5GS2B

Crystal structure of diabody complex with repebody and mbp
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
268
structure length
268
Chain Sequence
TVSTPIKQIFPDDAFAETIKANLKKKSVTDAVTQNELNSIDQIIANNSDIKSVQGIQYLPNVRYLALGGNKLHDISALKELTNLTYLILTGNQLQSLPNGVFDKLTNLKELVLVENQLQSLPDGVFDKLTNLTYLYLYHNQLQSLPKGVFDKLTNLTRLDLDNNQLQSLPEGVFDKLTQLKQLSLNDNQLKSVPDGVFDRLTSLTHIWLLNNPWDCACSDILYLSRWISQHPGLVFGYLNLDPDSARCSGTNTPVRAVTEASTSPSKC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Sugar binding protein/immune system
molecule keywords Maltose-binding periplasmic protein
publication title Crystal structure of mono- and bi-specific diabodies and reduction of their structural flexibility by introduction of disulfide bridges at the Fv interface.
pubmed doi rcsb
source organism Escherichia coli (strain k12)
total genus 70
structure length 268
sequence length 268
ec nomenclature
pdb deposition date 2016-08-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 5gs2B00
2O6SA 2Z62A 3ULUA 4AW4A 4PKIG 4Q3IA 3A79B 4M7EA 4Q3GA 4CNMA 1OTNA 5GMFA 2Z81A 1FQVA 3ZYNA 5GS0A 2Z7XB 4QC0A 3O53A 4KNGA 3RJ0A 2JE1A 2P1NB 4LI1A 4ECOA 3TSRE 1XCDA 1QYYA 2P1QB 2CA6A 5AZ5A 4Z94G 4C2AB 1XECA 4RCAB 3E6JA 4U06A 2O6RA 5GS2B 4FD0A 4YEBB 4V2DA 4C2BB 3RGZA 3VQ1A 4PQ8A 2JE0A 5HDHA 2Q4GW 4J0MA 4GT6A 3OGMB 4CC4C 4LXRA 1OGQA 4NKHA 4PSJA 3W3MA 3O6NA 3OJAA 2ID5A 4NKGA 2P1MB 4PERA 1OTOA 4MQWX 3UL7A 4TZHA 4FS7A 5AWAA 2WFHA 2P1OB 5IJDA 1W8AA 4IM6A 1FS2A 4LSAA 4R6JA 4Q62A 2XOTA 4R07A 1H6UA 4RWTC 3G04C 3E2JA 4ARRA 4BSUA 2V9TB 3W3NA 4ARNA 3SB4A 3C6NB 4R08A 2IFGA 5B4PA 4WYKA 5AWBA 4V2EA 3M18A 2RR6A 1M9LA 3KJ4A 3RFJA 4KT1A 3UL8A 3W3LA 2OMVA 3JB9j 3ZYOA 1WWLA 4R0AA 5GMHA 1U0ND 1OTMA 1A4YA 4I6JB 1SQ0B 1DS9A 2ASSB 3ULAA 4OQTA 4LXSA 3UL9A 2ELLA 3G3AA 3CIYA 4FDWA 2Z7XA 3RGXA 2Z82A 4UFRA 3UN9A 4CILA 2R9UA 1OOKG 4KXFB 5AWCA 3CIGA 4J4LA 1M9SA 3ZYIA 4CC4A 3G06A 5A5CA 2WQVA 2UZYA 4P91A 4L3AA 4L3FA 2WQXA 2O6QA 4Z8GA 2XWTC 2FT3A 5AWDA 3WN4A 3WPIA 2Y5QA 1G9UA 4V2CA 1K5DC 4K17A 4BSSA 4B8CD 1FO1A 3P72A 2OMUA 4BV4R 2OMXA 2WQWA 3C6OB 5GQRK 5FTTB 2WQUA 3VQ2A 1M0ZA 4GLPA 3M19A 4Z79A 3WPGA 3OJAB 3BZ5A 1O6VA 2OMZA 1O6SA 3WPDA 4U09A 1XEUA 4RCWA 5CMPA 3W3GA 4AY9X 3REZA 3RW6A 3ULVA 4R5DA 3WPBA 2BNHA 3ZYJA 1LTXA 4R6AA 1KOOA 1H6TA 1XWDC 4FHOA 3OGLB 4QXEA 3FXIA 3WPEA 1O6TA 1K5GC 4LI2A 4LSXC 1GWBA 2Z64A 3G3BA 5LFNA 3G39A 4FMZA 5CMNA 1XKUA 1PGVA 1FT8A 1P8TA 5IJBA 4EZGA 5IYXC 2V9SA 5B0NA 2P1PB 2Z66A 3RIZA 4P8SA 4H09A 4CNCA 3RFSA 4Z64C 2Z65A 1M10B 3E3ZA 1D0BA 3C6PB 4XGOA 4BSRA 4R58A 5D3IA 4M7EC 3GOZA 1OZNA 4MN8B 2Z63A 4Y61B 2JQDA 2A0ZA 3DZEA 4XSQA 3WPHA 1P8VA 5IJCA 4LSCA 2V70A 5B0TA 5GMGA 4CP6A 1Z7XW 1JL5A 2RA8A 3RFEA 3E4GA 4R6GA 4XOSA 1DFJI 3WPCA 2OMYA 2ASTB 2OMWA 1KOHA 4R09A 1IO0A 3OGKB 4U08A 3PMHG 3W3KA 4G8AA 1ZIWA 4QBZA 3W3JA 4LSXA 1P9AG 1YRGA 4PEQB 2UZXA 1DCEA 2OMTA 3WPFA 4HQ1A 4ECNA 4R6FA 4R5CA 4U7LA 4FCGA 2BEXA 4WP6A 3CVRA 1A9NA 3RW7A 5HZLB 4Z61C
chains in the Genus database with same CATH superfamily
2O6SA 2Z62A 3ULUA 4AW4A 4PKIG 4Q3IA 3A79B 4M7EA 4Q3GA 4CNMA 1OTNA 5GMFA 2Z81A 1FQVA 3ZYNA 5GS0A 2Z7XB 4QC0A 3O53A 4KNGA 3RJ0A 2JE1A 2P1NB 4LI1A 4ECOA 3TSRE 1XCDA 1QYYA 2P1QB 2CA6A 5AZ5A 4Z94G 4C2AB 1XECA 4RCAB 3E6JA 4U06A 2O6RA 5GS2B 4FD0A 4YEBB 4V2DA 4C2BB 3RGZA 3VQ1A 4PQ8A 2JE0A 5HDHA 2Q4GW 4J0MA 4GT6A 3OGMB 4CC4C 4LXRA 1OGQA 4NKHA 4PSJA 3W3MA 3O6NA 3OJAA 2ID5A 4NKGA 2P1MB 4PERA 1OTOA 4MQWX 3UL7A 4TZHA 4FS7A 5AWAA 2WFHA 4NZRM 2P1OB 5IJDA 1W8AA 4IM6A 1FS2A 4LSAA 4R6JA 4Q62A 2XOTA 4R07A 1H6UA 4RWTC 3G04C 3E2JA 4ARRA 4BSUA 2V9TB 3W3NA 4ARNA 3SB4A 3C6NB 4R08A 2IFGA 5B4PA 4WYKA 5AWBA 4V2EA 3M18A 2RR6A 1M9LA 3KJ4A 3RFJA 4KT1A 3UL8A 3W3LA 2OMVA 3JB9j 3ZYOA 1WWLA 4R0AA 5GMHA 1U0ND 1OTMA 1A4YA 4I6JB 1SQ0B 1DS9A 2ASSB 3ULAA 4OQTA 4LXSA 3UL9A 2ELLA 3G3AA 3CIYA 4FDWA 2Z7XA 3RGXA 2Z82A 4UFRA 3UN9A 4CILA 2R9UA 1OOKG 4KXFB 5AWCA 3CIGA 4J4LA 1M9SA 3ZYIA 4CC4A 3G06A 5A5CA 2WQVA 2UZYA 4P91A 4L3AA 4L3FA 2WQXA 2O6QA 4Z8GA 2XWTC 2FT3A 5AWDA 3WN4A 3WPIA 2Y5QA 1G9UA 4V2CA 1K5DC 4K17A 4BSSA 4B8CD 1FO1A 3P72A 2OMUA 4BV4R 2OMXA 2WQWA 3C6OB 5GQRK 5FTTB 2WQUA 3VQ2A 1M0ZA 4GLPA 3M19A 4Z79A 3WPGA 3OJAB 3BZ5A 1O6VA 2OMZA 1O6SA 3WPDA 4U09A 1XEUA 4RCWA 5CMPA 3W3GA 4AY9X 3REZA 3RW6A 3ULVA 4R5DA 3WPBA 2BNHA 3ZYJA 1LTXA 4R6AA 1KOOA 1H6TA 1XWDC 4FHOA 3OGLB 4QXEA 3FXIA 3WPEA 1O6TA 1K5GC 4LI2A 4LSXC 1GWBA 2Z64A 3G3BA 5LFNA 3G39A 4FMZA 5CMNA 1XKUA 1PGVA 1FT8A 1P8TA 5IJBA 4EZGA 5IYXC 2V9SA 5B0NA 2P1PB 2Z66A 3RIZA 4P8SA 4H09A 4CNCA 3RFSA 4Z64C 2Z65A 1M10B 3E3ZA 1D0BA 3C6PB 4XGOA 4BSRA 4R58A 5D3IA 4M7EC 3GOZA 1OZNA 4MN8B 2Z63A 4Y61B 2JQDA 2A0ZA 3DZEA 4XSQA 4NZTM 3WPHA 1P8VA 5IJCA 4LSCA 2V70A 5B0TA 5GMGA 4CP6A 1Z7XW 1JL5A 2RA8A 3RFEA 3E4GA 4R6GA 4XOSA 1DFJI 3WPCA 2OMYA 2ASTB 2OMWA 1KOHA 4R09A 1IO0A 3OGKB 4U08A 3PMHG 3W3KA 4G8AA 1ZIWA 4QBZA 3W3JA 4LSXA 1P9AG 1YRGA 4PEQB 2UZXA 1DCEA 2OMTA 3WPFA 4HQ1A 4ECNA 4R6FA 4R5CA 4U7LA 4FCGA 2BEXA 4WP6A 3CVRA 1A9NA 3RW7A 5HZLB 4Z61C
chains in the Genus database with same CATH topology
2O6SA 2Z62A 3ULUA 4AW4A 4PKIG 4Q3IA 3A79B 4M7EA 4Q3GA 4CNMA 1OTNA 5GMFA 2Z81A 1FQVA 3ZYNA 5GS0A 2Z7XB 4QC0A 3O53A 4KNGA 3RJ0A 2JE1A 2P1NB 4LI1A 4ECOA 3TSRE 1XCDA 1QYYA 2P1QB 2CA6A 5AZ5A 4Z94G 4C2AB 1XECA 4RCAB 3E6JA 4U06A 2O6RA 5GS2B 4FD0A 4YEBB 4V2DA 4C2BB 3RGZA 3VQ1A 4PQ8A 2JE0A 5HDHA 2Q4GW 4J0MA 4GT6A 3OGMB 4CC4C 4LXRA 1OGQA 4NKHA 4PSJA 3W3MA 3O6NA 3OJAA 2ID5A 4NKGA 2P1MB 4PERA 1OTOA 4MQWX 3UL7A 4TZHA 4FS7A 5AWAA 2WFHA 2P1OB 5IJDA 1W8AA 4IM6A 1FS2A 4LSAA 4R6JA 4Q62A 2XOTA 4R07A 1H6UA 4RWTC 3G04C 3E2JA 4ARRA 4BSUA 2V9TB 3W3NA 4ARNA 3SB4A 3C6NB 4R08A 2IFGA 5B4PA 4WYKA 5AWBA 4V2EA 3M18A 2RR6A 1M9LA 3KJ4A 3RFJA 4KT1A 3UL8A 3W3LA 2OMVA 3JB9j 3ZYOA 1WWLA 4R0AA 5GMHA 1U0ND 1OTMA 1A4YA 4I6JB 1SQ0B 1DS9A 2ASSB 3ULAA 4OQTA 4LXSA 3UL9A 2ELLA 3G3AA 3CIYA 4FDWA 2Z7XA 3RGXA 2Z82A 4UFRA 3UN9A 4CILA 2R9UA 1OOKG 4KXFB 5AWCA 3CIGA 4J4LA 1M9SA 3ZYIA 4CC4A 3G06A 5A5CA 2WQVA 2UZYA 4P91A 4L3AA 4L3FA 2WQXA 2O6QA 4Z8GA 2XWTC 2FT3A 5AWDA 3WN4A 3WPIA 2Y5QA 1G9UA 4V2CA 1K5DC 4K17A 4BSSA 4B8CD 1FO1A 3P72A 2OMUA 4BV4R 2OMXA 2WQWA 3C6OB 5GQRK 5FTTB 2WQUA 3VQ2A 1M0ZA 4GLPA 3M19A 4Z79A 3WPGA 3OJAB 3BZ5A 1O6VA 2OMZA 1O6SA 3WPDA 4U09A 1XEUA 4RCWA 5CMPA 3W3GA 4AY9X 3REZA 3RW6A 3ULVA 4R5DA 3WPBA 2BNHA 3ZYJA 1LTXA 4R6AA 1KOOA 1H6TA 1XWDC 4FHOA 3OGLB 4QXEA 3FXIA 3WPEA 1O6TA 1K5GC 4LI2A 4LSXC 1GWBA 2Z64A 3G3BA 5LFNA 3G39A 4FMZA 5CMNA 1XKUA 1PGVA 1FT8A 1P8TA 5IJBA 4EZGA 5IYXC 2V9SA 5B0NA 2P1PB 2Z66A 3RIZA 4P8SA 4H09A 4CNCA 3RFSA 4Z64C 2Z65A 1M10B 3E3ZA 1D0BA 3C6PB 4XGOA 4BSRA 4R58A 5D3IA 4M7EC 3GOZA 1OZNA 4MN8B 2Z63A 4Y61B 2JQDA 2A0ZA 3DZEA 4XSQA 3WPHA 1P8VA 5IJCA 4LSCA 2V70A 5B0TA 5GMGA 4CP6A 1Z7XW 1JL5A 2RA8A 3RFEA 3E4GA 4R6GA 4XOSA 1DFJI 3WPCA 2OMYA 2ASTB 2OMWA 1KOHA 4R09A 1IO0A 3OGKB 4U08A 3PMHG 3W3KA 4G8AA 1ZIWA 4QBZA 3W3JA 4LSXA 1P9AG 1YRGA 4PEQB 2UZXA 1DCEA 2OMTA 3WPFA 4HQ1A 4ECNA 4R6FA 4R5CA 4U7LA 4FCGA 2BEXA 4WP6A 3CVRA 1A9NA 3RW7A 5HZLB 4Z61C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2O6S A;  2Z62 A;  3ULU A;  4AW4 A;  4PKI G;  4Q3I A;  3A79 B;  4M7E A;  4Q3G A;  4CNM A;  1OTN A;  5GMF A;  2Z81 A;  1FQV A;  3ZYN A;  5GS0 A;  2Z7X B;  4QC0 A;  3O53 A;  4KNG A;  3RJ0 A;  2JE1 A;  2P1N B;  4LI1 A;  4ECO A;  3TSR E;  1XCD A;  1QYY A;  2P1Q B;  2CA6 A;  5AZ5 A;  4Z94 G;  4C2A B;  1XEC A;  4RCA B;  3E6J A;  4U06 A;  2O6R A;  5GS2 B;  4FD0 A;  4YEB B;  4V2D A;  4C2B B;  3RGZ A;  3VQ1 A;  4PQ8 A;  2JE0 A;  5HDH A;  2Q4G W;  4J0M A;  4GT6 A;  3OGM B;  4CC4 C;  4LXR A;  1OGQ A;  4NKH A;  4PSJ A;  3W3M A;  3O6N A;  3OJA A;  2ID5 A;  4NKG A;  2P1M B;  4PER A;  1OTO A;  4MQW X;  3UL7 A;  4TZH A;  4FS7 A;  5AWA A;  2WFH A;  2P1O B;  5IJD A;  1W8A A;  4IM6 A;  1FS2 A;  4LSA A;  4R6J A;  4Q62 A;  2XOT A;  4R07 A;  1H6U A;  4RWT C;  3G04 C;  3E2J A;  4ARR A;  4BSU A;  2V9T B;  3W3N A;  4ARN A;  3SB4 A;  3C6N B;  4R08 A;  2IFG A;  5B4P A;  4WYK A;  5AWB A;  4V2E A;  3M18 A;  2RR6 A;  1M9L A;  3KJ4 A;  3RFJ A;  4KT1 A;  3UL8 A;  3W3L A;  2OMV A;  3JB9 j;  3ZYO A;  1WWL A;  4R0A A;  5GMH A;  1U0N D;  1OTM A;  1A4Y A;  4I6J B;  1SQ0 B;  1DS9 A;  2ASS B;  3ULA A;  4OQT A;  4LXS A;  3UL9 A;  2ELL A;  3G3A A;  3CIY A;  4FDW A;  2Z7X A;  3RGX A;  2Z82 A;  4UFR A;  3UN9 A;  4CIL A;  2R9U A;  1OOK G;  4KXF B;  5AWC A;  3CIG A;  4J4L A;  1M9S A;  3ZYI A;  4CC4 A;  3G06 A;  5A5C A;  2WQV A;  2UZY A;  4P91 A;  4L3A A;  4L3F A;  2WQX A;  2O6Q A;  4Z8G A;  2XWT C;  2FT3 A;  5AWD A;  3WN4 A;  3WPI A;  2Y5Q A;  1G9U A;  4V2C A;  1K5D C;  4K17 A;  4BSS A;  4B8C D;  1FO1 A;  3P72 A;  2OMU A;  4BV4 R;  2OMX A;  2WQW A;  3C6O B;  5GQR K;  5FTT B;  2WQU A;  3VQ2 A;  1M0Z A;  4GLP A;  3M19 A;  4Z79 A;  3WPG A;  3OJA B;  3BZ5 A;  1O6V A;  2OMZ A;  1O6S A;  3WPD A;  4U09 A;  1XEU A;  4RCW A;  5CMP A;  3W3G A;  4AY9 X;  3REZ A;  3RW6 A;  3ULV A;  4R5D A;  3WPB A;  2BNH A;  3ZYJ A;  1LTX A;  4R6A A;  1KOO A;  1H6T A;  1XWD C;  4FHO A;  3OGL B;  4QXE A;  3FXI A;  3WPE A;  1O6T A;  1K5G C;  4LI2 A;  4LSX C;  1GWB A;  2Z64 A;  3G3B A;  5LFN A;  3G39 A;  4FMZ A;  5CMN A;  1XKU A;  1PGV A;  1FT8 A;  1P8T A;  5IJB A;  4EZG A;  5IYX C;  2V9S A;  5B0N A;  2P1P B;  2Z66 A;  3RIZ A;  4P8S A;  4H09 A;  4CNC A;  3RFS A;  4Z64 C;  2Z65 A;  1M10 B;  3E3Z A;  1D0B A;  3C6P B;  4XGO A;  4BSR A;  4R58 A;  5D3I A;  4M7E C;  3GOZ A;  1OZN A;  4MN8 B;  2Z63 A;  4Y61 B;  2JQD A;  2A0Z A;  3DZE A;  4XSQ A;  3WPH A;  1P8V A;  5IJC A;  4LSC A;  2V70 A;  5B0T A;  5GMG A;  4CP6 A;  1Z7X W;  1JL5 A;  2RA8 A;  3RFE A;  3E4G A;  4R6G A;  4XOS A;  1DFJ I;  3WPC A;  2OMY A;  2AST B;  2OMW A;  1KOH A;  4R09 A;  1IO0 A;  3OGK B;  4U08 A;  3PMH G;  3W3K A;  4G8A A;  1ZIW A;  4QBZ A;  3W3J A;  4LSX A;  1P9A G;  1YRG A;  4PEQ B;  2UZX A;  1DCE A;  2OMT A;  3WPF A;  4HQ1 A;  4ECN A;  4R6F A;  4R5C A;  4U7L A;  4FCG A;  2BEX A;  4WP6 A;  3CVR A;  1A9N A;  3RW7 A;  5HZL B;  4Z61 C; 
#chains in the Genus database with same CATH topology
 2O6S A;  2Z62 A;  3ULU A;  4AW4 A;  4PKI G;  4Q3I A;  3A79 B;  4M7E A;  4Q3G A;  4CNM A;  1OTN A;  5GMF A;  2Z81 A;  1FQV A;  3ZYN A;  5GS0 A;  2Z7X B;  4QC0 A;  3O53 A;  4KNG A;  3RJ0 A;  2JE1 A;  2P1N B;  4LI1 A;  4ECO A;  3TSR E;  1XCD A;  1QYY A;  2P1Q B;  2CA6 A;  5AZ5 A;  4Z94 G;  4C2A B;  1XEC A;  4RCA B;  3E6J A;  4U06 A;  2O6R A;  5GS2 B;  4FD0 A;  4YEB B;  4V2D A;  4C2B B;  3RGZ A;  3VQ1 A;  4PQ8 A;  2JE0 A;  5HDH A;  2Q4G W;  4J0M A;  4GT6 A;  3OGM B;  4CC4 C;  4LXR A;  1OGQ A;  4NKH A;  4PSJ A;  3W3M A;  3O6N A;  3OJA A;  2ID5 A;  4NKG A;  2P1M B;  4PER A;  1OTO A;  4MQW X;  3UL7 A;  4TZH A;  4FS7 A;  5AWA A;  2WFH A;  4NZR M;  2P1O B;  5IJD A;  1W8A A;  4IM6 A;  1FS2 A;  4LSA A;  4R6J A;  4Q62 A;  2XOT A;  4R07 A;  1H6U A;  4RWT C;  3G04 C;  3E2J A;  4ARR A;  4BSU A;  2V9T B;  3W3N A;  4ARN A;  3SB4 A;  3C6N B;  4R08 A;  2IFG A;  5B4P A;  4WYK A;  5AWB A;  4V2E A;  3M18 A;  2RR6 A;  1M9L A;  3KJ4 A;  3RFJ A;  4KT1 A;  3UL8 A;  3W3L A;  2OMV A;  3JB9 j;  3ZYO A;  1WWL A;  4R0A A;  5GMH A;  1U0N D;  1OTM A;  1A4Y A;  4I6J B;  1SQ0 B;  1DS9 A;  2ASS B;  3ULA A;  4OQT A;  4LXS A;  3UL9 A;  2ELL A;  3G3A A;  3CIY A;  4FDW A;  2Z7X A;  3RGX A;  2Z82 A;  4UFR A;  3UN9 A;  4CIL A;  2R9U A;  1OOK G;  4KXF B;  5AWC A;  3CIG A;  4J4L A;  1M9S A;  3ZYI A;  4CC4 A;  3G06 A;  5A5C A;  2WQV A;  2UZY A;  4P91 A;  4L3A A;  4L3F A;  2WQX A;  2O6Q A;  4Z8G A;  2XWT C;  2FT3 A;  5AWD A;  3WN4 A;  3WPI A;  2Y5Q A;  1G9U A;  4V2C A;  1K5D C;  4K17 A;  4BSS A;  4B8C D;  1FO1 A;  3P72 A;  2OMU A;  4BV4 R;  2OMX A;  2WQW A;  3C6O B;  5GQR K;  5FTT B;  2WQU A;  3VQ2 A;  1M0Z A;  4GLP A;  3M19 A;  4Z79 A;  3WPG A;  3OJA B;  3BZ5 A;  1O6V A;  2OMZ A;  1O6S A;  3WPD A;  4U09 A;  1XEU A;  4RCW A;  5CMP A;  3W3G A;  4AY9 X;  3REZ A;  3RW6 A;  3ULV A;  4R5D A;  3WPB A;  2BNH A;  3ZYJ A;  1LTX A;  4R6A A;  1KOO A;  1H6T A;  1XWD C;  4FHO A;  3OGL B;  4QXE A;  3FXI A;  3WPE A;  1O6T A;  1K5G C;  4LI2 A;  4LSX C;  1GWB A;  2Z64 A;  3G3B A;  5LFN A;  3G39 A;  4FMZ A;  5CMN A;  1XKU A;  1PGV A;  1FT8 A;  1P8T A;  5IJB A;  4EZG A;  5IYX C;  2V9S A;  5B0N A;  2P1P B;  2Z66 A;  3RIZ A;  4P8S A;  4H09 A;  4CNC A;  3RFS A;  4Z64 C;  2Z65 A;  1M10 B;  3E3Z A;  1D0B A;  3C6P B;  4XGO A;  4BSR A;  4R58 A;  5D3I A;  4M7E C;  3GOZ A;  1OZN A;  4MN8 B;  2Z63 A;  4Y61 B;  2JQD A;  2A0Z A;  3DZE A;  4XSQ A;  4NZT M;  3WPH A;  1P8V A;  5IJC A;  4LSC A;  2V70 A;  5B0T A;  5GMG A;  4CP6 A;  1Z7X W;  1JL5 A;  2RA8 A;  3RFE A;  3E4G A;  4R6G A;  4XOS A;  1DFJ I;  3WPC A;  2OMY A;  2AST B;  2OMW A;  1KOH A;  4R09 A;  1IO0 A;  3OGK B;  4U08 A;  3PMH G;  3W3K A;  4G8A A;  1ZIW A;  4QBZ A;  3W3J A;  4LSX A;  1P9A G;  1YRG A;  4PEQ B;  2UZX A;  1DCE A;  2OMT A;  3WPF A;  4HQ1 A;  4ECN A;  4R6F A;  4R5C A;  4U7L A;  4FCG A;  2BEX A;  4WP6 A;  3CVR A;  1A9N A;  3RW7 A;  5HZL B;  4Z61 C; 
#chains in the Genus database with same CATH homology
 2O6S A;  2Z62 A;  3ULU A;  4AW4 A;  4PKI G;  4Q3I A;  3A79 B;  4M7E A;  4Q3G A;  4CNM A;  1OTN A;  5GMF A;  2Z81 A;  1FQV A;  3ZYN A;  5GS0 A;  2Z7X B;  4QC0 A;  3O53 A;  4KNG A;  3RJ0 A;  2JE1 A;  2P1N B;  4LI1 A;  4ECO A;  3TSR E;  1XCD A;  1QYY A;  2P1Q B;  2CA6 A;  5AZ5 A;  4Z94 G;  4C2A B;  1XEC A;  4RCA B;  3E6J A;  4U06 A;  2O6R A;  5GS2 B;  4FD0 A;  4YEB B;  4V2D A;  4C2B B;  3RGZ A;  3VQ1 A;  4PQ8 A;  2JE0 A;  5HDH A;  2Q4G W;  4J0M A;  4GT6 A;  3OGM B;  4CC4 C;  4LXR A;  1OGQ A;  4NKH A;  4PSJ A;  3W3M A;  3O6N A;  3OJA A;  2ID5 A;  4NKG A;  2P1M B;  4PER A;  1OTO A;  4MQW X;  3UL7 A;  4TZH A;  4FS7 A;  5AWA A;  2WFH A;  2P1O B;  5IJD A;  1W8A A;  4IM6 A;  1FS2 A;  4LSA A;  4R6J A;  4Q62 A;  2XOT A;  4R07 A;  1H6U A;  4RWT C;  3G04 C;  3E2J A;  4ARR A;  4BSU A;  2V9T B;  3W3N A;  4ARN A;  3SB4 A;  3C6N B;  4R08 A;  2IFG A;  5B4P A;  4WYK A;  5AWB A;  4V2E A;  3M18 A;  2RR6 A;  1M9L A;  3KJ4 A;  3RFJ A;  4KT1 A;  3UL8 A;  3W3L A;  2OMV A;  3JB9 j;  3ZYO A;  1WWL A;  4R0A A;  5GMH A;  1U0N D;  1OTM A;  1A4Y A;  4I6J B;  1SQ0 B;  1DS9 A;  2ASS B;  3ULA A;  4OQT A;  4LXS A;  3UL9 A;  2ELL A;  3G3A A;  3CIY A;  4FDW A;  2Z7X A;  3RGX A;  2Z82 A;  4UFR A;  3UN9 A;  4CIL A;  2R9U A;  1OOK G;  4KXF B;  5AWC A;  3CIG A;  4J4L A;  1M9S A;  3ZYI A;  4CC4 A;  3G06 A;  5A5C A;  2WQV A;  2UZY A;  4P91 A;  4L3A A;  4L3F A;  2WQX A;  2O6Q A;  4Z8G A;  2XWT C;  2FT3 A;  5AWD A;  3WN4 A;  3WPI A;  2Y5Q A;  1G9U A;  4V2C A;  1K5D C;  4K17 A;  4BSS A;  4B8C D;  1FO1 A;  3P72 A;  2OMU A;  4BV4 R;  2OMX A;  2WQW A;  3C6O B;  5GQR K;  5FTT B;  2WQU A;  3VQ2 A;  1M0Z A;  4GLP A;  3M19 A;  4Z79 A;  3WPG A;  3OJA B;  3BZ5 A;  1O6V A;  2OMZ A;  1O6S A;  3WPD A;  4U09 A;  1XEU A;  4RCW A;  5CMP A;  3W3G A;  4AY9 X;  3REZ A;  3RW6 A;  3ULV A;  4R5D A;  3WPB A;  2BNH A;  3ZYJ A;  1LTX A;  4R6A A;  1KOO A;  1H6T A;  1XWD C;  4FHO A;  3OGL B;  4QXE A;  3FXI A;  3WPE A;  1O6T A;  1K5G C;  4LI2 A;  4LSX C;  1GWB A;  2Z64 A;  3G3B A;  5LFN A;  3G39 A;  4FMZ A;  5CMN A;  1XKU A;  1PGV A;  1FT8 A;  1P8T A;  5IJB A;  4EZG A;  5IYX C;  2V9S A;  5B0N A;  2P1P B;  2Z66 A;  3RIZ A;  4P8S A;  4H09 A;  4CNC A;  3RFS A;  4Z64 C;  2Z65 A;  1M10 B;  3E3Z A;  1D0B A;  3C6P B;  4XGO A;  4BSR A;  4R58 A;  5D3I A;  4M7E C;  3GOZ A;  1OZN A;  4MN8 B;  2Z63 A;  4Y61 B;  2JQD A;  2A0Z A;  3DZE A;  4XSQ A;  3WPH A;  1P8V A;  5IJC A;  4LSC A;  2V70 A;  5B0T A;  5GMG A;  4CP6 A;  1Z7X W;  1JL5 A;  2RA8 A;  3RFE A;  3E4G A;  4R6G A;  4XOS A;  1DFJ I;  3WPC A;  2OMY A;  2AST B;  2OMW A;  1KOH A;  4R09 A;  1IO0 A;  3OGK B;  4U08 A;  3PMH G;  3W3K A;  4G8A A;  1ZIW A;  4QBZ A;  3W3J A;  4LSX A;  1P9A G;  1YRG A;  4PEQ B;  2UZX A;  1DCE A;  2OMT A;  3WPF A;  4HQ1 A;  4ECN A;  4R6F A;  4R5C A;  4U7L A;  4FCG A;  2BEX A;  4WP6 A;  3CVR A;  1A9N A;  3RW7 A;  5HZL B;  4Z61 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...