5GMHA

Crystal structure of monkey tlr7 in complex with r848
Total Genus 267
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
267
sequence length
809
structure length
772
Chain Sequence
ARWFPKTLPCDVTLDVSKNHVIVDCTDKHLTEIPGGIPTNTTNLTLTINHIPDISPASFHRLVHLVEIDFRCNCVPIRLGSKSNMCPRRLQIKPRSFSGLTYLKSLYLDGNQLLEIPQGLPPSLQLLSLEANNIFSIRKEQLTELANIEILYLGQNCYYRNPCYVSYSIEKDAFLNLTKLKVLSLKDNNVTTVPTVLPSTLTELYLYNNMIAEIQEDDFNNLNQLQILDLSGNCPRCYNAPFPCTPCKNNSPLQIPVNAFDALTELKVLRLHSNSLQHVPPRWFKNINNLQELDLSQNFLAKEIGDAKFLHFLPNLIQLDLSFNFELQVYRASMNLSQAFSSLKSLKILRIRGYVFKELKSFQLSPLHNLQNLEVLDLGTNFIKIANLSMFKQFKRLKVIDLSVNKISPVLEQLYYFRYDKYARSCSCYKYGQTLDLSKNSIFFIKSSDFQHLSFLKCLNLSGNLISQTLNGSEFQPLAELRYLDFSNNRLDLLHSTAFEELRKLEVLDISSNSHYFQSEGITHMLNFTKNLKVLQKLMMNDNDISSSTSRTMESESLRTLEFRGNHLDVLWRDGDNRYLQLFKNLLKLEELDISKNSLSFLPSGVFDGMPPNLKNLSLAKNGLKSFIWEKLRYLKNLETLDLSHNQLTTVPERLSNCSRSLKNLILKNNQIRSLTKYFLQDAFQLRYLDLSSNKIQMIQKTSFPENVLNNLKMLLLHHNRFLCTCDAVWFVWWVQHTEVTIPYLATDVTCVGPGAHKGQSVISLDLYTCEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Immune system
molecule keywords Toll-like receptor 7
publication title Structural Analysis Reveals that Toll-like Receptor 7 Is a Dual Receptor for Guanosine and Single-Stranded RNA
pubmed doi rcsb
source organism Macaca mulatta
total genus 267
structure length 772
sequence length 809
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13306 LRR_5 BspA type Leucine rich repeat region (6 copies)
A PF13855 LRR_8 Leucine rich repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 5gmhA00
2Z82A 4H09A 4R08A 3KJ4A 1H6UA 5GMHA 3C6NB 1W8AA 2P1OB 1WWLA 1QYYA 1OTOA 4MN8B 3PMHG 4C2AB 1M0ZA 4BSRA 4FHOA 1FQVA 2Z66A 3E6JA 3ZYJA 4OQTA 3WN4A 4CP6A 3WPFA 3WPGA 3M19A 4FMZA 3ULUA 3SB4A 3RGZA 2OMWA 4FS7A 3WPIA 4ARNA 3DZEA 3WPBA 2P1NB 4R6JA 2Y5QA 4Y61B 2WQVA 3G3AA 3JB9j 1K5GC 1XKUA 1GWBA 2RA8A 1P9AG 4Z61C 1G9UA 4J0MA 1A9NA 5GMFA 3VQ1A 4C2BB 3CIYA 4V2EA 3RFSA 3UL9A 3W3LA 4RCAB 2Z7XB 3WPCA 1U0ND 5IYXC 3GOZA 5AWDA 2R9UA 3ZYIA 4AW4A 5FTTB 4J4LA 3RGXA 1O6SA 4CC4C 4CNMA 3G06A 3ULVA 4R5DA 4V2DA 1KOOA 3W3JA 4WYKA 1YRGA 2WQWA 3E3ZA 4LSXC 4RCWA 3ZYNA 4ARRA 4CNCA 4R6FA 4CC4A 1OGQA 2V70A 2XWTC 4Q62A 1M10B 2P1MB 4L3FA 3C6OB 5B0TA 3E4GA 4G8AA 3OGMB 4Z94G 1DS9A 1DFJI 4UFRA 1IO0A 1KOHA 1SQ0B 2OMUA 2Z81A 4LSXA 4LI1A 1LTXA 3W3NA 3M18A 2Z64A 4FDWA 2OMVA 4NKGA 2A0ZA 5HZLB 1M9SA 5AWCA 5D3IA 1OTMA 4R6AA 4Z8GA 1M9LA 5GQRK 4ECNA 1Z7XW 4R0AA 2ASSB 3G39A 1H6TA 3OGKB 4LI2A 3UL8A 4R58A 4K17A 5IJCA 1A4YA 2WQXA 2ELLA 1PGVA 3G3BA 2WFHA 4Q3GA 3CIGA 3CVRA 4XOSA 4M7EC 4U06A 3RW7A 4BSUA 4PSJA 2ID5A 5CMNA 1FO1A 3C6PB 4YEBB 2CA6A 2UZXA 4LXSA 2BNHA 1O6TA 2O6SA 3ZYOA 3W3MA 4I6JB 4M7EA 3RFEA 4P91A 4FD0A 4PEQB 1OOKG 4PERA 4R5CA 3VQ2A 3TSRE 3RJ0A 5A5CA 3E2JA 4MQWX 4RWTC 1FS2A 2ASTB 1DCEA 1O6VA 2JE0A 5HDHA 4LSAA 3REZA 2V9TB 4PKIG 2UZYA 2Z63A 4HQ1A 2OMXA 2Q4GW 4KT1A 4GT6A 4PQ8A 4B8CD 3OJAA 3UN9A 1P8VA 4QBZA 1ZIWA 2JE1A 3W3KA 4KNGA 2Z65A 2XOTA 5LFNA 2BEXA 3OJAB 1XECA 4XSQA 3FXIA 4WP6A 2Z62A 4Z79A 2IFGA 4QC0A 2WQUA 1XEUA 4IM6A 3WPEA 3OGLB 4FCGA 4R09A 2O6QA 4V2CA 3BZ5A 3A79B 4ECOA 5AWAA 3RW6A 4GLPA 4U09A 4BSSA 2RR6A 3P72A 3O6NA 1D0BA 2JQDA 2O6RA 4EZGA 5GS0A 4AY9X 4R6GA 4U7LA 4QXEA 2V9SA 3UL7A 1OTNA 5B0NA 2Z7XA 5B4PA 3RIZA 3O53A 4LSCA 4P8SA 4LXRA 1OZNA 5AWBA 1XWDC 1P8TA 4Z64C 4NKHA 4BV4R 4TZHA 5AZ5A 2P1PB 1FT8A 4XGOA 4L3AA 3G04C 3WPHA 2OMTA 5IJBA 4KXFB 3RFJA 2FT3A 3WPDA 3ULAA 4R07A 1JL5A 2OMZA 1K5DC 4U08A 3W3GA 4Q3IA 1XCDA 5CMPA 5GS2B 5IJDA 4CILA 2OMYA 2P1QB 5GMGA
chains in the Genus database with same CATH superfamily
2Z82A 4H09A 4R08A 3KJ4A 1H6UA 5GMHA 3C6NB 1W8AA 2P1OB 1WWLA 1QYYA 1OTOA 4MN8B 3PMHG 4C2AB 1M0ZA 4BSRA 4FHOA 1FQVA 2Z66A 3E6JA 3ZYJA 4OQTA 3WN4A 4CP6A 3WPFA 3WPGA 3M19A 4FMZA 3ULUA 3SB4A 3RGZA 2OMWA 4FS7A 3WPIA 4ARNA 3DZEA 3WPBA 2P1NB 4R6JA 2Y5QA 4Y61B 2WQVA 3G3AA 3JB9j 1K5GC 1XKUA 1GWBA 2RA8A 1P9AG 4Z61C 1G9UA 4J0MA 1A9NA 5GMFA 3VQ1A 4C2BB 3CIYA 4V2EA 3RFSA 3UL9A 3W3LA 4RCAB 2Z7XB 3WPCA 1U0ND 5IYXC 3GOZA 5AWDA 2R9UA 3ZYIA 4AW4A 5FTTB 4J4LA 3RGXA 1O6SA 4CC4C 4CNMA 3G06A 3ULVA 4R5DA 4V2DA 1KOOA 3W3JA 4WYKA 1YRGA 2WQWA 3E3ZA 4LSXC 4RCWA 3ZYNA 4ARRA 4CNCA 4R6FA 4CC4A 1OGQA 2V70A 2XWTC 4Q62A 1M10B 2P1MB 4L3FA 3C6OB 5B0TA 3E4GA 4G8AA 3OGMB 4Z94G 1DS9A 1DFJI 4UFRA 1IO0A 1KOHA 1SQ0B 2OMUA 2Z81A 4LSXA 4LI1A 1LTXA 3W3NA 3M18A 2Z64A 4FDWA 2OMVA 4NKGA 2A0ZA 5HZLB 1M9SA 5AWCA 5D3IA 1OTMA 4R6AA 4Z8GA 1M9LA 5GQRK 4ECNA 1Z7XW 4R0AA 2ASSB 4NZTM 3G39A 1H6TA 3OGKB 4LI2A 3UL8A 4R58A 4K17A 5IJCA 1A4YA 2WQXA 2ELLA 1PGVA 3G3BA 2WFHA 4Q3GA 3CIGA 3CVRA 4XOSA 4M7EC 4U06A 3RW7A 4BSUA 4PSJA 2ID5A 5CMNA 1FO1A 3C6PB 4YEBB 2CA6A 2UZXA 4LXSA 2BNHA 1O6TA 2O6SA 3ZYOA 3W3MA 4I6JB 4M7EA 3RFEA 4P91A 4FD0A 4PEQB 1OOKG 4PERA 4R5CA 3VQ2A 3TSRE 3RJ0A 5A5CA 3E2JA 4MQWX 4RWTC 1FS2A 2ASTB 1DCEA 1O6VA 2JE0A 5HDHA 4LSAA 3REZA 2V9TB 4PKIG 2UZYA 2Z63A 4HQ1A 2OMXA 2Q4GW 4KT1A 4GT6A 4PQ8A 4B8CD 3OJAA 3UN9A 1P8VA 4QBZA 1ZIWA 2JE1A 3W3KA 4KNGA 2Z65A 2XOTA 5LFNA 2BEXA 3OJAB 1XECA 4XSQA 3FXIA 4WP6A 2Z62A 4Z79A 2IFGA 4QC0A 2WQUA 1XEUA 4IM6A 3WPEA 3OGLB 4FCGA 4R09A 2O6QA 4V2CA 3BZ5A 3A79B 4ECOA 5AWAA 3RW6A 4GLPA 4U09A 4BSSA 2RR6A 3P72A 3O6NA 1D0BA 2JQDA 2O6RA 4EZGA 5GS0A 4AY9X 4R6GA 4U7LA 4QXEA 2V9SA 3UL7A 1OTNA 5B0NA 2Z7XA 5B4PA 3RIZA 3O53A 4LSCA 4P8SA 4LXRA 1OZNA 5AWBA 1XWDC 1P8TA 4Z64C 4NKHA 4BV4R 4TZHA 5AZ5A 2P1PB 1FT8A 4XGOA 4L3AA 3G04C 3WPHA 2OMTA 5IJBA 4KXFB 3RFJA 2FT3A 3WPDA 3ULAA 4R07A 1JL5A 2OMZA 1K5DC 4U08A 3W3GA 4Q3IA 1XCDA 5CMPA 5GS2B 5IJDA 4CILA 2OMYA 2P1QB 4NZRM 5GMGA
chains in the Genus database with same CATH topology
2Z82A 4H09A 4R08A 3KJ4A 1H6UA 5GMHA 3C6NB 1W8AA 2P1OB 1WWLA 1QYYA 1OTOA 4MN8B 3PMHG 4C2AB 1M0ZA 4BSRA 4FHOA 1FQVA 2Z66A 3E6JA 3ZYJA 4OQTA 3WN4A 4CP6A 3WPFA 3WPGA 3M19A 4FMZA 3ULUA 3SB4A 3RGZA 2OMWA 4FS7A 3WPIA 4ARNA 3DZEA 3WPBA 2P1NB 4R6JA 2Y5QA 4Y61B 2WQVA 3G3AA 3JB9j 1K5GC 1XKUA 1GWBA 2RA8A 1P9AG 4Z61C 1G9UA 4J0MA 1A9NA 5GMFA 3VQ1A 4C2BB 3CIYA 4V2EA 3RFSA 3UL9A 3W3LA 4RCAB 2Z7XB 3WPCA 1U0ND 5IYXC 3GOZA 5AWDA 2R9UA 3ZYIA 4AW4A 5FTTB 4J4LA 3RGXA 1O6SA 4CC4C 4CNMA 3G06A 3ULVA 4R5DA 4V2DA 1KOOA 3W3JA 4WYKA 1YRGA 2WQWA 3E3ZA 4LSXC 4RCWA 3ZYNA 4ARRA 4CNCA 4R6FA 4CC4A 1OGQA 2V70A 2XWTC 4Q62A 1M10B 2P1MB 4L3FA 3C6OB 5B0TA 3E4GA 4G8AA 3OGMB 4Z94G 1DS9A 1DFJI 4UFRA 1IO0A 1KOHA 1SQ0B 2OMUA 2Z81A 4LSXA 4LI1A 1LTXA 3W3NA 3M18A 2Z64A 4FDWA 2OMVA 4NKGA 2A0ZA 5HZLB 1M9SA 5AWCA 5D3IA 1OTMA 4R6AA 4Z8GA 1M9LA 5GQRK 4ECNA 1Z7XW 4R0AA 2ASSB 3G39A 1H6TA 3OGKB 4LI2A 3UL8A 4R58A 4K17A 5IJCA 1A4YA 2WQXA 2ELLA 1PGVA 3G3BA 2WFHA 4Q3GA 3CIGA 3CVRA 4XOSA 4M7EC 4U06A 3RW7A 4BSUA 4PSJA 2ID5A 5CMNA 1FO1A 3C6PB 4YEBB 2CA6A 2UZXA 4LXSA 2BNHA 1O6TA 2O6SA 3ZYOA 3W3MA 4I6JB 4M7EA 3RFEA 4P91A 4FD0A 4PEQB 1OOKG 4PERA 4R5CA 3VQ2A 3TSRE 3RJ0A 5A5CA 3E2JA 4MQWX 4RWTC 1FS2A 2ASTB 1DCEA 1O6VA 2JE0A 5HDHA 4LSAA 3REZA 2V9TB 4PKIG 2UZYA 2Z63A 4HQ1A 2OMXA 2Q4GW 4KT1A 4GT6A 4PQ8A 4B8CD 3OJAA 3UN9A 1P8VA 4QBZA 1ZIWA 2JE1A 3W3KA 4KNGA 2Z65A 2XOTA 5LFNA 2BEXA 3OJAB 1XECA 4XSQA 3FXIA 4WP6A 2Z62A 4Z79A 2IFGA 4QC0A 2WQUA 1XEUA 4IM6A 3WPEA 3OGLB 4FCGA 4R09A 2O6QA 4V2CA 3BZ5A 3A79B 4ECOA 5AWAA 3RW6A 4GLPA 4U09A 4BSSA 2RR6A 3P72A 3O6NA 1D0BA 2JQDA 2O6RA 4EZGA 5GS0A 4AY9X 4R6GA 4U7LA 4QXEA 2V9SA 3UL7A 1OTNA 5B0NA 2Z7XA 5B4PA 3RIZA 3O53A 4LSCA 4P8SA 4LXRA 1OZNA 5AWBA 1XWDC 1P8TA 4Z64C 4NKHA 4BV4R 4TZHA 5AZ5A 2P1PB 1FT8A 4XGOA 4L3AA 3G04C 3WPHA 2OMTA 5IJBA 4KXFB 3RFJA 2FT3A 3WPDA 3ULAA 4R07A 1JL5A 2OMZA 1K5DC 4U08A 3W3GA 4Q3IA 1XCDA 5CMPA 5GS2B 5IJDA 4CILA 2OMYA 2P1QB 5GMGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Z82 A;  4H09 A;  4R08 A;  3KJ4 A;  1H6U A;  5GMH A;  3C6N B;  1W8A A;  2P1O B;  1WWL A;  1QYY A;  1OTO A;  4MN8 B;  3PMH G;  4C2A B;  1M0Z A;  4BSR A;  4FHO A;  1FQV A;  2Z66 A;  3E6J A;  3ZYJ A;  4OQT A;  3WN4 A;  4CP6 A;  3WPF A;  3WPG A;  3M19 A;  4FMZ A;  3ULU A;  3SB4 A;  3RGZ A;  2OMW A;  4FS7 A;  3WPI A;  4ARN A;  3DZE A;  3WPB A;  2P1N B;  4R6J A;  2Y5Q A;  4Y61 B;  2WQV A;  3G3A A;  3JB9 j;  1K5G C;  1XKU A;  1GWB A;  2RA8 A;  1P9A G;  4Z61 C;  1G9U A;  4J0M A;  1A9N A;  5GMF A;  3VQ1 A;  4C2B B;  3CIY A;  4V2E A;  3RFS A;  3UL9 A;  3W3L A;  4RCA B;  2Z7X B;  3WPC A;  1U0N D;  5IYX C;  3GOZ A;  5AWD A;  2R9U A;  3ZYI A;  4AW4 A;  5FTT B;  4J4L A;  3RGX A;  1O6S A;  4CC4 C;  4CNM A;  3G06 A;  3ULV A;  4R5D A;  4V2D A;  1KOO A;  3W3J A;  4WYK A;  1YRG A;  2WQW A;  3E3Z A;  4LSX C;  4RCW A;  3ZYN A;  4ARR A;  4CNC A;  4R6F A;  4CC4 A;  1OGQ A;  2V70 A;  2XWT C;  4Q62 A;  1M10 B;  2P1M B;  4L3F A;  3C6O B;  5B0T A;  3E4G A;  4G8A A;  3OGM B;  4Z94 G;  1DS9 A;  1DFJ I;  4UFR A;  1IO0 A;  1KOH A;  1SQ0 B;  2OMU A;  2Z81 A;  4LSX A;  4LI1 A;  1LTX A;  3W3N A;  3M18 A;  2Z64 A;  4FDW A;  2OMV A;  4NKG A;  2A0Z A;  5HZL B;  1M9S A;  5AWC A;  5D3I A;  1OTM A;  4R6A A;  4Z8G A;  1M9L A;  5GQR K;  4ECN A;  1Z7X W;  4R0A A;  2ASS B;  3G39 A;  1H6T A;  3OGK B;  4LI2 A;  3UL8 A;  4R58 A;  4K17 A;  5IJC A;  1A4Y A;  2WQX A;  2ELL A;  1PGV A;  3G3B A;  2WFH A;  4Q3G A;  3CIG A;  3CVR A;  4XOS A;  4M7E C;  4U06 A;  3RW7 A;  4BSU A;  4PSJ A;  2ID5 A;  5CMN A;  1FO1 A;  3C6P B;  4YEB B;  2CA6 A;  2UZX A;  4LXS A;  2BNH A;  1O6T A;  2O6S A;  3ZYO A;  3W3M A;  4I6J B;  4M7E A;  3RFE A;  4P91 A;  4FD0 A;  4PEQ B;  1OOK G;  4PER A;  4R5C A;  3VQ2 A;  3TSR E;  3RJ0 A;  5A5C A;  3E2J A;  4MQW X;  4RWT C;  1FS2 A;  2AST B;  1DCE A;  1O6V A;  2JE0 A;  5HDH A;  4LSA A;  3REZ A;  2V9T B;  4PKI G;  2UZY A;  2Z63 A;  4HQ1 A;  2OMX A;  2Q4G W;  4KT1 A;  4GT6 A;  4PQ8 A;  4B8C D;  3OJA A;  3UN9 A;  1P8V A;  4QBZ A;  1ZIW A;  2JE1 A;  3W3K A;  4KNG A;  2Z65 A;  2XOT A;  5LFN A;  2BEX A;  3OJA B;  1XEC A;  4XSQ A;  3FXI A;  4WP6 A;  2Z62 A;  4Z79 A;  2IFG A;  4QC0 A;  2WQU A;  1XEU A;  4IM6 A;  3WPE A;  3OGL B;  4FCG A;  4R09 A;  2O6Q A;  4V2C A;  3BZ5 A;  3A79 B;  4ECO A;  5AWA A;  3RW6 A;  4GLP A;  4U09 A;  4BSS A;  2RR6 A;  3P72 A;  3O6N A;  1D0B A;  2JQD A;  2O6R A;  4EZG A;  5GS0 A;  4AY9 X;  4R6G A;  4U7L A;  4QXE A;  2V9S A;  3UL7 A;  1OTN A;  5B0N A;  2Z7X A;  5B4P A;  3RIZ A;  3O53 A;  4LSC A;  4P8S A;  4LXR A;  1OZN A;  5AWB A;  1XWD C;  1P8T A;  4Z64 C;  4NKH A;  4BV4 R;  4TZH A;  5AZ5 A;  2P1P B;  1FT8 A;  4XGO A;  4L3A A;  3G04 C;  3WPH A;  2OMT A;  5IJB A;  4KXF B;  3RFJ A;  2FT3 A;  3WPD A;  3ULA A;  4R07 A;  1JL5 A;  2OMZ A;  1K5D C;  4U08 A;  3W3G A;  4Q3I A;  1XCD A;  5CMP A;  5GS2 B;  5IJD A;  4CIL A;  2OMY A;  2P1Q B;  5GMG A; 
#chains in the Genus database with same CATH topology
 2Z82 A;  4H09 A;  4R08 A;  3KJ4 A;  1H6U A;  5GMH A;  3C6N B;  1W8A A;  2P1O B;  1WWL A;  1QYY A;  1OTO A;  4MN8 B;  3PMH G;  4C2A B;  1M0Z A;  4BSR A;  4FHO A;  1FQV A;  2Z66 A;  3E6J A;  3ZYJ A;  4OQT A;  3WN4 A;  4CP6 A;  3WPF A;  3WPG A;  3M19 A;  4FMZ A;  3ULU A;  3SB4 A;  3RGZ A;  2OMW A;  4FS7 A;  3WPI A;  4ARN A;  3DZE A;  3WPB A;  2P1N B;  4R6J A;  2Y5Q A;  4Y61 B;  2WQV A;  3G3A A;  3JB9 j;  1K5G C;  1XKU A;  1GWB A;  2RA8 A;  1P9A G;  4Z61 C;  1G9U A;  4J0M A;  1A9N A;  5GMF A;  3VQ1 A;  4C2B B;  3CIY A;  4V2E A;  3RFS A;  3UL9 A;  3W3L A;  4RCA B;  2Z7X B;  3WPC A;  1U0N D;  5IYX C;  3GOZ A;  5AWD A;  2R9U A;  3ZYI A;  4AW4 A;  5FTT B;  4J4L A;  3RGX A;  1O6S A;  4CC4 C;  4CNM A;  3G06 A;  3ULV A;  4R5D A;  4V2D A;  1KOO A;  3W3J A;  4WYK A;  1YRG A;  2WQW A;  3E3Z A;  4LSX C;  4RCW A;  3ZYN A;  4ARR A;  4CNC A;  4R6F A;  4CC4 A;  1OGQ A;  2V70 A;  2XWT C;  4Q62 A;  1M10 B;  2P1M B;  4L3F A;  3C6O B;  5B0T A;  3E4G A;  4G8A A;  3OGM B;  4Z94 G;  1DS9 A;  1DFJ I;  4UFR A;  1IO0 A;  1KOH A;  1SQ0 B;  2OMU A;  2Z81 A;  4LSX A;  4LI1 A;  1LTX A;  3W3N A;  3M18 A;  2Z64 A;  4FDW A;  2OMV A;  4NKG A;  2A0Z A;  5HZL B;  1M9S A;  5AWC A;  5D3I A;  1OTM A;  4R6A A;  4Z8G A;  1M9L A;  5GQR K;  4ECN A;  1Z7X W;  4R0A A;  2ASS B;  4NZT M;  3G39 A;  1H6T A;  3OGK B;  4LI2 A;  3UL8 A;  4R58 A;  4K17 A;  5IJC A;  1A4Y A;  2WQX A;  2ELL A;  1PGV A;  3G3B A;  2WFH A;  4Q3G A;  3CIG A;  3CVR A;  4XOS A;  4M7E C;  4U06 A;  3RW7 A;  4BSU A;  4PSJ A;  2ID5 A;  5CMN A;  1FO1 A;  3C6P B;  4YEB B;  2CA6 A;  2UZX A;  4LXS A;  2BNH A;  1O6T A;  2O6S A;  3ZYO A;  3W3M A;  4I6J B;  4M7E A;  3RFE A;  4P91 A;  4FD0 A;  4PEQ B;  1OOK G;  4PER A;  4R5C A;  3VQ2 A;  3TSR E;  3RJ0 A;  5A5C A;  3E2J A;  4MQW X;  4RWT C;  1FS2 A;  2AST B;  1DCE A;  1O6V A;  2JE0 A;  5HDH A;  4LSA A;  3REZ A;  2V9T B;  4PKI G;  2UZY A;  2Z63 A;  4HQ1 A;  2OMX A;  2Q4G W;  4KT1 A;  4GT6 A;  4PQ8 A;  4B8C D;  3OJA A;  3UN9 A;  1P8V A;  4QBZ A;  1ZIW A;  2JE1 A;  3W3K A;  4KNG A;  2Z65 A;  2XOT A;  5LFN A;  2BEX A;  3OJA B;  1XEC A;  4XSQ A;  3FXI A;  4WP6 A;  2Z62 A;  4Z79 A;  2IFG A;  4QC0 A;  2WQU A;  1XEU A;  4IM6 A;  3WPE A;  3OGL B;  4FCG A;  4R09 A;  2O6Q A;  4V2C A;  3BZ5 A;  3A79 B;  4ECO A;  5AWA A;  3RW6 A;  4GLP A;  4U09 A;  4BSS A;  2RR6 A;  3P72 A;  3O6N A;  1D0B A;  2JQD A;  2O6R A;  4EZG A;  5GS0 A;  4AY9 X;  4R6G A;  4U7L A;  4QXE A;  2V9S A;  3UL7 A;  1OTN A;  5B0N A;  2Z7X A;  5B4P A;  3RIZ A;  3O53 A;  4LSC A;  4P8S A;  4LXR A;  1OZN A;  5AWB A;  1XWD C;  1P8T A;  4Z64 C;  4NKH A;  4BV4 R;  4TZH A;  5AZ5 A;  2P1P B;  1FT8 A;  4XGO A;  4L3A A;  3G04 C;  3WPH A;  2OMT A;  5IJB A;  4KXF B;  3RFJ A;  2FT3 A;  3WPD A;  3ULA A;  4R07 A;  1JL5 A;  2OMZ A;  1K5D C;  4U08 A;  3W3G A;  4Q3I A;  1XCD A;  5CMP A;  5GS2 B;  5IJD A;  4CIL A;  2OMY A;  2P1Q B;  4NZR M;  5GMG A; 
#chains in the Genus database with same CATH homology
 2Z82 A;  4H09 A;  4R08 A;  3KJ4 A;  1H6U A;  5GMH A;  3C6N B;  1W8A A;  2P1O B;  1WWL A;  1QYY A;  1OTO A;  4MN8 B;  3PMH G;  4C2A B;  1M0Z A;  4BSR A;  4FHO A;  1FQV A;  2Z66 A;  3E6J A;  3ZYJ A;  4OQT A;  3WN4 A;  4CP6 A;  3WPF A;  3WPG A;  3M19 A;  4FMZ A;  3ULU A;  3SB4 A;  3RGZ A;  2OMW A;  4FS7 A;  3WPI A;  4ARN A;  3DZE A;  3WPB A;  2P1N B;  4R6J A;  2Y5Q A;  4Y61 B;  2WQV A;  3G3A A;  3JB9 j;  1K5G C;  1XKU A;  1GWB A;  2RA8 A;  1P9A G;  4Z61 C;  1G9U A;  4J0M A;  1A9N A;  5GMF A;  3VQ1 A;  4C2B B;  3CIY A;  4V2E A;  3RFS A;  3UL9 A;  3W3L A;  4RCA B;  2Z7X B;  3WPC A;  1U0N D;  5IYX C;  3GOZ A;  5AWD A;  2R9U A;  3ZYI A;  4AW4 A;  5FTT B;  4J4L A;  3RGX A;  1O6S A;  4CC4 C;  4CNM A;  3G06 A;  3ULV A;  4R5D A;  4V2D A;  1KOO A;  3W3J A;  4WYK A;  1YRG A;  2WQW A;  3E3Z A;  4LSX C;  4RCW A;  3ZYN A;  4ARR A;  4CNC A;  4R6F A;  4CC4 A;  1OGQ A;  2V70 A;  2XWT C;  4Q62 A;  1M10 B;  2P1M B;  4L3F A;  3C6O B;  5B0T A;  3E4G A;  4G8A A;  3OGM B;  4Z94 G;  1DS9 A;  1DFJ I;  4UFR A;  1IO0 A;  1KOH A;  1SQ0 B;  2OMU A;  2Z81 A;  4LSX A;  4LI1 A;  1LTX A;  3W3N A;  3M18 A;  2Z64 A;  4FDW A;  2OMV A;  4NKG A;  2A0Z A;  5HZL B;  1M9S A;  5AWC A;  5D3I A;  1OTM A;  4R6A A;  4Z8G A;  1M9L A;  5GQR K;  4ECN A;  1Z7X W;  4R0A A;  2ASS B;  3G39 A;  1H6T A;  3OGK B;  4LI2 A;  3UL8 A;  4R58 A;  4K17 A;  5IJC A;  1A4Y A;  2WQX A;  2ELL A;  1PGV A;  3G3B A;  2WFH A;  4Q3G A;  3CIG A;  3CVR A;  4XOS A;  4M7E C;  4U06 A;  3RW7 A;  4BSU A;  4PSJ A;  2ID5 A;  5CMN A;  1FO1 A;  3C6P B;  4YEB B;  2CA6 A;  2UZX A;  4LXS A;  2BNH A;  1O6T A;  2O6S A;  3ZYO A;  3W3M A;  4I6J B;  4M7E A;  3RFE A;  4P91 A;  4FD0 A;  4PEQ B;  1OOK G;  4PER A;  4R5C A;  3VQ2 A;  3TSR E;  3RJ0 A;  5A5C A;  3E2J A;  4MQW X;  4RWT C;  1FS2 A;  2AST B;  1DCE A;  1O6V A;  2JE0 A;  5HDH A;  4LSA A;  3REZ A;  2V9T B;  4PKI G;  2UZY A;  2Z63 A;  4HQ1 A;  2OMX A;  2Q4G W;  4KT1 A;  4GT6 A;  4PQ8 A;  4B8C D;  3OJA A;  3UN9 A;  1P8V A;  4QBZ A;  1ZIW A;  2JE1 A;  3W3K A;  4KNG A;  2Z65 A;  2XOT A;  5LFN A;  2BEX A;  3OJA B;  1XEC A;  4XSQ A;  3FXI A;  4WP6 A;  2Z62 A;  4Z79 A;  2IFG A;  4QC0 A;  2WQU A;  1XEU A;  4IM6 A;  3WPE A;  3OGL B;  4FCG A;  4R09 A;  2O6Q A;  4V2C A;  3BZ5 A;  3A79 B;  4ECO A;  5AWA A;  3RW6 A;  4GLP A;  4U09 A;  4BSS A;  2RR6 A;  3P72 A;  3O6N A;  1D0B A;  2JQD A;  2O6R A;  4EZG A;  5GS0 A;  4AY9 X;  4R6G A;  4U7L A;  4QXE A;  2V9S A;  3UL7 A;  1OTN A;  5B0N A;  2Z7X A;  5B4P A;  3RIZ A;  3O53 A;  4LSC A;  4P8S A;  4LXR A;  1OZN A;  5AWB A;  1XWD C;  1P8T A;  4Z64 C;  4NKH A;  4BV4 R;  4TZH A;  5AZ5 A;  2P1P B;  1FT8 A;  4XGO A;  4L3A A;  3G04 C;  3WPH A;  2OMT A;  5IJB A;  4KXF B;  3RFJ A;  2FT3 A;  3WPD A;  3ULA A;  4R07 A;  1JL5 A;  2OMZ A;  1K5D C;  4U08 A;  3W3G A;  4Q3I A;  1XCD A;  5CMP A;  5GS2 B;  5IJD A;  4CIL A;  2OMY A;  2P1Q B;  5GMG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...