5D0JA

Grb7 sh2 with inhibitor peptide
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
106
structure length
106
Chain Sequence
HRTQLWFHGRISREESQRLIGQQGLVDGLFLVRESQRNPQGFVLSLCHLQKVKHYLILPSEEEGRLYFSMDDGQTRFTDLLQLVEFHQLNRGILPCLLRHCCTRVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Signaling protein
molecule keywords Growth factor receptor-bound protein 7
publication title Unexpected involvement of staple leads to redesign of selective bicyclic peptide inhibitor of Grb7.
pubmed doi rcsb
source organism Homo sapiens
total genus 23
structure length 106
sequence length 106
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00017 SH2 SH2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.505.10 Alpha Beta 2-Layer Sandwich SHC Adaptor Protein SH2 domain 5d0jA00
1O41A 1NRVA 1SHBA 1AOUF 1A81A 3BKBA 4A4BA 2HUWA 2FCIA 1QCFA 1O47A 2IUGA 4K45A 5HKWA 2PTKA 1IJRA 3US4A 3S9KA 1O4RA 2HDVA 2EKXA 3VS1A 1LKKA 1OO4A 1FBZA 1X27A 3PSKA 5CDWA 1BFJA 1BHHB 3S8OA 4E68A 1LCJA 4H34A 5HKYA 5DC4A 3OB2B 1O44A 4WWQA 3KFJA 2OQ1A 2RORA 3TL0A 1A07A 3NHNA 3VRPA 3IN7A 1I3ZA 1F2FA 1TCEA 1XA6A 4NWFA 2K79B 2CR4A 2EOBA 1O45A 4TZIA 2DLYA 2EYYA 2FO0A 4GL9E 2L6KA 3GXXA 2C0TA 2AUGA 3N8MA 5EG3B 1BMBA 1FU6A 1A1BA 1O4HA 1CSYA 1ZFPE 1LUKA 1RQQC 4FL3A 2YSXA 1AOTF 3VS2A 4F5BA 3TKZA 3MXYA 3VS0A 1O4CA 1CWEA 4XZ0A 3PS5A 5EHRA 1KA6A 3GXWA 2LNWA 5HKZA 1K9AA 1OPKA 3VRZA 4U1PA 3IMJA 1QADA 4M4ZA 1B47A 1Z3KA 1SPRA 1BFIA 3PLFB 3BUNB 1KC2A 1CWDL 1A1EA 1CSZA 2SRCA 5IBSA 1O4BA 3N7YA 3BUMB 2IUHA 1KSWA 3C7IA 3IN8A 1O4FA 1FYRA 4DGXA 3VRQA 4LUEA 2HDXA 5EEQA 1KA7A 4QSYA 1YVHA 1GRIA 1O4PA 2C0IA 1JWOA 2OZOA 3VS5A 3CBLA 1PICA 1RJAA 4P9VA 5DC0B 2AOBA 4OHEA 5DC9A 1JU5A 3VRYA 4DGPA 1O4GA 1MILA 2EO3A 4LUDA 2BBUA 1BHHA 5BO4A 3M7FA 3OP0A 2QMSA 1IS0A 1SKJA 4GWFA 2LQNA 1CJ1A 3BUXB 2KNOA 1BM2A 3QWXX 3PJPA 2GE9A 4FL2A 2PLDA 1QG1E 2MQIA 1M61A 2K7AB 5D0JA 1JYQA 3QWYA 4K2RA 2KK6A 1G83A 3MXCA 3S8LA 4NWGA 2H5KA 2RVFA 5J3XA 2GSBA 2PNAA 2AOAA 4K11A 1AYCA 3PSJA 3BUOB 2DVJA 5I6VA 1O4AA 2DCRA 1SHAA 2LNXA 1H9OA 1LUMA 1R1QA 1YVLA 3K2MA 1AYAA 1FU5A 2RSYA 1BLJA 2Y1NA 1LUIA 4EY0A 3IMDA 4EIHA 4U17A 1LKLA 2DX0A 1O4JA 4P9ZA 3UF4A 3OVEA 3S8NA 4GPLB 3MAZA 2ABLA 1O46A 2C9WA 1O4EA 2JYQA 2L4KA 2IUIA 3CWGA 2ETZA 3HCKA 5IBMA 1BKLA 1SPSA 3VS4A 2Y3AB 2HCKA 1A1CA 3CD3A 4D8KA 1O4MA 4XZ1A 5GJIA 1O4NA 1R1PA 5AXIA 1BHFA 1LCKA 1HCTB 1UURA 1D4TA 1FMKA 2IZVA 1JYRA 1O4QA 2Y1MA 4F59A 1TZEE 3OV1A 1O4KA 1R1SA 5EHPA 1D4WA 3PQZA 1O4IA 1HCSB 1AYBA 2LCTA 1OO3A 2HMHA 3ZNIA 3VRNA 1O42A 2LQWA 3VS6A 5EELA 2ECDA 2SHPA 2EO6A 4X6SA 2VIFA 4F5AA 1A08A 5DF6A 4K44A 4A4CA 2PNBA 3HHMB 1O4OA 2CBLA 4OHDA 4JEGA 2YU7A 2DLZA 1BKMA 4JE4A 3PFVA 1NZVA 1O4LA 1X0NA 5KAZA 5AULA 1X6CA 2MRKA 1LUNA 1Y57A 2PLEA 2EYVA 2H46E 2EYZA 2EU0A 1P13A 2MK2A 1A1AA 3BUWB 1O49A 1O43A 3EACA 1UUSA 2CI9A 2EL8A 3VS7A 1JYUA 4E93A 1Y1UA 2CS0A 4ROJA 2XP1A 3HIZB 3WA4A 3OB1B 4OHLA 1OPLA 4FBNA 2CIAA 3VS3A 1BG1A 3VROA 2DM0A 3N84A 1GHUA 4H1OA 2CI8A 1RPYA 3UYOA 1NZLA 1BLKA 2B3OA 2L3TA 1AD5A 2H8HA 3EAZA 1M27A 1FHSA 3VGOA 2MRJA 3VRRA 4JGHA 1BF5A 1WQUA 1F1WA 4OHHA 1AYDA 4OHIA 3T04A 2MC1A 2RMXA 1MW4A 4L1BB 2C0OA 1FBVA 3GQIB 1D1ZA 5GJHA 3CXLA 1AB2A 2CRHA 1A09A 1O4DA 1O48A 1SHDA
chains in the Genus database with same CATH superfamily
1O41A 1NRVA 1SHBA 1AOUF 1A81A 3BKBA 4A4BA 2HUWA 2FCIA 1QCFA 1O47A 2IUGA 4K45A 5HKWA 2PTKA 1IJRA 3US4A 3S9KA 1O4RA 2HDVA 2EKXA 3VS1A 1LKKA 1OO4A 1FBZA 1X27A 3PSKA 5CDWA 1BFJA 1BHHB 3S8OA 4E68A 1LCJA 4H34A 5HKYA 5DC4A 3OB2B 1O44A 4WWQA 3KFJA 2OQ1A 2RORA 3TL0A 1A07A 3NHNA 3VRPA 3IN7A 1I3ZA 1F2FA 1TCEA 1XA6A 4NWFA 2K79B 2CR4A 2EOBA 1O45A 4TZIA 2DLYA 2EYYA 2FO0A 4GL9E 2KGYA 2L6KA 3GXXA 2C0TA 2AUGA 3N8MA 5EG3B 1BMBA 1FU6A 1A1BA 1O4HA 1CSYA 1ZFPE 1LUKA 1RQQC 4FL3A 2YSXA 1AOTF 3VS2A 4F5BA 3TKZA 3MXYA 3VS0A 1O4CA 1CWEA 4XZ0A 3PS5A 5EHRA 1KA6A 3GXWA 2LNWA 5HKZA 1K9AA 1OPKA 3VRZA 4U1PA 3IMJA 1QADA 4M4ZA 1B47A 1Z3KA 1SPRA 1BFIA 3PLFB 3BUNB 1KC2A 1CWDL 1A1EA 1CSZA 2SRCA 5IBSA 1O4BA 3N7YA 3BUMB 2IUHA 1KSWA 3C7IA 3IN8A 1O4FA 1FYRA 4DGXA 3VRQA 4LUEA 2HDXA 5EEQA 1KA7A 4QSYA 1YVHA 1GRIA 1O4PA 2C0IA 1JWOA 2OZOA 3VS5A 3CBLA 1PICA 1RJAA 4P9VA 5DC0B 2AOBA 4OHEA 5DC9A 1JU5A 3VRYA 4DGPA 1O4GA 1MILA 2EO3A 4LUDA 2BBUA 1BHHA 5BO4A 3M7FA 3OP0A 2QMSA 1IS0A 1SKJA 4GWFA 2LQNA 1CJ1A 3BUXB 2KNOA 1BM2A 3QWXX 3PJPA 2GE9A 3LYVA 4FL2A 2PLDA 1QG1E 2MQIA 1M61A 2K7AB 5D0JA 1JYQA 3QWYA 4K2RA 2KK6A 1G83A 3MXCA 3S8LA 4NWGA 2H5KA 2RVFA 5J3XA 2GSBA 2PNAA 2AOAA 4K11A 1AYCA 3PSJA 3BUOB 2DVJA 5I6VA 1O4AA 2DCRA 1SHAA 2LNXA 1H9OA 1LUMA 1R1QA 1YVLA 3K2MA 1AYAA 1FU5A 2RSYA 1BLJA 2Y1NA 1LUIA 4EY0A 3IMDA 4EIHA 4U17A 1LKLA 2DX0A 1O4JA 4P9ZA 3UF4A 3OVEA 3S8NA 4GPLB 3MAZA 2ABLA 1O46A 2C9WA 1O4EA 2JYQA 2L4KA 2IUIA 3CWGA 2ETZA 3HCKA 5IBMA 1BKLA 1SPSA 3VS4A 2Y3AB 2HCKA 1A1CA 3CD3A 4D8KA 1O4MA 4XZ1A 5GJIA 1O4NA 1R1PA 5AXIA 1BHFA 1LCKA 1HCTB 1UURA 1D4TA 1FMKA 2IZVA 1JYRA 1O4QA 2Y1MA 4F59A 1TZEE 3OV1A 1O4KA 1R1SA 5EHPA 1D4WA 3PQZA 1O4IA 1HCSB 1AYBA 2LCTA 1OO3A 2HMHA 3ZNIA 3VRNA 1O42A 2LQWA 3VS6A 5EELA 2ECDA 2SHPA 2EO6A 4X6SA 2VIFA 4F5AA 1A08A 5DF6A 4K44A 4A4CA 2PNBA 3HHMB 1O4OA 2CBLA 4OHDA 4JEGA 2YU7A 2DLZA 1BKMA 4JE4A 3PFVA 1NZVA 1O4LA 1X0NA 5KAZA 5AULA 1X6CA 2MRKA 1LUNA 1Y57A 2PLEA 2EYVA 2H46E 2EYZA 2EU0A 1P13A 2MK2A 1A1AA 3BUWB 1O49A 1O43A 3EACA 1UUSA 2CI9A 2EL8A 3VS7A 2LRAA 1JYUA 4E93A 1Y1UA 2CS0A 4ROJA 2XP1A 3HIZB 3WA4A 3OB1B 4OHLA 1OPLA 4FBNA 2CIAA 3VS3A 1BG1A 3VROA 2DM0A 3N84A 1GHUA 4H1OA 2CI8A 1RPYA 3UYOA 1NZLA 1BLKA 2B3OA 2L3TA 3K2TA 1AD5A 2H8HA 3EAZA 1M27A 1FHSA 3VGOA 2MRJA 3VRRA 4JGHA 1BF5A 1WQUA 1F1WA 4OHHA 1AYDA 4OHIA 3T04A 2MC1A 2RMXA 1MW4A 4L1BB 2C0OA 1FBVA 3GQIB 1D1ZA 5GJHA 3CXLA 1AB2A 2CRHA 1A09A 1O4DA 1O48A 1SHDA
chains in the Genus database with same CATH topology
1O41A 1NRVA 1SHBA 1AOUF 1A81A 3BKBA 4A4BA 2HUWA 2FCIA 1QCFA 1O47A 2IUGA 4K45A 5HKWA 2PTKA 1IJRA 3US4A 3S9KA 1O4RA 2HDVA 2EKXA 3VS1A 1LKKA 1OO4A 1FBZA 1X27A 3PSKA 5CDWA 1BFJA 1BHHB 3S8OA 4E68A 1LCJA 4H34A 5HKYA 5DC4A 3OB2B 1O44A 4WWQA 3KFJA 2OQ1A 2RORA 3TL0A 1A07A 3NHNA 3VRPA 3IN7A 1I3ZA 1F2FA 1TCEA 1XA6A 4NWFA 2K79B 2CR4A 2EOBA 1O45A 4TZIA 2DLYA 2EYYA 2FO0A 4GL9E 2L6KA 3GXXA 2C0TA 2AUGA 3N8MA 5EG3B 1BMBA 1FU6A 1A1BA 1O4HA 1CSYA 1ZFPE 1LUKA 1RQQC 4FL3A 2YSXA 1AOTF 3VS2A 4F5BA 3TKZA 3MXYA 3VS0A 1O4CA 1CWEA 4XZ0A 3PS5A 5EHRA 1KA6A 3GXWA 2LNWA 5HKZA 1K9AA 1OPKA 3VRZA 4U1PA 3IMJA 1QADA 4M4ZA 1B47A 1Z3KA 1SPRA 1BFIA 3PLFB 3BUNB 1KC2A 1CWDL 1A1EA 1CSZA 2SRCA 5IBSA 1O4BA 3N7YA 3BUMB 2IUHA 1KSWA 3C7IA 3IN8A 1O4FA 1FYRA 4DGXA 3VRQA 4LUEA 2HDXA 5EEQA 1KA7A 4QSYA 1YVHA 1GRIA 1O4PA 2C0IA 1JWOA 2OZOA 3VS5A 3CBLA 1PICA 1RJAA 4P9VA 5DC0B 2AOBA 4OHEA 5DC9A 1JU5A 3VRYA 4DGPA 1O4GA 1MILA 2EO3A 4LUDA 2BBUA 1BHHA 5BO4A 3M7FA 3OP0A 2QMSA 1IS0A 1SKJA 4GWFA 2LQNA 1CJ1A 3BUXB 2KNOA 1BM2A 3QWXX 3PJPA 2GE9A 4FL2A 2PLDA 1QG1E 2MQIA 1M61A 2K7AB 5D0JA 1JYQA 3QWYA 4K2RA 2KK6A 1G83A 3MXCA 3S8LA 4NWGA 2H5KA 2RVFA 5J3XA 2GSBA 2PNAA 2AOAA 4K11A 1AYCA 3PSJA 3BUOB 2DVJA 5I6VA 1O4AA 2DCRA 1SHAA 2LNXA 1H9OA 1LUMA 1R1QA 1YVLA 3K2MA 1AYAA 1FU5A 2RSYA 1BLJA 2Y1NA 1LUIA 4EY0A 3IMDA 4EIHA 4U17A 1LKLA 2DX0A 1O4JA 4P9ZA 3UF4A 3OVEA 3S8NA 4GPLB 3MAZA 2ABLA 1O46A 2C9WA 1O4EA 2JYQA 2L4KA 2IUIA 3CWGA 2ETZA 3HCKA 5IBMA 1BKLA 1SPSA 3VS4A 2Y3AB 2HCKA 1A1CA 3CD3A 4D8KA 1O4MA 4XZ1A 5GJIA 1O4NA 1R1PA 5AXIA 1BHFA 1LCKA 1HCTB 1UURA 1D4TA 1FMKA 2IZVA 1JYRA 1O4QA 2Y1MA 4F59A 1TZEE 3OV1A 1O4KA 1R1SA 5EHPA 1D4WA 3PQZA 1O4IA 1HCSB 1AYBA 2LCTA 1OO3A 2HMHA 3ZNIA 3VRNA 1O42A 2LQWA 3VS6A 5EELA 2ECDA 2SHPA 2EO6A 4X6SA 2VIFA 4F5AA 1A08A 5DF6A 4K44A 4A4CA 2PNBA 3HHMB 1O4OA 2CBLA 4OHDA 4JEGA 2YU7A 2DLZA 1BKMA 4JE4A 3PFVA 1NZVA 1O4LA 1X0NA 5KAZA 5AULA 1X6CA 2MRKA 1LUNA 1Y57A 2PLEA 2EYVA 2H46E 2EYZA 2EU0A 1P13A 2MK2A 1A1AA 3BUWB 1O49A 1O43A 3EACA 1UUSA 2CI9A 2EL8A 3VS7A 1JYUA 4E93A 1Y1UA 2CS0A 4ROJA 2XP1A 3HIZB 3WA4A 3OB1B 4OHLA 1OPLA 4FBNA 2CIAA 3VS3A 1BG1A 3VROA 2DM0A 3N84A 1GHUA 4H1OA 2CI8A 1RPYA 3UYOA 1NZLA 1BLKA 2B3OA 2L3TA 1AD5A 2H8HA 3EAZA 1M27A 1FHSA 3VGOA 2MRJA 3VRRA 4JGHA 1BF5A 1WQUA 1F1WA 4OHHA 1AYDA 4OHIA 3T04A 2MC1A 2RMXA 1MW4A 4L1BB 2C0OA 1FBVA 3GQIB 1D1ZA 5GJHA 3CXLA 1AB2A 2CRHA 1A09A 1O4DA 1O48A 1SHDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1O41 A;  1NRV A;  1SHB A;  1AOU F;  1A81 A;  3BKB A;  4A4B A;  2HUW A;  2FCI A;  1QCF A;  1O47 A;  2IUG A;  4K45 A;  5HKW A;  2PTK A;  1IJR A;  3US4 A;  3S9K A;  1O4R A;  2HDV A;  2EKX A;  3VS1 A;  1LKK A;  1OO4 A;  1FBZ A;  1X27 A;  3PSK A;  5CDW A;  1BFJ A;  1BHH B;  3S8O A;  4E68 A;  1LCJ A;  4H34 A;  5HKY A;  5DC4 A;  3OB2 B;  1O44 A;  4WWQ A;  3KFJ A;  2OQ1 A;  2ROR A;  3TL0 A;  1A07 A;  3NHN A;  3VRP A;  3IN7 A;  1I3Z A;  1F2F A;  1TCE A;  1XA6 A;  4NWF A;  2K79 B;  2CR4 A;  2EOB A;  1O45 A;  4TZI A;  2DLY A;  2EYY A;  2FO0 A;  4GL9 E;  2L6K A;  3GXX A;  2C0T A;  2AUG A;  3N8M A;  5EG3 B;  1BMB A;  1FU6 A;  1A1B A;  1O4H A;  1CSY A;  1ZFP E;  1LUK A;  1RQQ C;  4FL3 A;  2YSX A;  1AOT F;  3VS2 A;  4F5B A;  3TKZ A;  3MXY A;  3VS0 A;  1O4C A;  1CWE A;  4XZ0 A;  3PS5 A;  5EHR A;  1KA6 A;  3GXW A;  2LNW A;  5HKZ A;  1K9A A;  1OPK A;  3VRZ A;  4U1P A;  3IMJ A;  1QAD A;  4M4Z A;  1B47 A;  1Z3K A;  1SPR A;  1BFI A;  3PLF B;  3BUN B;  1KC2 A;  1CWD L;  1A1E A;  1CSZ A;  2SRC A;  5IBS A;  1O4B A;  3N7Y A;  3BUM B;  2IUH A;  1KSW A;  3C7I A;  3IN8 A;  1O4F A;  1FYR A;  4DGX A;  3VRQ A;  4LUE A;  2HDX A;  5EEQ A;  1KA7 A;  4QSY A;  1YVH A;  1GRI A;  1O4P A;  2C0I A;  1JWO A;  2OZO A;  3VS5 A;  3CBL A;  1PIC A;  1RJA A;  4P9V A;  5DC0 B;  2AOB A;  4OHE A;  5DC9 A;  1JU5 A;  3VRY A;  4DGP A;  1O4G A;  1MIL A;  2EO3 A;  4LUD A;  2BBU A;  1BHH A;  5BO4 A;  3M7F A;  3OP0 A;  2QMS A;  1IS0 A;  1SKJ A;  4GWF A;  2LQN A;  1CJ1 A;  3BUX B;  2KNO A;  1BM2 A;  3QWX X;  3PJP A;  2GE9 A;  4FL2 A;  2PLD A;  1QG1 E;  2MQI A;  1M61 A;  2K7A B;  5D0J A;  1JYQ A;  3QWY A;  4K2R A;  2KK6 A;  1G83 A;  3MXC A;  3S8L A;  4NWG A;  2H5K A;  2RVF A;  5J3X A;  2GSB A;  2PNA A;  2AOA A;  4K11 A;  1AYC A;  3PSJ A;  3BUO B;  2DVJ A;  5I6V A;  1O4A A;  2DCR A;  1SHA A;  2LNX A;  1H9O A;  1LUM A;  1R1Q A;  1YVL A;  3K2M A;  1AYA A;  1FU5 A;  2RSY A;  1BLJ A;  2Y1N A;  1LUI A;  4EY0 A;  3IMD A;  4EIH A;  4U17 A;  1LKL A;  2DX0 A;  1O4J A;  4P9Z A;  3UF4 A;  3OVE A;  3S8N A;  4GPL B;  3MAZ A;  2ABL A;  1O46 A;  2C9W A;  1O4E A;  2JYQ A;  2L4K A;  2IUI A;  3CWG A;  2ETZ A;  3HCK A;  5IBM A;  1BKL A;  1SPS A;  3VS4 A;  2Y3A B;  2HCK A;  1A1C A;  3CD3 A;  4D8K A;  1O4M A;  4XZ1 A;  5GJI A;  1O4N A;  1R1P A;  5AXI A;  1BHF A;  1LCK A;  1HCT B;  1UUR A;  1D4T A;  1FMK A;  2IZV A;  1JYR A;  1O4Q A;  2Y1M A;  4F59 A;  1TZE E;  3OV1 A;  1O4K A;  1R1S A;  5EHP A;  1D4W A;  3PQZ A;  1O4I A;  1HCS B;  1AYB A;  2LCT A;  1OO3 A;  2HMH A;  3ZNI A;  3VRN A;  1O42 A;  2LQW A;  3VS6 A;  5EEL A;  2ECD A;  2SHP A;  2EO6 A;  4X6S A;  2VIF A;  4F5A A;  1A08 A;  5DF6 A;  4K44 A;  4A4C A;  2PNB A;  3HHM B;  1O4O A;  2CBL A;  4OHD A;  4JEG A;  2YU7 A;  2DLZ A;  1BKM A;  4JE4 A;  3PFV A;  1NZV A;  1O4L A;  1X0N A;  5KAZ A;  5AUL A;  1X6C A;  2MRK A;  1LUN A;  1Y57 A;  2PLE A;  2EYV A;  2H46 E;  2EYZ A;  2EU0 A;  1P13 A;  2MK2 A;  1A1A A;  3BUW B;  1O49 A;  1O43 A;  3EAC A;  1UUS A;  2CI9 A;  2EL8 A;  3VS7 A;  1JYU A;  4E93 A;  1Y1U A;  2CS0 A;  4ROJ A;  2XP1 A;  3HIZ B;  3WA4 A;  3OB1 B;  4OHL A;  1OPL A;  4FBN A;  2CIA A;  3VS3 A;  1BG1 A;  3VRO A;  2DM0 A;  3N84 A;  1GHU A;  4H1O A;  2CI8 A;  1RPY A;  3UYO A;  1NZL A;  1BLK A;  2B3O A;  2L3T A;  1AD5 A;  2H8H A;  3EAZ A;  1M27 A;  1FHS A;  3VGO A;  2MRJ A;  3VRR A;  4JGH A;  1BF5 A;  1WQU A;  1F1W A;  4OHH A;  1AYD A;  4OHI A;  3T04 A;  2MC1 A;  2RMX A;  1MW4 A;  4L1B B;  2C0O A;  1FBV A;  3GQI B;  1D1Z A;  5GJH A;  3CXL A;  1AB2 A;  2CRH A;  1A09 A;  1O4D A;  1O48 A;  1SHD A; 
#chains in the Genus database with same CATH topology
 1O41 A;  1NRV A;  1SHB A;  1AOU F;  1A81 A;  3BKB A;  4A4B A;  2HUW A;  2FCI A;  1QCF A;  1O47 A;  2IUG A;  4K45 A;  5HKW A;  2PTK A;  1IJR A;  3US4 A;  3S9K A;  1O4R A;  2HDV A;  2EKX A;  3VS1 A;  1LKK A;  1OO4 A;  1FBZ A;  1X27 A;  3PSK A;  5CDW A;  1BFJ A;  1BHH B;  3S8O A;  4E68 A;  1LCJ A;  4H34 A;  5HKY A;  5DC4 A;  3OB2 B;  1O44 A;  4WWQ A;  3KFJ A;  2OQ1 A;  2ROR A;  3TL0 A;  1A07 A;  3NHN A;  3VRP A;  3IN7 A;  1I3Z A;  1F2F A;  1TCE A;  1XA6 A;  4NWF A;  2K79 B;  2CR4 A;  2EOB A;  1O45 A;  4TZI A;  2DLY A;  2EYY A;  2FO0 A;  4GL9 E;  2KGY A;  2L6K A;  3GXX A;  2C0T A;  2AUG A;  3N8M A;  5EG3 B;  1BMB A;  1FU6 A;  1A1B A;  1O4H A;  1CSY A;  1ZFP E;  1LUK A;  1RQQ C;  4FL3 A;  2YSX A;  1AOT F;  3VS2 A;  4F5B A;  3TKZ A;  3MXY A;  3VS0 A;  1O4C A;  1CWE A;  4XZ0 A;  3PS5 A;  5EHR A;  1KA6 A;  3GXW A;  2LNW A;  5HKZ A;  1K9A A;  1OPK A;  3VRZ A;  4U1P A;  3IMJ A;  1QAD A;  4M4Z A;  1B47 A;  1Z3K A;  1SPR A;  1BFI A;  3PLF B;  3BUN B;  1KC2 A;  1CWD L;  1A1E A;  1CSZ A;  2SRC A;  5IBS A;  1O4B A;  3N7Y A;  3BUM B;  2IUH A;  1KSW A;  3C7I A;  3IN8 A;  1O4F A;  1FYR A;  4DGX A;  3VRQ A;  4LUE A;  2HDX A;  5EEQ A;  1KA7 A;  4QSY A;  1YVH A;  1GRI A;  1O4P A;  2C0I A;  1JWO A;  2OZO A;  3VS5 A;  3CBL A;  1PIC A;  1RJA A;  4P9V A;  5DC0 B;  2AOB A;  4OHE A;  5DC9 A;  1JU5 A;  3VRY A;  4DGP A;  1O4G A;  1MIL A;  2EO3 A;  4LUD A;  2BBU A;  1BHH A;  5BO4 A;  3M7F A;  3OP0 A;  2QMS A;  1IS0 A;  1SKJ A;  4GWF A;  2LQN A;  1CJ1 A;  3BUX B;  2KNO A;  1BM2 A;  3QWX X;  3PJP A;  2GE9 A;  3LYV A;  4FL2 A;  2PLD A;  1QG1 E;  2MQI A;  1M61 A;  2K7A B;  5D0J A;  1JYQ A;  3QWY A;  4K2R A;  2KK6 A;  1G83 A;  3MXC A;  3S8L A;  4NWG A;  2H5K A;  2RVF A;  5J3X A;  2GSB A;  2PNA A;  2AOA A;  4K11 A;  1AYC A;  3PSJ A;  3BUO B;  2DVJ A;  5I6V A;  1O4A A;  2DCR A;  1SHA A;  2LNX A;  1H9O A;  1LUM A;  1R1Q A;  1YVL A;  3K2M A;  1AYA A;  1FU5 A;  2RSY A;  1BLJ A;  2Y1N A;  1LUI A;  4EY0 A;  3IMD A;  4EIH A;  4U17 A;  1LKL A;  2DX0 A;  1O4J A;  4P9Z A;  3UF4 A;  3OVE A;  3S8N A;  4GPL B;  3MAZ A;  2ABL A;  1O46 A;  2C9W A;  1O4E A;  2JYQ A;  2L4K A;  2IUI A;  3CWG A;  2ETZ A;  3HCK A;  5IBM A;  1BKL A;  1SPS A;  3VS4 A;  2Y3A B;  2HCK A;  1A1C A;  3CD3 A;  4D8K A;  1O4M A;  4XZ1 A;  5GJI A;  1O4N A;  1R1P A;  5AXI A;  1BHF A;  1LCK A;  1HCT B;  1UUR A;  1D4T A;  1FMK A;  2IZV A;  1JYR A;  1O4Q A;  2Y1M A;  4F59 A;  1TZE E;  3OV1 A;  1O4K A;  1R1S A;  5EHP A;  1D4W A;  3PQZ A;  1O4I A;  1HCS B;  1AYB A;  2LCT A;  1OO3 A;  2HMH A;  3ZNI A;  3VRN A;  1O42 A;  2LQW A;  3VS6 A;  5EEL A;  2ECD A;  2SHP A;  2EO6 A;  4X6S A;  2VIF A;  4F5A A;  1A08 A;  5DF6 A;  4K44 A;  4A4C A;  2PNB A;  3HHM B;  1O4O A;  2CBL A;  4OHD A;  4JEG A;  2YU7 A;  2DLZ A;  1BKM A;  4JE4 A;  3PFV A;  1NZV A;  1O4L A;  1X0N A;  5KAZ A;  5AUL A;  1X6C A;  2MRK A;  1LUN A;  1Y57 A;  2PLE A;  2EYV A;  2H46 E;  2EYZ A;  2EU0 A;  1P13 A;  2MK2 A;  1A1A A;  3BUW B;  1O49 A;  1O43 A;  3EAC A;  1UUS A;  2CI9 A;  2EL8 A;  3VS7 A;  2LRA A;  1JYU A;  4E93 A;  1Y1U A;  2CS0 A;  4ROJ A;  2XP1 A;  3HIZ B;  3WA4 A;  3OB1 B;  4OHL A;  1OPL A;  4FBN A;  2CIA A;  3VS3 A;  1BG1 A;  3VRO A;  2DM0 A;  3N84 A;  1GHU A;  4H1O A;  2CI8 A;  1RPY A;  3UYO A;  1NZL A;  1BLK A;  2B3O A;  2L3T A;  3K2T A;  1AD5 A;  2H8H A;  3EAZ A;  1M27 A;  1FHS A;  3VGO A;  2MRJ A;  3VRR A;  4JGH A;  1BF5 A;  1WQU A;  1F1W A;  4OHH A;  1AYD A;  4OHI A;  3T04 A;  2MC1 A;  2RMX A;  1MW4 A;  4L1B B;  2C0O A;  1FBV A;  3GQI B;  1D1Z A;  5GJH A;  3CXL A;  1AB2 A;  2CRH A;  1A09 A;  1O4D A;  1O48 A;  1SHD A; 
#chains in the Genus database with same CATH homology
 1O41 A;  1NRV A;  1SHB A;  1AOU F;  1A81 A;  3BKB A;  4A4B A;  2HUW A;  2FCI A;  1QCF A;  1O47 A;  2IUG A;  4K45 A;  5HKW A;  2PTK A;  1IJR A;  3US4 A;  3S9K A;  1O4R A;  2HDV A;  2EKX A;  3VS1 A;  1LKK A;  1OO4 A;  1FBZ A;  1X27 A;  3PSK A;  5CDW A;  1BFJ A;  1BHH B;  3S8O A;  4E68 A;  1LCJ A;  4H34 A;  5HKY A;  5DC4 A;  3OB2 B;  1O44 A;  4WWQ A;  3KFJ A;  2OQ1 A;  2ROR A;  3TL0 A;  1A07 A;  3NHN A;  3VRP A;  3IN7 A;  1I3Z A;  1F2F A;  1TCE A;  1XA6 A;  4NWF A;  2K79 B;  2CR4 A;  2EOB A;  1O45 A;  4TZI A;  2DLY A;  2EYY A;  2FO0 A;  4GL9 E;  2L6K A;  3GXX A;  2C0T A;  2AUG A;  3N8M A;  5EG3 B;  1BMB A;  1FU6 A;  1A1B A;  1O4H A;  1CSY A;  1ZFP E;  1LUK A;  1RQQ C;  4FL3 A;  2YSX A;  1AOT F;  3VS2 A;  4F5B A;  3TKZ A;  3MXY A;  3VS0 A;  1O4C A;  1CWE A;  4XZ0 A;  3PS5 A;  5EHR A;  1KA6 A;  3GXW A;  2LNW A;  5HKZ A;  1K9A A;  1OPK A;  3VRZ A;  4U1P A;  3IMJ A;  1QAD A;  4M4Z A;  1B47 A;  1Z3K A;  1SPR A;  1BFI A;  3PLF B;  3BUN B;  1KC2 A;  1CWD L;  1A1E A;  1CSZ A;  2SRC A;  5IBS A;  1O4B A;  3N7Y A;  3BUM B;  2IUH A;  1KSW A;  3C7I A;  3IN8 A;  1O4F A;  1FYR A;  4DGX A;  3VRQ A;  4LUE A;  2HDX A;  5EEQ A;  1KA7 A;  4QSY A;  1YVH A;  1GRI A;  1O4P A;  2C0I A;  1JWO A;  2OZO A;  3VS5 A;  3CBL A;  1PIC A;  1RJA A;  4P9V A;  5DC0 B;  2AOB A;  4OHE A;  5DC9 A;  1JU5 A;  3VRY A;  4DGP A;  1O4G A;  1MIL A;  2EO3 A;  4LUD A;  2BBU A;  1BHH A;  5BO4 A;  3M7F A;  3OP0 A;  2QMS A;  1IS0 A;  1SKJ A;  4GWF A;  2LQN A;  1CJ1 A;  3BUX B;  2KNO A;  1BM2 A;  3QWX X;  3PJP A;  2GE9 A;  4FL2 A;  2PLD A;  1QG1 E;  2MQI A;  1M61 A;  2K7A B;  5D0J A;  1JYQ A;  3QWY A;  4K2R A;  2KK6 A;  1G83 A;  3MXC A;  3S8L A;  4NWG A;  2H5K A;  2RVF A;  5J3X A;  2GSB A;  2PNA A;  2AOA A;  4K11 A;  1AYC A;  3PSJ A;  3BUO B;  2DVJ A;  5I6V A;  1O4A A;  2DCR A;  1SHA A;  2LNX A;  1H9O A;  1LUM A;  1R1Q A;  1YVL A;  3K2M A;  1AYA A;  1FU5 A;  2RSY A;  1BLJ A;  2Y1N A;  1LUI A;  4EY0 A;  3IMD A;  4EIH A;  4U17 A;  1LKL A;  2DX0 A;  1O4J A;  4P9Z A;  3UF4 A;  3OVE A;  3S8N A;  4GPL B;  3MAZ A;  2ABL A;  1O46 A;  2C9W A;  1O4E A;  2JYQ A;  2L4K A;  2IUI A;  3CWG A;  2ETZ A;  3HCK A;  5IBM A;  1BKL A;  1SPS A;  3VS4 A;  2Y3A B;  2HCK A;  1A1C A;  3CD3 A;  4D8K A;  1O4M A;  4XZ1 A;  5GJI A;  1O4N A;  1R1P A;  5AXI A;  1BHF A;  1LCK A;  1HCT B;  1UUR A;  1D4T A;  1FMK A;  2IZV A;  1JYR A;  1O4Q A;  2Y1M A;  4F59 A;  1TZE E;  3OV1 A;  1O4K A;  1R1S A;  5EHP A;  1D4W A;  3PQZ A;  1O4I A;  1HCS B;  1AYB A;  2LCT A;  1OO3 A;  2HMH A;  3ZNI A;  3VRN A;  1O42 A;  2LQW A;  3VS6 A;  5EEL A;  2ECD A;  2SHP A;  2EO6 A;  4X6S A;  2VIF A;  4F5A A;  1A08 A;  5DF6 A;  4K44 A;  4A4C A;  2PNB A;  3HHM B;  1O4O A;  2CBL A;  4OHD A;  4JEG A;  2YU7 A;  2DLZ A;  1BKM A;  4JE4 A;  3PFV A;  1NZV A;  1O4L A;  1X0N A;  5KAZ A;  5AUL A;  1X6C A;  2MRK A;  1LUN A;  1Y57 A;  2PLE A;  2EYV A;  2H46 E;  2EYZ A;  2EU0 A;  1P13 A;  2MK2 A;  1A1A A;  3BUW B;  1O49 A;  1O43 A;  3EAC A;  1UUS A;  2CI9 A;  2EL8 A;  3VS7 A;  1JYU A;  4E93 A;  1Y1U A;  2CS0 A;  4ROJ A;  2XP1 A;  3HIZ B;  3WA4 A;  3OB1 B;  4OHL A;  1OPL A;  4FBN A;  2CIA A;  3VS3 A;  1BG1 A;  3VRO A;  2DM0 A;  3N84 A;  1GHU A;  4H1O A;  2CI8 A;  1RPY A;  3UYO A;  1NZL A;  1BLK A;  2B3O A;  2L3T A;  1AD5 A;  2H8H A;  3EAZ A;  1M27 A;  1FHS A;  3VGO A;  2MRJ A;  3VRR A;  4JGH A;  1BF5 A;  1WQU A;  1F1W A;  4OHH A;  1AYD A;  4OHI A;  3T04 A;  2MC1 A;  2RMX A;  1MW4 A;  4L1B B;  2C0O A;  1FBV A;  3GQI B;  1D1Z A;  5GJH A;  3CXL A;  1AB2 A;  2CRH A;  1A09 A;  1O4D A;  1O48 A;  1SHD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...