ I;  2Z62 A;  3RW7 A;  1Z7X W;  2Q4G W;  5GQR K;  3REZ A;  2OMZ A;  4Z8G A;  3OJA A;  2Z64 A;  4TZH A;  1DS9 A;  2IFG A;  4UFR A;  3OJA B;  4MN8 B;  4YEB B;  1XEC A;  3WPG A;  3WPE A;  3M19 A;  4V2E A;  5D3I A;  3WPC A;  2O6S A;  1JL5 A;  1SQ0 B;  5AWB A;  5GMF A;  4FHO A;  4EZG A;  5GS2 B;  4XSQ A;  3DZE A;  2V9T B;  2WFH A;  3RIZ A;  3A79 B;  2BNH A;  2JQD A;  2CA6 A;  1H6T A;  1KOH A;  3WPD A;  1ZIW A;  4BSU A;  5IJD A;  4AW4 A;  4C2B B;  1OTM A;  4CNM A;  3W3K A;  1XEU A;  5FTT B;  5AWC A;  3VQ1 A;  3ULU A;  4IM6 A;  4R07 A;  3M18 A;  4H09 A;  3RGX A;  1W8A A;  4ECO A;  2O6R A;  3CIY A;  3E2J A;  5B0T A;  5IJB A;  1PGV A;  5GS0 A;  3RFJ A;  2OMU A;  3ULA A;  2ID5 A;  2P1N B;  3UL9 A;  4U7L A;  4R6G A;  1OOK G;  5CMP A;  1M9L A;  4OQT A;  3W3L A;  4J0M A;  4V2C A;  3ZYI A;  1P8T A;  1O6S A;  3W3G A;  3RFE A;  4FCG A;  1FS2 A;  3WPF A;  4GT6 A;  4P91 A;  1M9S A;  4Z94 G;  2P1Q B;  2Y5Q A;  4LSX A;  3RW6 A;  4FMZ A;  3RJ0 A;  2Z66 A;  3TSR E;  1M0Z A;  1LTX A;  3ZYJ A;  4L3F A;  4BSR A;  3G3B A;  4L3A A;  1IO0 A;  1WWL A;  2AST B;  1O6V A;  4LXR A;  4P8S A;  4PQ8 A;  1XKU A;  1K5D C;  1YRG A;  4U09 A;  1OTN A;  2R9U A;  1G9U A;  2UZY A;  3C6N B;  4WP6 A;  4KT1 A;  5AWD A;  3G39 A;  4LSC A;  2OMV A;  3KJ4 A;  3CIG A;  3OGK B;  1K5G C;  4Z61 C;  5AZ5 A;  4I6J B;  2P1P B;  4RWT C;  1KOO A;  3FXI A;  5CMN A;  2OMW A;  3WN4 A;  4BV4 R;  4FD0 A;  2V9S A;  1OGQ A;  5B4P A;  3G04 C;  4PSJ A;  3E6J A;  1P8V A;  4ECN A;  1FO1 A;  1XCD A;  4NZR M;  4R6J A;  2WQW A;  4LSA A;  1FT8 A;  4R0A A;  4R5C A;  4HQ1 A;  3RFS A;  3W3M A;  3BZ5 A;  4XOS A;  5A5C A;  4QXE A;  4M7E A;  2OMT A;  1OTO A;  4Z64 C;  1FQV A;  4LSX C;  4LXS A;  2A0Z A;  4R6F A;  2OMY A;  3PMH G;  4CP6 A;  4MQW X;  1U0N D;  4AY9 X;  4XGO A;  2WQV A;  4U06 A;  4U08 A;  3WPB A;  4CIL A;  1XWD C;  3W3J A;  3OGM B;  2P1M B;  2P1O B;  1H6U A;  2OMX A;  3C6O B;  4R08 A;  3OGL B;  4FDW A;  2BEX A;  2FT3 A;  4NKG A;  3C6P B;  3RGZ A;  3WPH A;  3JB9 j;  3G3A A;  4R5D A;  1D0B A;  1O6T A;  2Z82 A;  4LI2 A;  4Y61 B;  2Z81 A;  5LFN A;  3O53 A;  2JE1 A;  3GOZ A;  2RA8 A;  4C2A B;  2WQX A;  4FS7 A;  4RCW A;  4RCA B;  4CNC A;  1A4Y A;  2O6Q A;  3SB4 A;  4Q3I A;  3O6N A;  2ASS B;  4PER A;  4R58 A;  1QYY A;  5IYX C;  4QBZ A;  2Z65 A;  3CVR A;  4R09 A;  3ULV A;  3ZYN A;  4Q62 A;  2UZX A;  2WQU A;  5GMH A;  4PKI G;  3UN9 A;  3W3N A;  3WPI A;  4KNG A;  4M7E C;  2XOT A;  3UL8 A;  2RR6 A;  5HDH A;  3G06 A;  1M10 B;  3UL7 A;  4Z79 A;  4Q3G A;  2JE0 A;  4ARN A;  4NKH A;  4GLP A;  3ZYO A;  2XWT C;  4B8C D;  4CC4 C;  1DCE A;  5B0N A;  3VQ2 A;  5IJC A;  4BSS A;  4R6A A;  4V2D A;  4QC0 A;  3E3Z A;  2Z7X A;  4KXF B;  4CC4 A;  2ELL A;  1OZN A;  4G8A A;  4PEQ B;  4LI1 A;  4WYK A;  2Z7X B;  1P9A G;  5HZL B;  4ARR A;  3E4G A;  5AWA A;  5GMG A;  1A9N A;  3P72 A;  4K17 A;  4J4L A;  2V70 A; 
#chains in the Genus database with same CATH homology
 1GWB A;  2Z63 A;  1DFJ I;  2Z62 A;  3RW7 A;  1Z7X W;  2Q4G W;  5GQR K;  3REZ A;  2OMZ A;  4Z8G A;  3OJA A;  2Z64 A;  4TZH A;  1DS9 A;  2IFG A;  4UFR A;  3OJA B;  4MN8 B;  4YEB B;  1XEC A;  3WPG A;  3WPE A;  3M19 A;  4V2E A;  5D3I A;  3WPC A;  2O6S A;  1JL5 A;  1SQ0 B;  5AWB A;  5GMF A;  4FHO A;  4EZG A;  5GS2 B;  4XSQ A;  3DZE A;  2V9T B;  2WFH A;  3RIZ A;  3A79 B;  2BNH A;  2JQD A;  2CA6 A;  1H6T A;  1KOH A;  3WPD A;  1ZIW A;  4BSU A;  5IJD A;  4AW4 A;  4C2B B;  1OTM A;  4CNM A;  3W3K A;  1XEU A;  5FTT B;  5AWC A;  3VQ1 A;  3ULU A;  4IM6 A;  4R07 A;  3M18 A;  4H09 A;  3RGX A;  1W8A A;  4ECO A;  2O6R A;  3CIY A;  3E2J A;  5B0T A;  5IJB A;  1PGV A;  5GS0 A;  3RFJ A;  2OMU A;  3ULA A;  2ID5 A;  2P1N B;  3UL9 A;  4U7L A;  4R6G A;  1OOK G;  5CMP A;  1M9L A;  4OQT A;  3W3L A;  4J0M A;  4V2C A;  3ZYI A;  1P8T A;  1O6S A;  3W3G A;  3RFE A;  4FCG A;  1FS2 A;  3WPF A;  4GT6 A;  4P91 A;  1M9S A;  4Z94 G;  2P1Q B;  2Y5Q A;  4LSX A;  3RW6 A;  4FMZ A;  3RJ0 A;  2Z66 A;  3TSR E;  1M0Z A;  1LTX A;  3ZYJ A;  4L3F A;  4BSR A;  3G3B A;  4L3A A;  1IO0 A;  1WWL A;  2AST B;  1O6V A;  4LXR A;  4P8S A;  4PQ8 A;  1XKU A;  1K5D C;  1YRG A;  4U09 A;  1OTN A;  2R9U A;  1G9U A;  2UZY A;  3C6N B;  4WP6 A;  4KT1 A;  5AWD A;  3G39 A;  4LSC A;  2OMV A;  3KJ4 A;  3CIG A;  3OGK B;  1K5G C;  4Z61 C;  5AZ5 A;  4I6J B;  2P1P B;  4RWT C;  1KOO A;  3FXI A;  5CMN A;  2OMW A;  3WN4 A;  4BV4 R;  4FD0 A;  2V9S A;  1OGQ A;  5B4P A;  3G04 C;  4PSJ A;  3E6J A;  1P8V A;  4ECN A;  1FO1 A;  1XCD A;  4R6J A;  2WQW A;  4LSA A;  1FT8 A;  4R0A A;  4R5C A;  4HQ1 A;  3RFS A;  3W3M A;  3BZ5 A;  4XOS A;  5A5C A;  4QXE A;  4M7E A;  2OMT A;  1OTO A;  4Z64 C;  1FQV A;  4LSX C;  4LXS A;  2A0Z A;  4R6F A;  2OMY A;  3PMH G;  4CP6 A;  4MQW X;  1U0N D;  4AY9 X;  4XGO A;  2WQV A;  4U06 A;  4U08 A;  3WPB A;  4CIL A;  1XWD C;  3W3J A;  3OGM B;  2P1M B;  2P1O B;  1H6U A;  2OMX A;  3C6O B;  4R08 A;  3OGL B;  4FDW A;  2BEX A;  2FT3 A;  4NKG A;  3C6P B;  3RGZ A;  3WPH A;  3JB9 j;  3G3A A;  4R5D A;  1D0B A;  1O6T A;  2Z82 A;  4LI2 A;  4Y61 B;  2Z81 A;  5LFN A;  3O53 A;  2JE1 A;  3GOZ A;  2RA8 A;  4C2A B;  2WQX A;  4FS7 A;  4RCW A;  4RCA B;  4CNC A;  1A4Y A;  2O6Q A;  3SB4 A;  4Q3I A;  3O6N A;  2ASS B;  4PER A;  4R58 A;  1QYY A;  5IYX C;  4QBZ A;  2Z65 A;  3CVR A;  4R09 A;  3ULV A;  3ZYN A;  4Q62 A;  2UZX A;  2WQU A;  5GMH A;  4PKI G;  3UN9 A;  3W3N A;  3WPI A;  4KNG A;  4M7E C;  2XOT A;  3UL8 A;  2RR6 A;  5HDH A;  3G06 A;  1M10 B;  3UL7 A;  4Z79 A;  4Q3G A;  2JE0 A;  4ARN A;  4NKH A;  4GLP A;  3ZYO A;  2XWT C;  4B8C D;  4CC4 C;  1DCE A;  5B0N A;  3VQ2 A;  5IJC A;  4BSS A;  4R6A A;  4V2D A;  4QC0 A;  3E3Z A;  2Z7X A;  4KXF B;  4CC4 A;  2ELL A;  1OZN A;  4G8A A;  4PEQ B;  4LI1 A;  4WYK A;  2Z7X B;  1P9A G;  5HZL B;  4ARR A;  3E4G A;  5AWA A;  5GMG A;  1A9N A;  3P72 A;  4K17 A;  4J4L A;  2V70 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...