5HZLB

Secreted internalin-like protein lmo2445 from listeria monocytogenes
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
288
structure length
280
Chain Sequence
DTVPLPAPIIEAFPVEAIAEAIAGELDKDSVNDTITQADLDTMTAIPLPSLGLTGEDLSVLNNEVFTNAIELAIWSNNIGELPDLSEALPALENIEANGANITVFPDANYPNLTNVDLSQNNFGFNIPKFVGMEGLVSINMENAGLSGYIAEDIWMNMPNLDSLILNENHLISIPEDIFLSQQLGTHSFANQTATYPPTTIKQGENLKVFVPFIYQALDFIAPLIIIKDNGRTLYEPPYPTYDGSYMYTIETAGLQPGEHLLEISLGYYTGWYDFPVTIT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Unknown function
molecule keywords Lmo2445 protein
publication title Secreted Internalin-like protein Lmo2445 from Listeria monocytogenes
rcsb
source organism Listeria monocytogenes egd-e
total genus 76
structure length 280
sequence length 288
ec nomenclature
pdb deposition date 2016-02-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 5hzlB01
4XOSA 5GMFA 4Z79A 4CNMA 3WPFA 3RW7A 4Q3GA 3RJ0A 3O6NA 4AY9X 3ZYIA 1XWDC 4LSCA 3G3AA 1XECA 4KT1A 4ARRA 4FDWA 3OGMB 4C2BB 2Z64A 5IYXC 1GWBA 2O6SA 4PSJA 1K5GC 1WWLA 2ASSB 4CC4C 4L3FA 1IO0A 4P8SA 3ZYJA 4R07A 1FQVA 2Z81A 4MQWX 1YRGA 2RR6A 1K5DC 2V9TB 4IM6A 3C6PB 1KOOA 5AWAA 5CMNA 5IJCA 2UZYA 3M18A 4BSRA 3WN4A 3G39A 4R09A 3VQ2A 2P1PB 4PEQB 1QYYA 4G8AA 4Z61C 2WFHA 4M7EC 5GQRK 5AZ5A 1U0ND 1LTXA 1H6TA 4Z94G 2Q4GW 1OTOA 1O6VA 3FXIA 3G04C 4U7LA 2RA8A 1O6SA 2OMZA 3RFSA 3WPGA 4R6GA 4J0MA 1DFJI 4FHOA 2OMYA 3RFJA 1M0ZA 3UN9A 3E6JA 4ARNA 4QXEA 4M7EA 2Y5QA 4R6FA 4R58A 1KOHA 4AW4A 2JE0A 3W3JA 1H6UA 4B8CD 3UL7A 4BSSA 2P1MB 4FS7A 4LSXA 3REZA 3WPHA 4ECOA 2OMWA 5AWDA 3UL9A 5GMHA 5AWBA 5GS0A 1SQ0B 3WPIA 3ULUA 4LI2A 4FCGA 4RCAB 4R08A 2V9SA 5FTTB 4WYKA 1P9AG 2Z65A 2CA6A 4LSAA 3ZYNA 1FS2A 1DS9A 1XEUA 4HQ1A 4YEBB 3UL8A 4Y61B 1M9LA 4U09A 4CNCA 1A9NA 5B0TA 2Z82A 3W3NA 2O6RA 5B4PA 3C6OB 4R5DA 2R9UA 4QBZA 5GMGA 1M9SA 3A79B 4RCWA 1FO1A 4FD0A 5GS2B 5IJDA 5CMPA 2FT3A 3W3MA 1P8TA 2ELLA 2UZXA 1JL5A 2OMUA 3E4GA 4NKHA 4LXRA 1P8VA 3CIGA 4CC4A 4Z64C 3GOZA 4P91A 5LFNA 2A0ZA 4U06A 1OTMA 4PQ8A 2WQUA 4UFRA 1OTNA 3OJAB 5HZLB 5D3IA 3E3ZA 3DZEA 3C6NB 3PMHG 2V70A 3WPCA 4KNGA 4GT6A 1Z7XW 4GLPA 2P1NB 3JB9j 5AWCA 1A4YA 3VQ1A 2Z7XB 4J4LA 3ULVA 3RGZA 1PGVA 2O6QA 3RFEA 4I6JB 4QC0A 4V2DA 3G3BA 4XGOA 3W3LA 4CILA 4Z8GA 4R6JA 2ID5A 3W3GA 5A5CA 2Z63A 1DCEA 3ULAA 4EZGA 4FMZA 1OGQA 3E2JA 3G06A 2JQDA 3O53A 3OJAA 4LI1A 5IJBA 2WQWA 4R6AA 3ZYOA 4V2EA 2OMTA 1M10B 5HDHA 3CVRA 2JE1A 3RGXA 1W8AA 3W3KA 3WPDA 4H09A 2Z7XA 2BEXA 3WPBA 3OGKB 2WQXA 1D0BA 4PERA 1OZNA 4R0AA 2P1QB 2XWTC 3BZ5A 4R5CA 1XKUA 1XCDA 2XOTA 3OGLB 3RW6A 1ZIWA 4OQTA 4BV4R 4L3AA 4XSQA 5B0NA 4PKIG 4V2CA 4WP6A 4Q62A 3WPEA 1G9UA 3RIZA 2Z66A 4U08A 4K17A 4LXSA 4RWTC 4KXFB 4TZHA 2BNHA 4C2AB 4MN8B 4LSXC 1OOKG 2P1OB 1O6TA 2Z62A 2OMVA 3KJ4A 3SB4A 2OMXA 4CP6A 3CIYA 2WQVA 3M19A 3P72A 3TSRE 4ECNA 2ASTB 1FT8A 4NKGA 4BSUA 2IFGA 4Q3IA
chains in the Genus database with same CATH superfamily
4XOSA 5GMFA 4Z79A 4CNMA 3WPFA 3RW7A 4Q3GA 3RJ0A 3O6NA 4AY9X 3ZYIA 1XWDC 4LSCA 3G3AA 1XECA 4KT1A 4ARRA 4FDWA 3OGMB 4C2BB 2Z64A 5IYXC 1GWBA 2O6SA 4PSJA 1K5GC 1WWLA 2ASSB 4CC4C 4L3FA 1IO0A 4P8SA 3ZYJA 4R07A 1FQVA 2Z81A 4MQWX 1YRGA 2RR6A 1K5DC 2V9TB 4IM6A 3C6PB 1KOOA 5AWAA 5CMNA 5IJCA 2UZYA 4NZRM 3M18A 4BSRA 3WN4A 3G39A 4R09A 3VQ2A 2P1PB 4PEQB 1QYYA 4G8AA 4Z61C 2WFHA 4M7EC 4NZTM 5GQRK 5AZ5A 1U0ND 1LTXA 1H6TA 4Z94G 2Q4GW 1OTOA 1O6VA 3FXIA 3G04C 4U7LA 2RA8A 1O6SA 2OMZA 3RFSA 3WPGA 4R6GA 4J0MA 1DFJI 4FHOA 2OMYA 3RFJA 1M0ZA 3UN9A 3E6JA 4ARNA 4QXEA 4M7EA 2Y5QA 4R6FA 4R58A 1KOHA 4AW4A 2JE0A 3W3JA 1H6UA 4B8CD 3UL7A 4BSSA 2P1MB 4FS7A 4LSXA 3REZA 3WPHA 4ECOA 2OMWA 5AWDA 3UL9A 5GMHA 5AWBA 5GS0A 1SQ0B 3WPIA 3ULUA 4LI2A 4FCGA 4RCAB 4R08A 2V9SA 5FTTB 4WYKA 1P9AG 2Z65A 2CA6A 4LSAA 3ZYNA 1FS2A 1DS9A 1XEUA 4HQ1A 4YEBB 3UL8A 4Y61B 1M9LA 4U09A 4CNCA 1A9NA 5B0TA 2Z82A 3W3NA 5B4PA 2O6RA 3C6OB 4R5DA 2R9UA 4QBZA 5GMGA 1M9SA 3A79B 4RCWA 1FO1A 4FD0A 5GS2B 5IJDA 5CMPA 2FT3A 3W3MA 1P8TA 2ELLA 2UZXA 1JL5A 2OMUA 3E4GA 4NKHA 4LXRA 1P8VA 3CIGA 4CC4A 4Z64C 3GOZA 4P91A 5LFNA 2A0ZA 4U06A 1OTMA 4PQ8A 2WQUA 4UFRA 1OTNA 3OJAB 5HZLB 5D3IA 3E3ZA 3DZEA 3C6NB 3PMHG 2V70A 3WPCA 4KNGA 4GT6A 1Z7XW 4GLPA 2P1NB 3JB9j 5AWCA 1A4YA 3VQ1A 2Z7XB 4J4LA 3ULVA 3RGZA 1PGVA 2O6QA 3RFEA 4I6JB 4QC0A 4V2DA 3G3BA 4XGOA 3W3LA 4CILA 4Z8GA 4R6JA 2ID5A 3W3GA 5A5CA 2Z63A 1DCEA 3ULAA 4EZGA 4FMZA 1OGQA 3E2JA 3G06A 2JQDA 3O53A 3OJAA 4LI1A 5IJBA 2WQWA 4R6AA 3ZYOA 4V2EA 2OMTA 1M10B 5HDHA 3CVRA 2JE1A 3RGXA 1W8AA 3W3KA 3WPDA 4H09A 2Z7XA 2BEXA 3WPBA 3OGKB 2WQXA 1D0BA 4PERA 1OZNA 4R0AA 2P1QB 2XWTC 3BZ5A 4R5CA 1XKUA 1XCDA 2XOTA 3OGLB 3RW6A 1ZIWA 4OQTA 4BV4R 4L3AA 4XSQA 5B0NA 4PKIG 4V2CA 4WP6A 4Q62A 3WPEA 1G9UA 3RIZA 2Z66A 4U08A 4K17A 4LXSA 4RWTC 4KXFB 4TZHA 2BNHA 4C2AB 4MN8B 4LSXC 1OOKG 2P1OB 1O6TA 2Z62A 2OMVA 3KJ4A 3SB4A 2OMXA 4CP6A 3CIYA 2WQVA 3M19A 3P72A 3TSRE 4ECNA 2ASTB 1FT8A 4NKGA 4BSUA 2IFGA 4Q3IA
chains in the Genus database with same CATH topology
4XOSA 5GMFA 4Z79A 4CNMA 3WPFA 3RW7A 4Q3GA 3RJ0A 3O6NA 4AY9X 3ZYIA 1XWDC 4LSCA 3G3AA 1XECA 4KT1A 4ARRA 4FDWA 3OGMB 4C2BB 2Z64A 5IYXC 1GWBA 2O6SA 4PSJA 1K5GC 1WWLA 2ASSB 4CC4C 4L3FA 1IO0A 4P8SA 3ZYJA 4R07A 1FQVA 2Z81A 4MQWX 1YRGA 2RR6A 1K5DC 2V9TB 4IM6A 3C6PB 1KOOA 5AWAA 5CMNA 5IJCA 2UZYA 3M18A 4BSRA 3WN4A 3G39A 4R09A 3VQ2A 2P1PB 4PEQB 1QYYA 4G8AA 4Z61C 2WFHA 4M7EC 5GQRK 5AZ5A 1U0ND 1LTXA 1H6TA 4Z94G 2Q4GW 1OTOA 1O6VA 3FXIA 3G04C 4U7LA 2RA8A 1O6SA 2OMZA 3RFSA 3WPGA 4R6GA 4J0MA 1DFJI 4FHOA 2OMYA 3RFJA 1M0ZA 3UN9A 3E6JA 4ARNA 4QXEA 4M7EA 2Y5QA 4R6FA 4R58A 1KOHA 4AW4A 2JE0A 3W3JA 1H6UA 4B8CD 3UL7A 4BSSA 2P1MB 4FS7A 4LSXA 3REZA 3WPHA 4ECOA 2OMWA 5AWDA 3UL9A 5GMHA 5AWBA 5GS0A 1SQ0B 3WPIA 3ULUA 4LI2A 4FCGA 4RCAB 4R08A 2V9SA 5FTTB 4WYKA 1P9AG 2Z65A 2CA6A 4LSAA 3ZYNA 1FS2A 1DS9A 1XEUA 4HQ1A 4YEBB 3UL8A 4Y61B 1M9LA 4U09A 4CNCA 1A9NA 5B0TA 2Z82A 3W3NA 2O6RA 5B4PA 3C6OB 4R5DA 2R9UA 4QBZA 5GMGA 1M9SA 3A79B 4RCWA 1FO1A 4FD0A 5GS2B 5IJDA 5CMPA 2FT3A 3W3MA 1P8TA 2ELLA 2UZXA 1JL5A 2OMUA 3E4GA 4NKHA 4LXRA 1P8VA 3CIGA 4CC4A 4Z64C 3GOZA 4P91A 5LFNA 2A0ZA 4U06A 1OTMA 4PQ8A 2WQUA 4UFRA 1OTNA 3OJAB 5HZLB 5D3IA 3E3ZA 3DZEA 3C6NB 3PMHG 2V70A 3WPCA 4KNGA 4GT6A 1Z7XW 4GLPA 2P1NB 3JB9j 5AWCA 1A4YA 3VQ1A 2Z7XB 4J4LA 3ULVA 3RGZA 1PGVA 2O6QA 3RFEA 4I6JB 4QC0A 4V2DA 3G3BA 4XGOA 3W3LA 4CILA 4Z8GA 4R6JA 2ID5A 3W3GA 5A5CA 2Z63A 1DCEA 3ULAA 4EZGA 4FMZA 1OGQA 3E2JA 3G06A 2JQDA 3O53A 3OJAA 4LI1A 5IJBA 2WQWA 4R6AA 3ZYOA 4V2EA 2OMTA 1M10B 5HDHA 3CVRA 2JE1A 3RGXA 1W8AA 3W3KA 3WPDA 4H09A 2Z7XA 2BEXA 3WPBA 3OGKB 2WQXA 1D0BA 4PERA 1OZNA 4R0AA 2P1QB 2XWTC 3BZ5A 4R5CA 1XKUA 1XCDA 2XOTA 3OGLB 3RW6A 1ZIWA 4OQTA 4BV4R 4L3AA 4XSQA 5B0NA 4PKIG 4V2CA 4WP6A 4Q62A 3WPEA 1G9UA 3RIZA 2Z66A 4U08A 4K17A 4LXSA 4RWTC 4KXFB 4TZHA 2BNHA 4C2AB 4MN8B 4LSXC 1OOKG 2P1OB 1O6TA 2Z62A 2OMVA 3KJ4A 3SB4A 2OMXA 4CP6A 3CIYA 2WQVA 3M19A 3P72A 3TSRE 4ECNA 2ASTB 1FT8A 4NKGA 4BSUA 2IFGA 4Q3IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XOS A;  5GMF A;  4Z79 A;  4CNM A;  3WPF A;  3RW7 A;  4Q3G A;  3RJ0 A;  3O6N A;  4AY9 X;  3ZYI A;  1XWD C;  4LSC A;  3G3A A;  1XEC A;  4KT1 A;  4ARR A;  4FDW A;  3OGM B;  4C2B B;  2Z64 A;  5IYX C;  1GWB A;  2O6S A;  4PSJ A;  1K5G C;  1WWL A;  2ASS B;  4CC4 C;  4L3F A;  1IO0 A;  4P8S A;  3ZYJ A;  4R07 A;  1FQV A;  2Z81 A;  4MQW X;  1YRG A;  2RR6 A;  1K5D C;  2V9T B;  4IM6 A;  3C6P B;  1KOO A;  5AWA A;  5CMN A;  5IJC A;  2UZY A;  3M18 A;  4BSR A;  3WN4 A;  3G39 A;  4R09 A;  3VQ2 A;  2P1P B;  4PEQ B;  1QYY A;  4G8A A;  4Z61 C;  2WFH A;  4M7E C;  5GQR K;  5AZ5 A;  1U0N D;  1LTX A;  1H6T A;  4Z94 G;  2Q4G W;  1OTO A;  1O6V A;  3FXI A;  3G04 C;  4U7L A;  2RA8 A;  1O6S A;  2OMZ A;  3RFS A;  3WPG A;  4R6G A;  4J0M A;  1DFJ I;  4FHO A;  2OMY A;  3RFJ A;  1M0Z A;  3UN9 A;  3E6J A;  4ARN A;  4QXE A;  4M7E A;  2Y5Q A;  4R6F A;  4R58 A;  1KOH A;  4AW4 A;  2JE0 A;  3W3J A;  1H6U A;  4B8C D;  3UL7 A;  4BSS A;  2P1M B;  4FS7 A;  4LSX A;  3REZ A;  3WPH A;  4ECO A;  2OMW A;  5AWD A;  3UL9 A;  5GMH A;  5AWB A;  5GS0 A;  1SQ0 B;  3WPI A;  3ULU A;  4LI2 A;  4FCG A;  4RCA B;  4R08 A;  2V9S A;  5FTT B;  4WYK A;  1P9A G;  2Z65 A;  2CA6 A;  4LSA A;  3ZYN A;  1FS2 A;  1DS9 A;  1XEU A;  4HQ1 A;  4YEB B;  3UL8 A;  4Y61 B;  1M9L A;  4U09 A;  4CNC A;  1A9N A;  5B0T A;  2Z82 A;  3W3N A;  2O6R A;  5B4P A;  3C6O B;  4R5D A;  2R9U A;  4QBZ A;  5GMG A;  1M9S A;  3A79 B;  4RCW A;  1FO1 A;  4FD0 A;  5GS2 B;  5IJD A;  5CMP A;  2FT3 A;  3W3M A;  1P8T A;  2ELL A;  2UZX A;  1JL5 A;  2OMU A;  3E4G A;  4NKH A;  4LXR A;  1P8V A;  3CIG A;  4CC4 A;  4Z64 C;  3GOZ A;  4P91 A;  5LFN A;  2A0Z A;  4U06 A;  1OTM A;  4PQ8 A;  2WQU A;  4UFR A;  1OTN A;  3OJA B;  5HZL B;  5D3I A;  3E3Z A;  3DZE A;  3C6N B;  3PMH G;  2V70 A;  3WPC A;  4KNG A;  4GT6 A;  1Z7X W;  4GLP A;  2P1N B;  3JB9 j;  5AWC A;  1A4Y A;  3VQ1 A;  2Z7X B;  4J4L A;  3ULV A;  3RGZ A;  1PGV A;  2O6Q A;  3RFE A;  4I6J B;  4QC0 A;  4V2D A;  3G3B A;  4XGO A;  3W3L A;  4CIL A;  4Z8G A;  4R6J A;  2ID5 A;  3W3G A;  5A5C A;  2Z63 A;  1DCE A;  3ULA A;  4EZG A;  4FMZ A;  1OGQ A;  3E2J A;  3G06 A;  2JQD A;  3O53 A;  3OJA A;  4LI1 A;  5IJB A;  2WQW A;  4R6A A;  3ZYO A;  4V2E A;  2OMT A;  1M10 B;  5HDH A;  3CVR A;  2JE1 A;  3RGX A;  1W8A A;  3W3K A;  3WPD A;  4H09 A;  2Z7X A;  2BEX A;  3WPB A;  3OGK B;  2WQX A;  1D0B A;  4PER A;  1OZN A;  4R0A A;  2P1Q B;  2XWT C;  3BZ5 A;  4R5C A;  1XKU A;  1XCD A;  2XOT A;  3OGL B;  3RW6 A;  1ZIW A;  4OQT A;  4BV4 R;  4L3A A;  4XSQ A;  5B0N A;  4PKI G;  4V2C A;  4WP6 A;  4Q62 A;  3WPE A;  1G9U A;  3RIZ A;  2Z66 A;  4U08 A;  4K17 A;  4LXS A;  4RWT C;  4KXF B;  4TZH A;  2BNH A;  4C2A B;  4MN8 B;  4LSX C;  1OOK G;  2P1O B;  1O6T A;  2Z62 A;  2OMV A;  3KJ4 A;  3SB4 A;  2OMX A;  4CP6 A;  3CIY A;  2WQV A;  3M19 A;  3P72 A;  3TSR E;  4ECN A;  2AST B;  1FT8 A;  4NKG A;  4BSU A;  2IFG A;  4Q3I A; 
#chains in the Genus database with same CATH topology
 4XOS A;  5GMF A;  4Z79 A;  4CNM A;  3WPF A;  3RW7 A;  4Q3G A;  3RJ0 A;  3O6N A;  4AY9 X;  3ZYI A;  1XWD C;  4LSC A;  3G3A A;  1XEC A;  4KT1 A;  4ARR A;  4FDW A;  3OGM B;  4C2B B;  2Z64 A;  5IYX C;  1GWB A;  2O6S A;  4PSJ A;  1K5G C;  1WWL A;  2ASS B;  4CC4 C;  4L3F A;  1IO0 A;  4P8S A;  3ZYJ A;  4R07 A;  1FQV A;  2Z81 A;  4MQW X;  1YRG A;  2RR6 A;  1K5D C;  2V9T B;  4IM6 A;  3C6P B;  1KOO A;  5AWA A;  5CMN A;  5IJC A;  2UZY A;  4NZR M;  3M18 A;  4BSR A;  3WN4 A;  3G39 A;  4R09 A;  3VQ2 A;  2P1P B;  4PEQ B;  1QYY A;  4G8A A;  4Z61 C;  2WFH A;  4M7E C;  4NZT M;  5GQR K;  5AZ5 A;  1U0N D;  1LTX A;  1H6T A;  4Z94 G;  2Q4G W;  1OTO A;  1O6V A;  3FXI A;  3G04 C;  4U7L A;  2RA8 A;  1O6S A;  2OMZ A;  3RFS A;  3WPG A;  4R6G A;  4J0M A;  1DFJ I;  4FHO A;  2OMY A;  3RFJ A;  1M0Z A;  3UN9 A;  3E6J A;  4ARN A;  4QXE A;  4M7E A;  2Y5Q A;  4R6F A;  4R58 A;  1KOH A;  4AW4 A;  2JE0 A;  3W3J A;  1H6U A;  4B8C D;  3UL7 A;  4BSS A;  2P1M B;  4FS7 A;  4LSX A;  3REZ A;  3WPH A;  4ECO A;  2OMW A;  5AWD A;  3UL9 A;  5GMH A;  5AWB A;  5GS0 A;  1SQ0 B;  3WPI A;  3ULU A;  4LI2 A;  4FCG A;  4RCA B;  4R08 A;  2V9S A;  5FTT B;  4WYK A;  1P9A G;  2Z65 A;  2CA6 A;  4LSA A;  3ZYN A;  1FS2 A;  1DS9 A;  1XEU A;  4HQ1 A;  4YEB B;  3UL8 A;  4Y61 B;  1M9L A;  4U09 A;  4CNC A;  1A9N A;  5B0T A;  2Z82 A;  3W3N A;  5B4P A;  2O6R A;  3C6O B;  4R5D A;  2R9U A;  4QBZ A;  5GMG A;  1M9S A;  3A79 B;  4RCW A;  1FO1 A;  4FD0 A;  5GS2 B;  5IJD A;  5CMP A;  2FT3 A;  3W3M A;  1P8T A;  2ELL A;  2UZX A;  1JL5 A;  2OMU A;  3E4G A;  4NKH A;  4LXR A;  1P8V A;  3CIG A;  4CC4 A;  4Z64 C;  3GOZ A;  4P91 A;  5LFN A;  2A0Z A;  4U06 A;  1OTM A;  4PQ8 A;  2WQU A;  4UFR A;  1OTN A;  3OJA B;  5HZL B;  5D3I A;  3E3Z A;  3DZE A;  3C6N B;  3PMH G;  2V70 A;  3WPC A;  4KNG A;  4GT6 A;  1Z7X W;  4GLP A;  2P1N B;  3JB9 j;  5AWC A;  1A4Y A;  3VQ1 A;  2Z7X B;  4J4L A;  3ULV A;  3RGZ A;  1PGV A;  2O6Q A;  3RFE A;  4I6J B;  4QC0 A;  4V2D A;  3G3B A;  4XGO A;  3W3L A;  4CIL A;  4Z8G A;  4R6J A;  2ID5 A;  3W3G A;  5A5C A;  2Z63 A;  1DCE A;  3ULA A;  4EZG A;  4FMZ A;  1OGQ A;  3E2J A;  3G06 A;  2JQD A;  3O53 A;  3OJA A;  4LI1 A;  5IJB A;  2WQW A;  4R6A A;  3ZYO A;  4V2E A;  2OMT A;  1M10 B;  5HDH A;  3CVR A;  2JE1 A;  3RGX A;  1W8A A;  3W3K A;  3WPD A;  4H09 A;  2Z7X A;  2BEX A;  3WPB A;  3OGK B;  2WQX A;  1D0B A;  4PER A;  1OZN A;  4R0A A;  2P1Q B;  2XWT C;  3BZ5 A;  4R5C A;  1XKU A;  1XCD A;  2XOT A;  3OGL B;  3RW6 A;  1ZIW A;  4OQT A;  4BV4 R;  4L3A A;  4XSQ A;  5B0N A;  4PKI G;  4V2C A;  4WP6 A;  4Q62 A;  3WPE A;  1G9U A;  3RIZ A;  2Z66 A;  4U08 A;  4K17 A;  4LXS A;  4RWT C;  4KXF B;  4TZH A;  2BNH A;  4C2A B;  4MN8 B;  4LSX C;  1OOK G;  2P1O B;  1O6T A;  2Z62 A;  2OMV A;  3KJ4 A;  3SB4 A;  2OMX A;  4CP6 A;  3CIY A;  2WQV A;  3M19 A;  3P72 A;  3TSR E;  4ECN A;  2AST B;  1FT8 A;  4NKG A;  4BSU A;  2IFG A;  4Q3I A; 
#chains in the Genus database with same CATH homology
 4XOS A;  5GMF A;  4Z79 A;  4CNM A;  3WPF A;  3RW7 A;  4Q3G A;  3RJ0 A;  3O6N A;  4AY9 X;  3ZYI A;  1XWD C;  4LSC A;  3G3A A;  1XEC A;  4KT1 A;  4ARR A;  4FDW A;  3OGM B;  4C2B B;  2Z64 A;  5IYX C;  1GWB A;  2O6S A;  4PSJ A;  1K5G C;  1WWL A;  2ASS B;  4CC4 C;  4L3F A;  1IO0 A;  4P8S A;  3ZYJ A;  4R07 A;  1FQV A;  2Z81 A;  4MQW X;  1YRG A;  2RR6 A;  1K5D C;  2V9T B;  4IM6 A;  3C6P B;  1KOO A;  5AWA A;  5CMN A;  5IJC A;  2UZY A;  3M18 A;  4BSR A;  3WN4 A;  3G39 A;  4R09 A;  3VQ2 A;  2P1P B;  4PEQ B;  1QYY A;  4G8A A;  4Z61 C;  2WFH A;  4M7E C;  5GQR K;  5AZ5 A;  1U0N D;  1LTX A;  1H6T A;  4Z94 G;  2Q4G W;  1OTO A;  1O6V A;  3FXI A;  3G04 C;  4U7L A;  2RA8 A;  1O6S A;  2OMZ A;  3RFS A;  3WPG A;  4R6G A;  4J0M A;  1DFJ I;  4FHO A;  2OMY A;  3RFJ A;  1M0Z A;  3UN9 A;  3E6J A;  4ARN A;  4QXE A;  4M7E A;  2Y5Q A;  4R6F A;  4R58 A;  1KOH A;  4AW4 A;  2JE0 A;  3W3J A;  1H6U A;  4B8C D;  3UL7 A;  4BSS A;  2P1M B;  4FS7 A;  4LSX A;  3REZ A;  3WPH A;  4ECO A;  2OMW A;  5AWD A;  3UL9 A;  5GMH A;  5AWB A;  5GS0 A;  1SQ0 B;  3WPI A;  3ULU A;  4LI2 A;  4FCG A;  4RCA B;  4R08 A;  2V9S A;  5FTT B;  4WYK A;  1P9A G;  2Z65 A;  2CA6 A;  4LSA A;  3ZYN A;  1FS2 A;  1DS9 A;  1XEU A;  4HQ1 A;  4YEB B;  3UL8 A;  4Y61 B;  1M9L A;  4U09 A;  4CNC A;  1A9N A;  5B0T A;  2Z82 A;  3W3N A;  2O6R A;  5B4P A;  3C6O B;  4R5D A;  2R9U A;  4QBZ A;  5GMG A;  1M9S A;  3A79 B;  4RCW A;  1FO1 A;  4FD0 A;  5GS2 B;  5IJD A;  5CMP A;  2FT3 A;  3W3M A;  1P8T A;  2ELL A;  2UZX A;  1JL5 A;  2OMU A;  3E4G A;  4NKH A;  4LXR A;  1P8V A;  3CIG A;  4CC4 A;  4Z64 C;  3GOZ A;  4P91 A;  5LFN A;  2A0Z A;  4U06 A;  1OTM A;  4PQ8 A;  2WQU A;  4UFR A;  1OTN A;  3OJA B;  5HZL B;  5D3I A;  3E3Z A;  3DZE A;  3C6N B;  3PMH G;  2V70 A;  3WPC A;  4KNG A;  4GT6 A;  1Z7X W;  4GLP A;  2P1N B;  3JB9 j;  5AWC A;  1A4Y A;  3VQ1 A;  2Z7X B;  4J4L A;  3ULV A;  3RGZ A;  1PGV A;  2O6Q A;  3RFE A;  4I6J B;  4QC0 A;  4V2D A;  3G3B A;  4XGO A;  3W3L A;  4CIL A;  4Z8G A;  4R6J A;  2ID5 A;  3W3G A;  5A5C A;  2Z63 A;  1DCE A;  3ULA A;  4EZG A;  4FMZ A;  1OGQ A;  3E2J A;  3G06 A;  2JQD A;  3O53 A;  3OJA A;  4LI1 A;  5IJB A;  2WQW A;  4R6A A;  3ZYO A;  4V2E A;  2OMT A;  1M10 B;  5HDH A;  3CVR A;  2JE1 A;  3RGX A;  1W8A A;  3W3K A;  3WPD A;  4H09 A;  2Z7X A;  2BEX A;  3WPB A;  3OGK B;  2WQX A;  1D0B A;  4PER A;  1OZN A;  4R0A A;  2P1Q B;  2XWT C;  3BZ5 A;  4R5C A;  1XKU A;  1XCD A;  2XOT A;  3OGL B;  3RW6 A;  1ZIW A;  4OQT A;  4BV4 R;  4L3A A;  4XSQ A;  5B0N A;  4PKI G;  4V2C A;  4WP6 A;  4Q62 A;  3WPE A;  1G9U A;  3RIZ A;  2Z66 A;  4U08 A;  4K17 A;  4LXS A;  4RWT C;  4KXF B;  4TZH A;  2BNH A;  4C2A B;  4MN8 B;  4LSX C;  1OOK G;  2P1O B;  1O6T A;  2Z62 A;  2OMV A;  3KJ4 A;  3SB4 A;  2OMX A;  4CP6 A;  3CIY A;  2WQV A;  3M19 A;  3P72 A;  3TSR E;  4ECN A;  2AST B;  1FT8 A;  4NKG A;  4BSU A;  2IFG A;  4Q3I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...