1A09A

C-src (sh2 domain) complexed with ace-formyl phosphotyr-glu-(n,n-dipentyl amine)
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
106
structure length
106
Chain Sequence
DSIQAEEWYFGKITRRESERLLLNAENPRGTFLVRESETTKGAYCLSVSDFDNAKGLNVKHYKIRKLDSGGFYITSRTQFNSLQQLVAYYSKHADGLCHRLTTVCP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Complex (transferase/peptide)
molecule keywords C-SRC TYROSINE KINASE
publication title Peptide ligands of pp60(c-src) SH2 domains: a thermodynamic and structural study.
pubmed doi rcsb
source organism Homo sapiens
total genus 25
structure length 106
sequence length 106
chains with identical sequence B
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 1997-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00017 SH2 SH2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.505.10 Alpha Beta 2-Layer Sandwich SHC Adaptor Protein SH2 domain 1a09A00
3PJPA 1UURA 2MK2A 2RORA 1AYDA 2B3OA 1UUSA 1GHUA 1FU6A 1F1WA 5GJIA 1BG1A 1B47A 5CDWA 3VS2A 1KA7A 3HCKA 4F59A 1NZLA 1SPRA 2C0TA 1LKLA 1BLKA 2DVJA 3VRQA 4LUDA 2BBUA 3K2MA 4E93A 4A4BA 3MXYA 3VRPA 2PLEA 1IS0A 2L6KA 1FHSA 5EG3B 1QG1E 4FBNA 1YVLA 3BUOB 3VRYA 3S8NA 2H46E 2CS0A 2HDXA 1O49A 1Y57A 3UF4A 3OVEA 3HIZB 1PICA 3QWXX 4H1OA 4E68A 1OPLA 1O4QA 2OQ1A 2HMHA 1JYRA 3N7YA 4LUEA 2EYVA 2YSXA 2VIFA 4FL3A 1SKJA 4FL2A 1BFJA 1O4AA 1G83A 2DX0A 5HKZA 1AOTF 1D4WA 5KAZA 3OB1B 3OV1A 3IMDA 1P13A 1TCEA 2FO0A 1BKMA 1O4CA 1X0NA 3WA4A 3ZNIA 3PSJA 4U17A 5DC9A 2L4KA 1O4NA 2EKXA 2KK6A 2GSBA 2JYQA 2EOBA 1IJRA 1GRIA 3CXLA 3VS3A 5AULA 5EHRA 1H9OA 2IZVA 3T04A 5AXIA 2CI9A 3PFVA 1KSWA 3PLFB 1BFIA 2DCRA 1A1EA 1HCSB 2EYYA 2L3TA 1FU5A 2LNXA 2LNWA 3M7FA 1RJAA 1M27A 3MAZA 2DLYA 2MQIA 2AOBA 2C0IA 3VRRA 1O4EA 1OO4A 2KNOA 3OB2B 2EO3A 1RQQC 4F5AA 1A09A 3CD3A 1X6CA 3CBLA 3VS7A 1A1BA 1YVHA 1FBVA 4GWFA 3N84A 3EACA 1QADA 2C9WA 2MC1A 3TKZA 1BKLA 2AOAA 1O4IA 3VS0A 1AYBA 1I3ZA 1A07A 2Y1NA 1R1QA 3C7IA 1O4KA 3GXWA 1CWDL 3PS5A 2IUHA 5J3XA 4DGPA 1LUNA 3S8OA 4H34A 4TZIA 3VS4A 4EIHA 2DM0A 2DLZA 3GXXA 3EAZA 2Y3AB 4OHLA 2LCTA 4K45A 2PNAA 1TZEE 2EO6A 1O4GA 3KFJA 4OHHA 5I6VA 1FMKA 1BM2A 3QWYA 2CR4A 2GE9A 3IN7A 1KC2A 3CWGA 1O43A 3VGOA 3PQZA 2MRJA 5EEQA 4A4CA 2CI8A 1HCTB 1O41A 2K79B 5IBMA 2IUIA 5IBSA 4NWGA 1AYAA 4WWQA 1BHHA 1FYRA 2RSYA 5GJHA 1F2FA 1D1ZA 1AD5A 2EU0A 2H8HA 3VROA 2SRCA 3PSKA 1O4LA 1WQUA 1R1SA 1O48A 1KA6A 2IUGA 4F5BA 2RVFA 5EELA 1D4TA 2CIAA 1O4FA 1CJ1A 1O4JA 3VS6A 1MILA 1LUIA 1LCJA 4JE4A 2ETZA 1BLJA 1JYUA 1JWOA 1X27A 1LKKA 1K9AA 4GL9E 1BMBA 5DC4A 1Z3KA 1O42A 2CBLA 4OHEA 1A1CA 1O4RA 4JEGA 1JYQA 4QSYA 5HKWA 2HUWA 1CSZA 4X6SA 2FCIA 2OZOA 3TL0A 1ZFPE 4K11A 1QCFA 3UYOA 3VRZA 4EY0A 3GQIB 1LUKA 4M4ZA 5D0JA 5EHPA 1NRVA 3N8MA 5HKYA 5DF6A 3BUXB 1AB2A 4NWFA 4D8KA 4DGXA 3HHMB 2AUGA 2XP1A 4XZ0A 1O4PA 4K2RA 3BUWB 1CSYA 1BF5A 2PTKA 3S9KA 1LUMA 1O44A 5DC0B 3BKBA 1AYCA 2LQNA 2HDVA 1O4DA 1MW4A 4JGHA 1O45A 3IN8A 2C0OA 1NZVA 1O4OA 3VRNA 1O4HA 1BHFA 2SHPA 3S8LA 2RMXA 1SPSA 3US4A 1OO3A 4L1BB 1A08A 2EL8A 2EYZA 3VS1A 2PLDA 4P9ZA 1LCKA 4OHDA 1Y1UA 1RPYA 3NHNA 1BHHB 2Y1MA 2MRKA 4U1PA 2H5KA 4K44A 4ROJA 1A81A 1CWEA 4P9VA 3VS5A 1M61A 1O46A 1O4BA 2QMSA 2ECDA 4OHIA 3MXCA 2LQWA 1XA6A 2K7AB 2ABLA 1FBZA 1SHBA 2YU7A 4GPLB 3BUMB 1SHAA 4XZ1A 1JU5A 5BO4A 3BUNB 1O4MA 1AOUF 1A1AA 1SHDA 3IMJA 3OP0A 1O47A 1R1PA 2HCKA 2CRHA 1OPKA 2PNBA
chains in the Genus database with same CATH superfamily
3PJPA 1UURA 2MK2A 2RORA 1AYDA 2B3OA 1UUSA 1GHUA 1FU6A 1F1WA 5GJIA 1BG1A 1B47A 5CDWA 3VS2A 1KA7A 3HCKA 4F59A 1NZLA 1SPRA 2C0TA 1LKLA 1BLKA 2DVJA 3VRQA 4LUDA 2BBUA 3K2MA 4E93A 4A4BA 3MXYA 3VRPA 2PLEA 1IS0A 2L6KA 1FHSA 5EG3B 1QG1E 4FBNA 1YVLA 3BUOB 3VRYA 3S8NA 2H46E 2CS0A 2HDXA 1O49A 1Y57A 3UF4A 3OVEA 3HIZB 1PICA 3QWXX 4H1OA 4E68A 1OPLA 1O4QA 2OQ1A 2HMHA 1JYRA 3N7YA 4LUEA 2EYVA 2YSXA 2VIFA 4FL3A 1SKJA 4FL2A 1BFJA 1O4AA 1G83A 2DX0A 5HKZA 1AOTF 1D4WA 5KAZA 3OB1B 3OV1A 3IMDA 1P13A 1TCEA 2FO0A 1BKMA 1O4CA 1X0NA 3WA4A 3ZNIA 3PSJA 4U17A 5DC9A 2L4KA 1O4NA 2EKXA 2KK6A 2GSBA 2JYQA 2EOBA 1IJRA 1GRIA 3CXLA 3VS3A 5AULA 2KGYA 5EHRA 1H9OA 2IZVA 3T04A 5AXIA 2CI9A 3PFVA 1KSWA 3PLFB 1BFIA 2DCRA 1A1EA 1HCSB 2EYYA 2L3TA 1FU5A 2LNXA 2LNWA 3M7FA 1RJAA 1M27A 3MAZA 2DLYA 2MQIA 2AOBA 2C0IA 3VRRA 1O4EA 1OO4A 2KNOA 3OB2B 2EO3A 1RQQC 4F5AA 1A09A 3CD3A 1X6CA 3CBLA 3VS7A 1A1BA 1YVHA 1FBVA 4GWFA 3N84A 3EACA 1QADA 2C9WA 2MC1A 3TKZA 1BKLA 2AOAA 1O4IA 3VS0A 1AYBA 1I3ZA 1A07A 2Y1NA 1R1QA 3C7IA 1O4KA 3GXWA 1CWDL 3PS5A 2IUHA 5J3XA 4DGPA 1LUNA 3S8OA 4H34A 4TZIA 3VS4A 4EIHA 2DM0A 2DLZA 3GXXA 3EAZA 2Y3AB 4OHLA 2LCTA 4K45A 2PNAA 1TZEE 2EO6A 1O4GA 3KFJA 4OHHA 5I6VA 1FMKA 1BM2A 3QWYA 2CR4A 2GE9A 3IN7A 1KC2A 3LYVA 3CWGA 1O43A 3VGOA 3PQZA 2MRJA 5EEQA 4A4CA 2CI8A 1HCTB 1O41A 2K79B 5IBMA 2IUIA 5IBSA 4NWGA 1AYAA 4WWQA 1BHHA 1FYRA 2RSYA 5GJHA 1F2FA 1D1ZA 1AD5A 2EU0A 2H8HA 3VROA 2SRCA 3PSKA 1O4LA 1WQUA 3K2TA 1R1SA 1O48A 1KA6A 2IUGA 4F5BA 2RVFA 5EELA 1D4TA 2CIAA 1O4FA 1CJ1A 1O4JA 3VS6A 1MILA 1LUIA 1LCJA 4JE4A 2ETZA 1BLJA 1JYUA 1JWOA 1X27A 1LKKA 1K9AA 4GL9E 1BMBA 5DC4A 1Z3KA 1O42A 2CBLA 4OHEA 1A1CA 1O4RA 2LRAA 4JEGA 1JYQA 4QSYA 5HKWA 2HUWA 1CSZA 4X6SA 2FCIA 2OZOA 3TL0A 1ZFPE 4K11A 1QCFA 3UYOA 3VRZA 4EY0A 3GQIB 1LUKA 4M4ZA 5D0JA 5EHPA 1NRVA 3N8MA 5HKYA 5DF6A 3BUXB 1AB2A 4NWFA 4D8KA 4DGXA 3HHMB 2AUGA 2XP1A 4XZ0A 1O4PA 4K2RA 3BUWB 1CSYA 1BF5A 2PTKA 3S9KA 1LUMA 1O44A 5DC0B 3BKBA 1AYCA 2LQNA 2HDVA 1O4DA 1MW4A 4JGHA 1O45A 3IN8A 2C0OA 1NZVA 1O4OA 3VRNA 1O4HA 1BHFA 2SHPA 3S8LA 2RMXA 1SPSA 3US4A 1OO3A 4L1BB 1A08A 2EL8A 2EYZA 3VS1A 2PLDA 4P9ZA 1LCKA 4OHDA 1Y1UA 1RPYA 3NHNA 1BHHB 2Y1MA 2MRKA 4U1PA 2H5KA 4K44A 4ROJA 1A81A 1CWEA 4P9VA 3VS5A 1M61A 1O46A 1O4BA 2QMSA 2ECDA 4OHIA 3MXCA 2LQWA 1XA6A 2K7AB 2ABLA 1FBZA 1SHBA 2YU7A 4GPLB 3BUMB 1SHAA 4XZ1A 1JU5A 5BO4A 3BUNB 1O4MA 1AOUF 1A1AA 1SHDA 3IMJA 3OP0A 1O47A 1R1PA 2HCKA 2CRHA 1OPKA 2PNBA
chains in the Genus database with same CATH topology
3PJPA 1UURA 2MK2A 2RORA 1AYDA 2B3OA 1UUSA 1GHUA 1FU6A 1F1WA 5GJIA 1BG1A 1B47A 5CDWA 3VS2A 1KA7A 3HCKA 4F59A 1NZLA 1SPRA 2C0TA 1LKLA 1BLKA 2DVJA 3VRQA 4LUDA 2BBUA 3K2MA 4E93A 4A4BA 3MXYA 3VRPA 2PLEA 1IS0A 2L6KA 1FHSA 5EG3B 1QG1E 4FBNA 1YVLA 3BUOB 3VRYA 3S8NA 2H46E 2CS0A 2HDXA 1O49A 1Y57A 3UF4A 3OVEA 3HIZB 1PICA 3QWXX 4H1OA 4E68A 1OPLA 1O4QA 2OQ1A 2HMHA 1JYRA 3N7YA 4LUEA 2EYVA 2YSXA 2VIFA 4FL3A 1SKJA 4FL2A 1BFJA 1O4AA 1G83A 2DX0A 5HKZA 1AOTF 1D4WA 5KAZA 3OB1B 3OV1A 3IMDA 1P13A 1TCEA 2FO0A 1BKMA 1O4CA 1X0NA 3WA4A 3ZNIA 3PSJA 4U17A 5DC9A 2L4KA 1O4NA 2EKXA 2KK6A 2GSBA 2JYQA 2EOBA 1IJRA 1GRIA 3CXLA 3VS3A 5AULA 5EHRA 1H9OA 2IZVA 3T04A 5AXIA 2CI9A 3PFVA 1KSWA 3PLFB 1BFIA 2DCRA 1A1EA 1HCSB 2EYYA 2L3TA 1FU5A 2LNXA 2LNWA 3M7FA 1RJAA 1M27A 3MAZA 2DLYA 2MQIA 2AOBA 2C0IA 3VRRA 1O4EA 1OO4A 2KNOA 3OB2B 2EO3A 1RQQC 4F5AA 1A09A 3CD3A 1X6CA 3CBLA 3VS7A 1A1BA 1YVHA 1FBVA 4GWFA 3N84A 3EACA 1QADA 2C9WA 2MC1A 3TKZA 1BKLA 2AOAA 1O4IA 3VS0A 1AYBA 1I3ZA 1A07A 2Y1NA 1R1QA 3C7IA 1O4KA 3GXWA 1CWDL 3PS5A 2IUHA 5J3XA 4DGPA 1LUNA 3S8OA 4H34A 4TZIA 3VS4A 4EIHA 2DM0A 2DLZA 3GXXA 3EAZA 2Y3AB 4OHLA 2LCTA 4K45A 2PNAA 1TZEE 2EO6A 1O4GA 3KFJA 4OHHA 5I6VA 1FMKA 1BM2A 3QWYA 2CR4A 2GE9A 3IN7A 1KC2A 3CWGA 1O43A 3VGOA 3PQZA 2MRJA 5EEQA 4A4CA 2CI8A 1HCTB 1O41A 2K79B 5IBMA 2IUIA 5IBSA 4NWGA 1AYAA 4WWQA 1BHHA 1FYRA 2RSYA 5GJHA 1F2FA 1D1ZA 1AD5A 2EU0A 2H8HA 3VROA 2SRCA 3PSKA 1O4LA 1WQUA 1R1SA 1O48A 1KA6A 2IUGA 4F5BA 2RVFA 5EELA 1D4TA 2CIAA 1O4FA 1CJ1A 1O4JA 3VS6A 1MILA 1LUIA 1LCJA 4JE4A 2ETZA 1BLJA 1JYUA 1JWOA 1X27A 1LKKA 1K9AA 4GL9E 1BMBA 5DC4A 1Z3KA 1O42A 2CBLA 4OHEA 1A1CA 1O4RA 4JEGA 1JYQA 4QSYA 5HKWA 2HUWA 1CSZA 4X6SA 2FCIA 2OZOA 3TL0A 1ZFPE 4K11A 1QCFA 3UYOA 3VRZA 4EY0A 3GQIB 1LUKA 4M4ZA 5D0JA 5EHPA 1NRVA 3N8MA 5HKYA 5DF6A 3BUXB 1AB2A 4NWFA 4D8KA 4DGXA 3HHMB 2AUGA 2XP1A 4XZ0A 1O4PA 4K2RA 3BUWB 1CSYA 1BF5A 2PTKA 3S9KA 1LUMA 1O44A 5DC0B 3BKBA 1AYCA 2LQNA 2HDVA 1O4DA 1MW4A 4JGHA 1O45A 3IN8A 2C0OA 1NZVA 1O4OA 3VRNA 1O4HA 1BHFA 2SHPA 3S8LA 2RMXA 1SPSA 3US4A 1OO3A 4L1BB 1A08A 2EL8A 2EYZA 3VS1A 2PLDA 4P9ZA 1LCKA 4OHDA 1Y1UA 1RPYA 3NHNA 1BHHB 2Y1MA 2MRKA 4U1PA 2H5KA 4K44A 4ROJA 1A81A 1CWEA 4P9VA 3VS5A 1M61A 1O46A 1O4BA 2QMSA 2ECDA 4OHIA 3MXCA 2LQWA 1XA6A 2K7AB 2ABLA 1FBZA 1SHBA 2YU7A 4GPLB 3BUMB 1SHAA 4XZ1A 1JU5A 5BO4A 3BUNB 1O4MA 1AOUF 1A1AA 1SHDA 3IMJA 3OP0A 1O47A 1R1PA 2HCKA 2CRHA 1OPKA 2PNBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PJP A;  1UUR A;  2MK2 A;  2ROR A;  1AYD A;  2B3O A;  1UUS A;  1GHU A;  1FU6 A;  1F1W A;  5GJI A;  1BG1 A;  1B47 A;  5CDW A;  3VS2 A;  1KA7 A;  3HCK A;  4F59 A;  1NZL A;  1SPR A;  2C0T A;  1LKL A;  1BLK A;  2DVJ A;  3VRQ A;  4LUD A;  2BBU A;  3K2M A;  4E93 A;  4A4B A;  3MXY A;  3VRP A;  2PLE A;  1IS0 A;  2L6K A;  1FHS A;  5EG3 B;  1QG1 E;  4FBN A;  1YVL A;  3BUO B;  3VRY A;  3S8N A;  2H46 E;  2CS0 A;  2HDX A;  1O49 A;  1Y57 A;  3UF4 A;  3OVE A;  3HIZ B;  1PIC A;  3QWX X;  4H1O A;  4E68 A;  1OPL A;  1O4Q A;  2OQ1 A;  2HMH A;  1JYR A;  3N7Y A;  4LUE A;  2EYV A;  2YSX A;  2VIF A;  4FL3 A;  1SKJ A;  4FL2 A;  1BFJ A;  1O4A A;  1G83 A;  2DX0 A;  5HKZ A;  1AOT F;  1D4W A;  5KAZ A;  3OB1 B;  3OV1 A;  3IMD A;  1P13 A;  1TCE A;  2FO0 A;  1BKM A;  1O4C A;  1X0N A;  3WA4 A;  3ZNI A;  3PSJ A;  4U17 A;  5DC9 A;  2L4K A;  1O4N A;  2EKX A;  2KK6 A;  2GSB A;  2JYQ A;  2EOB A;  1IJR A;  1GRI A;  3CXL A;  3VS3 A;  5AUL A;  5EHR A;  1H9O A;  2IZV A;  3T04 A;  5AXI A;  2CI9 A;  3PFV A;  1KSW A;  3PLF B;  1BFI A;  2DCR A;  1A1E A;  1HCS B;  2EYY A;  2L3T A;  1FU5 A;  2LNX A;  2LNW A;  3M7F A;  1RJA A;  1M27 A;  3MAZ A;  2DLY A;  2MQI A;  2AOB A;  2C0I A;  3VRR A;  1O4E A;  1OO4 A;  2KNO A;  3OB2 B;  2EO3 A;  1RQQ C;  4F5A A;  1A09 A;  3CD3 A;  1X6C A;  3CBL A;  3VS7 A;  1A1B A;  1YVH A;  1FBV A;  4GWF A;  3N84 A;  3EAC A;  1QAD A;  2C9W A;  2MC1 A;  3TKZ A;  1BKL A;  2AOA A;  1O4I A;  3VS0 A;  1AYB A;  1I3Z A;  1A07 A;  2Y1N A;  1R1Q A;  3C7I A;  1O4K A;  3GXW A;  1CWD L;  3PS5 A;  2IUH A;  5J3X A;  4DGP A;  1LUN A;  3S8O A;  4H34 A;  4TZI A;  3VS4 A;  4EIH A;  2DM0 A;  2DLZ A;  3GXX A;  3EAZ A;  2Y3A B;  4OHL A;  2LCT A;  4K45 A;  2PNA A;  1TZE E;  2EO6 A;  1O4G A;  3KFJ A;  4OHH A;  5I6V A;  1FMK A;  1BM2 A;  3QWY A;  2CR4 A;  2GE9 A;  3IN7 A;  1KC2 A;  3CWG A;  1O43 A;  3VGO A;  3PQZ A;  2MRJ A;  5EEQ A;  4A4C A;  2CI8 A;  1HCT B;  1O41 A;  2K79 B;  5IBM A;  2IUI A;  5IBS A;  4NWG A;  1AYA A;  4WWQ A;  1BHH A;  1FYR A;  2RSY A;  5GJH A;  1F2F A;  1D1Z A;  1AD5 A;  2EU0 A;  2H8H A;  3VRO A;  2SRC A;  3PSK A;  1O4L A;  1WQU A;  1R1S A;  1O48 A;  1KA6 A;  2IUG A;  4F5B A;  2RVF A;  5EEL A;  1D4T A;  2CIA A;  1O4F A;  1CJ1 A;  1O4J A;  3VS6 A;  1MIL A;  1LUI A;  1LCJ A;  4JE4 A;  2ETZ A;  1BLJ A;  1JYU A;  1JWO A;  1X27 A;  1LKK A;  1K9A A;  4GL9 E;  1BMB A;  5DC4 A;  1Z3K A;  1O42 A;  2CBL A;  4OHE A;  1A1C A;  1O4R A;  4JEG A;  1JYQ A;  4QSY A;  5HKW A;  2HUW A;  1CSZ A;  4X6S A;  2FCI A;  2OZO A;  3TL0 A;  1ZFP E;  4K11 A;  1QCF A;  3UYO A;  3VRZ A;  4EY0 A;  3GQI B;  1LUK A;  4M4Z A;  5D0J A;  5EHP A;  1NRV A;  3N8M A;  5HKY A;  5DF6 A;  3BUX B;  1AB2 A;  4NWF A;  4D8K A;  4DGX A;  3HHM B;  2AUG A;  2XP1 A;  4XZ0 A;  1O4P A;  4K2R A;  3BUW B;  1CSY A;  1BF5 A;  2PTK A;  3S9K A;  1LUM A;  1O44 A;  5DC0 B;  3BKB A;  1AYC A;  2LQN A;  2HDV A;  1O4D A;  1MW4 A;  4JGH A;  1O45 A;  3IN8 A;  2C0O A;  1NZV A;  1O4O A;  3VRN A;  1O4H A;  1BHF A;  2SHP A;  3S8L A;  2RMX A;  1SPS A;  3US4 A;  1OO3 A;  4L1B B;  1A08 A;  2EL8 A;  2EYZ A;  3VS1 A;  2PLD A;  4P9Z A;  1LCK A;  4OHD A;  1Y1U A;  1RPY A;  3NHN A;  1BHH B;  2Y1M A;  2MRK A;  4U1P A;  2H5K A;  4K44 A;  4ROJ A;  1A81 A;  1CWE A;  4P9V A;  3VS5 A;  1M61 A;  1O46 A;  1O4B A;  2QMS A;  2ECD A;  4OHI A;  3MXC A;  2LQW A;  1XA6 A;  2K7A B;  2ABL A;  1FBZ A;  1SHB A;  2YU7 A;  4GPL B;  3BUM B;  1SHA A;  4XZ1 A;  1JU5 A;  5BO4 A;  3BUN B;  1O4M A;  1AOU F;  1A1A A;  1SHD A;  3IMJ A;  3OP0 A;  1O47 A;  1R1P A;  2HCK A;  2CRH A;  1OPK A;  2PNB A; 
#chains in the Genus database with same CATH topology
 3PJP A;  1UUR A;  2MK2 A;  2ROR A;  1AYD A;  2B3O A;  1UUS A;  1GHU A;  1FU6 A;  1F1W A;  5GJI A;  1BG1 A;  1B47 A;  5CDW A;  3VS2 A;  1KA7 A;  3HCK A;  4F59 A;  1NZL A;  1SPR A;  2C0T A;  1LKL A;  1BLK A;  2DVJ A;  3VRQ A;  4LUD A;  2BBU A;  3K2M A;  4E93 A;  4A4B A;  3MXY A;  3VRP A;  2PLE A;  1IS0 A;  2L6K A;  1FHS A;  5EG3 B;  1QG1 E;  4FBN A;  1YVL A;  3BUO B;  3VRY A;  3S8N A;  2H46 E;  2CS0 A;  2HDX A;  1O49 A;  1Y57 A;  3UF4 A;  3OVE A;  3HIZ B;  1PIC A;  3QWX X;  4H1O A;  4E68 A;  1OPL A;  1O4Q A;  2OQ1 A;  2HMH A;  1JYR A;  3N7Y A;  4LUE A;  2EYV A;  2YSX A;  2VIF A;  4FL3 A;  1SKJ A;  4FL2 A;  1BFJ A;  1O4A A;  1G83 A;  2DX0 A;  5HKZ A;  1AOT F;  1D4W A;  5KAZ A;  3OB1 B;  3OV1 A;  3IMD A;  1P13 A;  1TCE A;  2FO0 A;  1BKM A;  1O4C A;  1X0N A;  3WA4 A;  3ZNI A;  3PSJ A;  4U17 A;  5DC9 A;  2L4K A;  1O4N A;  2EKX A;  2KK6 A;  2GSB A;  2JYQ A;  2EOB A;  1IJR A;  1GRI A;  3CXL A;  3VS3 A;  5AUL A;  2KGY A;  5EHR A;  1H9O A;  2IZV A;  3T04 A;  5AXI A;  2CI9 A;  3PFV A;  1KSW A;  3PLF B;  1BFI A;  2DCR A;  1A1E A;  1HCS B;  2EYY A;  2L3T A;  1FU5 A;  2LNX A;  2LNW A;  3M7F A;  1RJA A;  1M27 A;  3MAZ A;  2DLY A;  2MQI A;  2AOB A;  2C0I A;  3VRR A;  1O4E A;  1OO4 A;  2KNO A;  3OB2 B;  2EO3 A;  1RQQ C;  4F5A A;  1A09 A;  3CD3 A;  1X6C A;  3CBL A;  3VS7 A;  1A1B A;  1YVH A;  1FBV A;  4GWF A;  3N84 A;  3EAC A;  1QAD A;  2C9W A;  2MC1 A;  3TKZ A;  1BKL A;  2AOA A;  1O4I A;  3VS0 A;  1AYB A;  1I3Z A;  1A07 A;  2Y1N A;  1R1Q A;  3C7I A;  1O4K A;  3GXW A;  1CWD L;  3PS5 A;  2IUH A;  5J3X A;  4DGP A;  1LUN A;  3S8O A;  4H34 A;  4TZI A;  3VS4 A;  4EIH A;  2DM0 A;  2DLZ A;  3GXX A;  3EAZ A;  2Y3A B;  4OHL A;  2LCT A;  4K45 A;  2PNA A;  1TZE E;  2EO6 A;  1O4G A;  3KFJ A;  4OHH A;  5I6V A;  1FMK A;  1BM2 A;  3QWY A;  2CR4 A;  2GE9 A;  3IN7 A;  1KC2 A;  3LYV A;  3CWG A;  1O43 A;  3VGO A;  3PQZ A;  2MRJ A;  5EEQ A;  4A4C A;  2CI8 A;  1HCT B;  1O41 A;  2K79 B;  5IBM A;  2IUI A;  5IBS A;  4NWG A;  1AYA A;  4WWQ A;  1BHH A;  1FYR A;  2RSY A;  5GJH A;  1F2F A;  1D1Z A;  1AD5 A;  2EU0 A;  2H8H A;  3VRO A;  2SRC A;  3PSK A;  1O4L A;  1WQU A;  3K2T A;  1R1S A;  1O48 A;  1KA6 A;  2IUG A;  4F5B A;  2RVF A;  5EEL A;  1D4T A;  2CIA A;  1O4F A;  1CJ1 A;  1O4J A;  3VS6 A;  1MIL A;  1LUI A;  1LCJ A;  4JE4 A;  2ETZ A;  1BLJ A;  1JYU A;  1JWO A;  1X27 A;  1LKK A;  1K9A A;  4GL9 E;  1BMB A;  5DC4 A;  1Z3K A;  1O42 A;  2CBL A;  4OHE A;  1A1C A;  1O4R A;  2LRA A;  4JEG A;  1JYQ A;  4QSY A;  5HKW A;  2HUW A;  1CSZ A;  4X6S A;  2FCI A;  2OZO A;  3TL0 A;  1ZFP E;  4K11 A;  1QCF A;  3UYO A;  3VRZ A;  4EY0 A;  3GQI B;  1LUK A;  4M4Z A;  5D0J A;  5EHP A;  1NRV A;  3N8M A;  5HKY A;  5DF6 A;  3BUX B;  1AB2 A;  4NWF A;  4D8K A;  4DGX A;  3HHM B;  2AUG A;  2XP1 A;  4XZ0 A;  1O4P A;  4K2R A;  3BUW B;  1CSY A;  1BF5 A;  2PTK A;  3S9K A;  1LUM A;  1O44 A;  5DC0 B;  3BKB A;  1AYC A;  2LQN A;  2HDV A;  1O4D A;  1MW4 A;  4JGH A;  1O45 A;  3IN8 A;  2C0O A;  1NZV A;  1O4O A;  3VRN A;  1O4H A;  1BHF A;  2SHP A;  3S8L A;  2RMX A;  1SPS A;  3US4 A;  1OO3 A;  4L1B B;  1A08 A;  2EL8 A;  2EYZ A;  3VS1 A;  2PLD A;  4P9Z A;  1LCK A;  4OHD A;  1Y1U A;  1RPY A;  3NHN A;  1BHH B;  2Y1M A;  2MRK A;  4U1P A;  2H5K A;  4K44 A;  4ROJ A;  1A81 A;  1CWE A;  4P9V A;  3VS5 A;  1M61 A;  1O46 A;  1O4B A;  2QMS A;  2ECD A;  4OHI A;  3MXC A;  2LQW A;  1XA6 A;  2K7A B;  2ABL A;  1FBZ A;  1SHB A;  2YU7 A;  4GPL B;  3BUM B;  1SHA A;  4XZ1 A;  1JU5 A;  5BO4 A;  3BUN B;  1O4M A;  1AOU F;  1A1A A;  1SHD A;  3IMJ A;  3OP0 A;  1O47 A;  1R1P A;  2HCK A;  2CRH A;  1OPK A;  2PNB A; 
#chains in the Genus database with same CATH homology
 3PJP A;  1UUR A;  2MK2 A;  2ROR A;  1AYD A;  2B3O A;  1UUS A;  1GHU A;  1FU6 A;  1F1W A;  5GJI A;  1BG1 A;  1B47 A;  5CDW A;  3VS2 A;  1KA7 A;  3HCK A;  4F59 A;  1NZL A;  1SPR A;  2C0T A;  1LKL A;  1BLK A;  2DVJ A;  3VRQ A;  4LUD A;  2BBU A;  3K2M A;  4E93 A;  4A4B A;  3MXY A;  3VRP A;  2PLE A;  1IS0 A;  2L6K A;  1FHS A;  5EG3 B;  1QG1 E;  4FBN A;  1YVL A;  3BUO B;  3VRY A;  3S8N A;  2H46 E;  2CS0 A;  2HDX A;  1O49 A;  1Y57 A;  3UF4 A;  3OVE A;  3HIZ B;  1PIC A;  3QWX X;  4H1O A;  4E68 A;  1OPL A;  1O4Q A;  2OQ1 A;  2HMH A;  1JYR A;  3N7Y A;  4LUE A;  2EYV A;  2YSX A;  2VIF A;  4FL3 A;  1SKJ A;  4FL2 A;  1BFJ A;  1O4A A;  1G83 A;  2DX0 A;  5HKZ A;  1AOT F;  1D4W A;  5KAZ A;  3OB1 B;  3OV1 A;  3IMD A;  1P13 A;  1TCE A;  2FO0 A;  1BKM A;  1O4C A;  1X0N A;  3WA4 A;  3ZNI A;  3PSJ A;  4U17 A;  5DC9 A;  2L4K A;  1O4N A;  2EKX A;  2KK6 A;  2GSB A;  2JYQ A;  2EOB A;  1IJR A;  1GRI A;  3CXL A;  3VS3 A;  5AUL A;  5EHR A;  1H9O A;  2IZV A;  3T04 A;  5AXI A;  2CI9 A;  3PFV A;  1KSW A;  3PLF B;  1BFI A;  2DCR A;  1A1E A;  1HCS B;  2EYY A;  2L3T A;  1FU5 A;  2LNX A;  2LNW A;  3M7F A;  1RJA A;  1M27 A;  3MAZ A;  2DLY A;  2MQI A;  2AOB A;  2C0I A;  3VRR A;  1O4E A;  1OO4 A;  2KNO A;  3OB2 B;  2EO3 A;  1RQQ C;  4F5A A;  1A09 A;  3CD3 A;  1X6C A;  3CBL A;  3VS7 A;  1A1B A;  1YVH A;  1FBV A;  4GWF A;  3N84 A;  3EAC A;  1QAD A;  2C9W A;  2MC1 A;  3TKZ A;  1BKL A;  2AOA A;  1O4I A;  3VS0 A;  1AYB A;  1I3Z A;  1A07 A;  2Y1N A;  1R1Q A;  3C7I A;  1O4K A;  3GXW A;  1CWD L;  3PS5 A;  2IUH A;  5J3X A;  4DGP A;  1LUN A;  3S8O A;  4H34 A;  4TZI A;  3VS4 A;  4EIH A;  2DM0 A;  2DLZ A;  3GXX A;  3EAZ A;  2Y3A B;  4OHL A;  2LCT A;  4K45 A;  2PNA A;  1TZE E;  2EO6 A;  1O4G A;  3KFJ A;  4OHH A;  5I6V A;  1FMK A;  1BM2 A;  3QWY A;  2CR4 A;  2GE9 A;  3IN7 A;  1KC2 A;  3CWG A;  1O43 A;  3VGO A;  3PQZ A;  2MRJ A;  5EEQ A;  4A4C A;  2CI8 A;  1HCT B;  1O41 A;  2K79 B;  5IBM A;  2IUI A;  5IBS A;  4NWG A;  1AYA A;  4WWQ A;  1BHH A;  1FYR A;  2RSY A;  5GJH A;  1F2F A;  1D1Z A;  1AD5 A;  2EU0 A;  2H8H A;  3VRO A;  2SRC A;  3PSK A;  1O4L A;  1WQU A;  1R1S A;  1O48 A;  1KA6 A;  2IUG A;  4F5B A;  2RVF A;  5EEL A;  1D4T A;  2CIA A;  1O4F A;  1CJ1 A;  1O4J A;  3VS6 A;  1MIL A;  1LUI A;  1LCJ A;  4JE4 A;  2ETZ A;  1BLJ A;  1JYU A;  1JWO A;  1X27 A;  1LKK A;  1K9A A;  4GL9 E;  1BMB A;  5DC4 A;  1Z3K A;  1O42 A;  2CBL A;  4OHE A;  1A1C A;  1O4R A;  4JEG A;  1JYQ A;  4QSY A;  5HKW A;  2HUW A;  1CSZ A;  4X6S A;  2FCI A;  2OZO A;  3TL0 A;  1ZFP E;  4K11 A;  1QCF A;  3UYO A;  3VRZ A;  4EY0 A;  3GQI B;  1LUK A;  4M4Z A;  5D0J A;  5EHP A;  1NRV A;  3N8M A;  5HKY A;  5DF6 A;  3BUX B;  1AB2 A;  4NWF A;  4D8K A;  4DGX A;  3HHM B;  2AUG A;  2XP1 A;  4XZ0 A;  1O4P A;  4K2R A;  3BUW B;  1CSY A;  1BF5 A;  2PTK A;  3S9K A;  1LUM A;  1O44 A;  5DC0 B;  3BKB A;  1AYC A;  2LQN A;  2HDV A;  1O4D A;  1MW4 A;  4JGH A;  1O45 A;  3IN8 A;  2C0O A;  1NZV A;  1O4O A;  3VRN A;  1O4H A;  1BHF A;  2SHP A;  3S8L A;  2RMX A;  1SPS A;  3US4 A;  1OO3 A;  4L1B B;  1A08 A;  2EL8 A;  2EYZ A;  3VS1 A;  2PLD A;  4P9Z A;  1LCK A;  4OHD A;  1Y1U A;  1RPY A;  3NHN A;  1BHH B;  2Y1M A;  2MRK A;  4U1P A;  2H5K A;  4K44 A;  4ROJ A;  1A81 A;  1CWE A;  4P9V A;  3VS5 A;  1M61 A;  1O46 A;  1O4B A;  2QMS A;  2ECD A;  4OHI A;  3MXC A;  2LQW A;  1XA6 A;  2K7A B;  2ABL A;  1FBZ A;  1SHB A;  2YU7 A;  4GPL B;  3BUM B;  1SHA A;  4XZ1 A;  1JU5 A;  5BO4 A;  3BUN B;  1O4M A;  1AOU F;  1A1A A;  1SHD A;  3IMJ A;  3OP0 A;  1O47 A;  1R1P A;  2HCK A;  2CRH A;  1OPK A;  2PNB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...