1FYRA

Dimer formation through domain swapping in the crystal structure of the grb2-sh2 ac-pyvnv complex
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
95
structure length
95
Chain Sequence
b'HPWFFGKIPRAKAEEMLSKQRHDGAFLIRESESAPGDFSLSVKFGNDVQHFKVLRDGAGKYFLWVVKFNSLNELVDYHRSTSVSRNQQIFLRDIE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GROWTH FACTOR RECEPTOR-BOUND PROTEIN 2
publication title Dimer formation through domain swapping in the crystal structure of the Grb2-SH2-Ac-pYVNV complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hormone/growth factor
total genus 20
structure length 95
sequence length 95
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2000-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00017 SH2 SH2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.505.10 Alpha Beta 2-Layer Sandwich SHC Adaptor Protein SH2 domain 1fyrA00
1SHAA 3HCKA 2MQIA 1F1WA 2Y1NA 1A09A 3GQIB 1AYBA 5DC4A 3KFJA 1OPKA 1FU5A 3N7YA 4P9ZA 2YU7A 1O47A 3HIZB 3UYOA 4NWGA 1O4CA 2C0IA 4H1OA 3OV1A 1LKKA 4H34A 4JE4A 1O45A 1GHUA 2CIAA 1AYCA 1BFJA 5J3XA 2PTKA 2EL8A 2XP1A 1TCEA 1JYRA 3VS7A 1BG1A 2DCRA 1AOTF 3VS3A 1PICA 3VS5A 1ZFPE 5GJIA 3PSJA 3VRYA 1O41A 1O4IA 1OPLA 2EYVA 1FU6A 2PNBA 3CWGA 1FMKA 1HCTB 1O4OA 2IUIA 4X6SA 1GRIA 2EO6A 3C7IA 3BUXB 2HCKA 1O4QA 1OO4A 3IMDA 2FO0A 2RVFA 3CXLA 4K2RA 3S8OA 2EYZA 3VRRA 2DLYA 1O4NA 1JU5A 1A1BA 3VRPA 4F5AA 1CWEA 3T04A 2PLEA 1BKLA 3VROA 1A81A 4OHIA 3PFVA 1R1SA 1I3ZA 1CSZA 5IBSA 4OHHA 4ROJA 2LCTA 1RQQC 3N84A 4JEGA 1A1CA 2QMSA 1TZEE 1QCFA 5CDWA 4DGPA 1BMBA 5EEQA 1LUIA 4NWFA 1A07A 4A4BA 3M7FA 2OZOA 5AXIA 2IUGA 3VRZA 4U1PA 1BFIA 3VS0A 1K9AA 5BO4A 4QSYA 1BHFA 1Y1UA 2JYQA 1O4HA 4OHDA 1KA6A 4FBNA 4E93A 1Y57A 2MRKA 3MXYA 4JGHA 1NZVA 3QWXX 1H9OA 4K11A 1D1ZA 1FBZA 4F59A 4XZ1A 1A08A 5EELA 1RJAA 2GE9A 2MRJA 1P13A 2EO3A 1CJ1A 3PS5A 1LUMA 1RPYA 2AUGA 2L6KA 3GXXA 1IJRA 2L4KA 3BUNB 1LCJA 1O46A 2H46E 5DF6A 4P9VA 3OB2B 1X27A 3S9KA 4OHLA 4EIHA 1O4PA 1YVHA 2IZVA 2FCIA 1BLKA 1JWOA 4K45A 3PQZA 2ECDA 2CRHA 1O43A 3BUOB 3BKBA 4LUDA 1O49A 2KNOA 1AD5A 1AB2A 3TKZA 3IN7A 3PJPA 3VS4A 2SRCA 2K79B 3CBLA 2B3OA 2RSYA 1LUNA 3IN8A 3IMJA 3OP0A 1MILA 2ETZA 1O4GA 2CR4A 3VGOA 1A1EA 2AOAA 1JYQA 3S8NA 4LUEA 3MXCA 5I6VA 2IUHA 2RORA 1D4TA 2BBUA 1X6CA 1O44A 2C0TA 5KAZA 3ZNIA 1F2FA 4FL2A 1D4WA 3VS6A 3WA4A 1G83A 2MK2A 4GL9E 1R1QA 3N8MA 1KSWA 1OO3A 5D0JA 3UF4A 1YVLA 1O4FA 3QWYA 2C9WA 1O48A 3VRQA 3MAZA 1BHHA 1O4LA 1O4MA 2Y1MA 1AOUF 2DLZA 3NHNA 5IBMA 5HKYA 1BKMA 1SPRA 1FYRA 2HUWA 1A1AA 2PLDA 1FHSA 2HMHA 1BHHB 1M61A 3VRNA 2EOBA 1SPSA 1O4DA 1IS0A 3EAZA 5EHRA 4GPLB 1NZLA 1O4EA 4A4CA 1JYUA 1AYDA 3TL0A 4TZIA 3OB1B 1R1PA 2AOBA 2YSXA 3US4A 3VS2A 3BUMB 3GXWA 1B47A 1LUKA 1O4AA 1FBVA 4FL3A 1BM2A 1SHBA 4U17A 1KC2A 1M27A 2HDXA 4K44A 2DM0A 2LNWA 2OQ1A 4DGXA 4WWQA 5EHPA 2EYYA 1QG1E 2RMXA 5DC9A 2DVJA 3S8LA 1UUSA 2CI8A 1BF5A 2K7AB 5GJHA 1SHDA 3HHMB 1CWDL 2LQWA 1NRVA 1MW4A 1XA6A 4EY0A 2H5KA 2EKXA 1Z3KA 2C0OA 3K2MA 3VS1A 1CSYA 1KA7A 1O4RA 4M4ZA 1BLJA 5EG3B 2CI9A 4XZ0A 3EACA 2VIFA 5DC0B 1SKJA 1O4JA 1LCKA 4F5BA 1O42A 4D8KA 2SHPA 2EU0A 3OVEA 1O4KA 1LKLA 1HCSB 2L3TA 2GSBA 2ABLA 1UURA 5HKZA 2PNAA 2LQNA 2Y3AB 4OHEA 1AYAA 5HKWA 2CS0A 2HDVA 5AULA 1X0NA 3CD3A 4L1BB 3PLFB 2LNXA 1WQUA 2CBLA 2DX0A 2KK6A 4GWFA 4E68A 1QADA 2H8HA 1O4BA 3PSKA 3BUWB 2MC1A
chains in the Genus database with same CATH superfamily
1SHAA 3HCKA 2MQIA 1F1WA 2Y1NA 1A09A 3GQIB 1AYBA 5DC4A 3KFJA 1OPKA 1FU5A 3N7YA 4P9ZA 2YU7A 1O47A 3HIZB 3UYOA 4NWGA 1O4CA 2C0IA 4H1OA 3OV1A 1LKKA 4H34A 4JE4A 1O45A 1GHUA 2CIAA 1AYCA 1BFJA 5J3XA 2PTKA 2EL8A 2XP1A 1TCEA 1JYRA 3VS7A 1BG1A 2DCRA 1AOTF 3VS3A 1PICA 3VS5A 1ZFPE 5GJIA 3PSJA 3VRYA 1O41A 1O4IA 1OPLA 2EYVA 1FU6A 2PNBA 3CWGA 1FMKA 1HCTB 1O4OA 2IUIA 4X6SA 1GRIA 2EO6A 3C7IA 3BUXB 2HCKA 1O4QA 1OO4A 3IMDA 2FO0A 2RVFA 3CXLA 4K2RA 3S8OA 2EYZA 3VRRA 2DLYA 1O4NA 1JU5A 1A1BA 3VRPA 4F5AA 1CWEA 3T04A 2PLEA 1BKLA 3VROA 1A81A 4OHIA 3PFVA 1R1SA 1I3ZA 1CSZA 5IBSA 4OHHA 4ROJA 2LCTA 1RQQC 3N84A 4JEGA 1A1CA 2QMSA 1TZEE 1QCFA 5CDWA 4DGPA 1BMBA 5EEQA 1LUIA 4NWFA 1A07A 4A4BA 3M7FA 2OZOA 5AXIA 2IUGA 3VRZA 4U1PA 1BFIA 3VS0A 1K9AA 5BO4A 4QSYA 1BHFA 1Y1UA 2JYQA 1O4HA 4OHDA 1KA6A 4FBNA 4E93A 1Y57A 2MRKA 3MXYA 4JGHA 1NZVA 3QWXX 1H9OA 4K11A 1D1ZA 1FBZA 4F59A 4XZ1A 1A08A 5EELA 1RJAA 2GE9A 2MRJA 1P13A 2EO3A 1CJ1A 3PS5A 1LUMA 1RPYA 2AUGA 2L6KA 2LRAA 3GXXA 1IJRA 2L4KA 3BUNB 1LCJA 1O46A 2H46E 5DF6A 4P9VA 3OB2B 1X27A 3S9KA 4OHLA 4EIHA 1O4PA 1YVHA 2IZVA 2FCIA 1BLKA 1JWOA 4K45A 3PQZA 2ECDA 2CRHA 1O43A 3BUOB 3BKBA 4LUDA 1O49A 2KNOA 1AD5A 1AB2A 3TKZA 3IN7A 3PJPA 3VS4A 2SRCA 2K79B 3CBLA 2B3OA 2RSYA 1LUNA 3IN8A 3IMJA 3OP0A 1MILA 2ETZA 1O4GA 2CR4A 3VGOA 1A1EA 2AOAA 1JYQA 3S8NA 4LUEA 3MXCA 5I6VA 2IUHA 2RORA 1D4TA 2BBUA 1X6CA 1O44A 2C0TA 5KAZA 3ZNIA 1F2FA 4FL2A 1D4WA 3VS6A 3WA4A 1G83A 2MK2A 4GL9E 1R1QA 3N8MA 1KSWA 1OO3A 5D0JA 3UF4A 1YVLA 1O4FA 3QWYA 2C9WA 1O48A 3VRQA 3MAZA 1BHHA 1O4LA 1O4MA 2Y1MA 1AOUF 3K2TA 2DLZA 3NHNA 5IBMA 5HKYA 1BKMA 1SPRA 1FYRA 2HUWA 1A1AA 2PLDA 1FHSA 2HMHA 1BHHB 1M61A 3VRNA 2EOBA 1SPSA 1O4DA 1IS0A 3EAZA 5EHRA 4GPLB 1NZLA 1O4EA 4A4CA 1JYUA 1AYDA 3TL0A 4TZIA 3OB1B 1R1PA 2AOBA 2YSXA 3US4A 3VS2A 3BUMB 3GXWA 1B47A 1LUKA 1O4AA 1FBVA 4FL3A 1BM2A 1SHBA 4U17A 1KC2A 1M27A 2HDXA 4K44A 2DM0A 2LNWA 2OQ1A 4DGXA 4WWQA 5EHPA 2EYYA 1QG1E 2RMXA 5DC9A 2DVJA 3S8LA 1UUSA 2CI8A 1BF5A 2K7AB 5GJHA 1SHDA 3HHMB 1CWDL 2LQWA 1NRVA 3LYVA 1MW4A 1XA6A 4EY0A 2H5KA 2EKXA 1Z3KA 2C0OA 3K2MA 3VS1A 1CSYA 1KA7A 1O4RA 4M4ZA 1BLJA 2KGYA 5EG3B 2CI9A 4XZ0A 3EACA 2VIFA 5DC0B 1SKJA 1O4JA 1LCKA 4F5BA 1O42A 4D8KA 2SHPA 2EU0A 3OVEA 1O4KA 1LKLA 1HCSB 2L3TA 2GSBA 2ABLA 1UURA 5HKZA 2PNAA 2LQNA 2Y3AB 4OHEA 1AYAA 5HKWA 2CS0A 2HDVA 5AULA 1X0NA 3CD3A 4L1BB 3PLFB 2LNXA 1WQUA 2CBLA 2DX0A 2KK6A 4GWFA 4E68A 1QADA 2H8HA 1O4BA 3PSKA 3BUWB 2MC1A
chains in the Genus database with same CATH topology
1SHAA 3HCKA 2MQIA 1F1WA 2Y1NA 1A09A 3GQIB 1AYBA 5DC4A 3KFJA 1OPKA 1FU5A 3N7YA 4P9ZA 2YU7A 1O47A 3HIZB 3UYOA 4NWGA 1O4CA 2C0IA 4H1OA 3OV1A 1LKKA 4H34A 4JE4A 1O45A 1GHUA 2CIAA 1AYCA 1BFJA 5J3XA 2PTKA 2EL8A 2XP1A 1TCEA 1JYRA 3VS7A 1BG1A 2DCRA 1AOTF 3VS3A 1PICA 3VS5A 1ZFPE 5GJIA 3PSJA 3VRYA 1O41A 1O4IA 1OPLA 2EYVA 1FU6A 2PNBA 3CWGA 1FMKA 1HCTB 1O4OA 2IUIA 4X6SA 1GRIA 2EO6A 3C7IA 3BUXB 2HCKA 1O4QA 1OO4A 3IMDA 2FO0A 2RVFA 3CXLA 4K2RA 3S8OA 2EYZA 3VRRA 2DLYA 1O4NA 1JU5A 1A1BA 3VRPA 4F5AA 1CWEA 3T04A 2PLEA 1BKLA 3VROA 1A81A 4OHIA 3PFVA 1R1SA 1I3ZA 1CSZA 5IBSA 4OHHA 4ROJA 2LCTA 1RQQC 3N84A 4JEGA 1A1CA 2QMSA 1TZEE 1QCFA 5CDWA 4DGPA 1BMBA 5EEQA 1LUIA 4NWFA 1A07A 4A4BA 3M7FA 2OZOA 5AXIA 2IUGA 3VRZA 4U1PA 1BFIA 3VS0A 1K9AA 5BO4A 4QSYA 1BHFA 1Y1UA 2JYQA 1O4HA 4OHDA 1KA6A 4FBNA 4E93A 1Y57A 2MRKA 3MXYA 4JGHA 1NZVA 3QWXX 1H9OA 4K11A 1D1ZA 1FBZA 4F59A 4XZ1A 1A08A 5EELA 1RJAA 2GE9A 2MRJA 1P13A 2EO3A 1CJ1A 3PS5A 1LUMA 1RPYA 2AUGA 2L6KA 3GXXA 1IJRA 2L4KA 3BUNB 1LCJA 1O46A 2H46E 5DF6A 4P9VA 3OB2B 1X27A 3S9KA 4OHLA 4EIHA 1O4PA 1YVHA 2IZVA 2FCIA 1BLKA 1JWOA 4K45A 3PQZA 2ECDA 2CRHA 1O43A 3BUOB 3BKBA 4LUDA 1O49A 2KNOA 1AD5A 1AB2A 3TKZA 3IN7A 3PJPA 3VS4A 2SRCA 2K79B 3CBLA 2B3OA 2RSYA 1LUNA 3IN8A 3IMJA 3OP0A 1MILA 2ETZA 1O4GA 2CR4A 3VGOA 1A1EA 2AOAA 1JYQA 3S8NA 4LUEA 3MXCA 5I6VA 2IUHA 2RORA 1D4TA 2BBUA 1X6CA 1O44A 2C0TA 5KAZA 3ZNIA 1F2FA 4FL2A 1D4WA 3VS6A 3WA4A 1G83A 2MK2A 4GL9E 1R1QA 3N8MA 1KSWA 1OO3A 5D0JA 3UF4A 1YVLA 1O4FA 3QWYA 2C9WA 1O48A 3VRQA 3MAZA 1BHHA 1O4LA 1O4MA 2Y1MA 1AOUF 2DLZA 3NHNA 5IBMA 5HKYA 1BKMA 1SPRA 1FYRA 2HUWA 1A1AA 2PLDA 1FHSA 2HMHA 1BHHB 1M61A 3VRNA 2EOBA 1SPSA 1O4DA 1IS0A 3EAZA 5EHRA 4GPLB 1NZLA 1O4EA 4A4CA 1JYUA 1AYDA 3TL0A 4TZIA 3OB1B 1R1PA 2AOBA 2YSXA 3US4A 3VS2A 3BUMB 3GXWA 1B47A 1LUKA 1O4AA 1FBVA 4FL3A 1BM2A 1SHBA 4U17A 1KC2A 1M27A 2HDXA 4K44A 2DM0A 2LNWA 2OQ1A 4DGXA 4WWQA 5EHPA 2EYYA 1QG1E 2RMXA 5DC9A 2DVJA 3S8LA 1UUSA 2CI8A 1BF5A 2K7AB 5GJHA 1SHDA 3HHMB 1CWDL 2LQWA 1NRVA 1MW4A 1XA6A 4EY0A 2H5KA 2EKXA 1Z3KA 2C0OA 3K2MA 3VS1A 1CSYA 1KA7A 1O4RA 4M4ZA 1BLJA 5EG3B 2CI9A 4XZ0A 3EACA 2VIFA 5DC0B 1SKJA 1O4JA 1LCKA 4F5BA 1O42A 4D8KA 2SHPA 2EU0A 3OVEA 1O4KA 1LKLA 1HCSB 2L3TA 2GSBA 2ABLA 1UURA 5HKZA 2PNAA 2LQNA 2Y3AB 4OHEA 1AYAA 5HKWA 2CS0A 2HDVA 5AULA 1X0NA 3CD3A 4L1BB 3PLFB 2LNXA 1WQUA 2CBLA 2DX0A 2KK6A 4GWFA 4E68A 1QADA 2H8HA 1O4BA 3PSKA 3BUWB 2MC1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SHA A;  3HCK A;  2MQI A;  1F1W A;  2Y1N A;  1A09 A;  3GQI B;  1AYB A;  5DC4 A;  3KFJ A;  1OPK A;  1FU5 A;  3N7Y A;  4P9Z A;  2YU7 A;  1O47 A;  3HIZ B;  3UYO A;  4NWG A;  1O4C A;  2C0I A;  4H1O A;  3OV1 A;  1LKK A;  4H34 A;  4JE4 A;  1O45 A;  1GHU A;  2CIA A;  1AYC A;  1BFJ A;  5J3X A;  2PTK A;  2EL8 A;  2XP1 A;  1TCE A;  1JYR A;  3VS7 A;  1BG1 A;  2DCR A;  1AOT F;  3VS3 A;  1PIC A;  3VS5 A;  1ZFP E;  5GJI A;  3PSJ A;  3VRY A;  1O41 A;  1O4I A;  1OPL A;  2EYV A;  1FU6 A;  2PNB A;  3CWG A;  1FMK A;  1HCT B;  1O4O A;  2IUI A;  4X6S A;  1GRI A;  2EO6 A;  3C7I A;  3BUX B;  2HCK A;  1O4Q A;  1OO4 A;  3IMD A;  2FO0 A;  2RVF A;  3CXL A;  4K2R A;  3S8O A;  2EYZ A;  3VRR A;  2DLY A;  1O4N A;  1JU5 A;  1A1B A;  3VRP A;  4F5A A;  1CWE A;  3T04 A;  2PLE A;  1BKL A;  3VRO A;  1A81 A;  4OHI A;  3PFV A;  1R1S A;  1I3Z A;  1CSZ A;  5IBS A;  4OHH A;  4ROJ A;  2LCT A;  1RQQ C;  3N84 A;  4JEG A;  1A1C A;  2QMS A;  1TZE E;  1QCF A;  5CDW A;  4DGP A;  1BMB A;  5EEQ A;  1LUI A;  4NWF A;  1A07 A;  4A4B A;  3M7F A;  2OZO A;  5AXI A;  2IUG A;  3VRZ A;  4U1P A;  1BFI A;  3VS0 A;  1K9A A;  5BO4 A;  4QSY A;  1BHF A;  1Y1U A;  2JYQ A;  1O4H A;  4OHD A;  1KA6 A;  4FBN A;  4E93 A;  1Y57 A;  2MRK A;  3MXY A;  4JGH A;  1NZV A;  3QWX X;  1H9O A;  4K11 A;  1D1Z A;  1FBZ A;  4F59 A;  4XZ1 A;  1A08 A;  5EEL A;  1RJA A;  2GE9 A;  2MRJ A;  1P13 A;  2EO3 A;  1CJ1 A;  3PS5 A;  1LUM A;  1RPY A;  2AUG A;  2L6K A;  3GXX A;  1IJR A;  2L4K A;  3BUN B;  1LCJ A;  1O46 A;  2H46 E;  5DF6 A;  4P9V A;  3OB2 B;  1X27 A;  3S9K A;  4OHL A;  4EIH A;  1O4P A;  1YVH A;  2IZV A;  2FCI A;  1BLK A;  1JWO A;  4K45 A;  3PQZ A;  2ECD A;  2CRH A;  1O43 A;  3BUO B;  3BKB A;  4LUD A;  1O49 A;  2KNO A;  1AD5 A;  1AB2 A;  3TKZ A;  3IN7 A;  3PJP A;  3VS4 A;  2SRC A;  2K79 B;  3CBL A;  2B3O A;  2RSY A;  1LUN A;  3IN8 A;  3IMJ A;  3OP0 A;  1MIL A;  2ETZ A;  1O4G A;  2CR4 A;  3VGO A;  1A1E A;  2AOA A;  1JYQ A;  3S8N A;  4LUE A;  3MXC A;  5I6V A;  2IUH A;  2ROR A;  1D4T A;  2BBU A;  1X6C A;  1O44 A;  2C0T A;  5KAZ A;  3ZNI A;  1F2F A;  4FL2 A;  1D4W A;  3VS6 A;  3WA4 A;  1G83 A;  2MK2 A;  4GL9 E;  1R1Q A;  3N8M A;  1KSW A;  1OO3 A;  5D0J A;  3UF4 A;  1YVL A;  1O4F A;  3QWY A;  2C9W A;  1O48 A;  3VRQ A;  3MAZ A;  1BHH A;  1O4L A;  1O4M A;  2Y1M A;  1AOU F;  2DLZ A;  3NHN A;  5IBM A;  5HKY A;  1BKM A;  1SPR A;  1FYR A;  2HUW A;  1A1A A;  2PLD A;  1FHS A;  2HMH A;  1BHH B;  1M61 A;  3VRN A;  2EOB A;  1SPS A;  1O4D A;  1IS0 A;  3EAZ A;  5EHR A;  4GPL B;  1NZL A;  1O4E A;  4A4C A;  1JYU A;  1AYD A;  3TL0 A;  4TZI A;  3OB1 B;  1R1P A;  2AOB A;  2YSX A;  3US4 A;  3VS2 A;  3BUM B;  3GXW A;  1B47 A;  1LUK A;  1O4A A;  1FBV A;  4FL3 A;  1BM2 A;  1SHB A;  4U17 A;  1KC2 A;  1M27 A;  2HDX A;  4K44 A;  2DM0 A;  2LNW A;  2OQ1 A;  4DGX A;  4WWQ A;  5EHP A;  2EYY A;  1QG1 E;  2RMX A;  5DC9 A;  2DVJ A;  3S8L A;  1UUS A;  2CI8 A;  1BF5 A;  2K7A B;  5GJH A;  1SHD A;  3HHM B;  1CWD L;  2LQW A;  1NRV A;  1MW4 A;  1XA6 A;  4EY0 A;  2H5K A;  2EKX A;  1Z3K A;  2C0O A;  3K2M A;  3VS1 A;  1CSY A;  1KA7 A;  1O4R A;  4M4Z A;  1BLJ A;  5EG3 B;  2CI9 A;  4XZ0 A;  3EAC A;  2VIF A;  5DC0 B;  1SKJ A;  1O4J A;  1LCK A;  4F5B A;  1O42 A;  4D8K A;  2SHP A;  2EU0 A;  3OVE A;  1O4K A;  1LKL A;  1HCS B;  2L3T A;  2GSB A;  2ABL A;  1UUR A;  5HKZ A;  2PNA A;  2LQN A;  2Y3A B;  4OHE A;  1AYA A;  5HKW A;  2CS0 A;  2HDV A;  5AUL A;  1X0N A;  3CD3 A;  4L1B B;  3PLF B;  2LNX A;  1WQU A;  2CBL A;  2DX0 A;  2KK6 A;  4GWF A;  4E68 A;  1QAD A;  2H8H A;  1O4B A;  3PSK A;  3BUW B;  2MC1 A; 
#chains in the Genus database with same CATH topology
 1SHA A;  3HCK A;  2MQI A;  1F1W A;  2Y1N A;  1A09 A;  3GQI B;  1AYB A;  5DC4 A;  3KFJ A;  1OPK A;  1FU5 A;  3N7Y A;  4P9Z A;  2YU7 A;  1O47 A;  3HIZ B;  3UYO A;  4NWG A;  1O4C A;  2C0I A;  4H1O A;  3OV1 A;  1LKK A;  4H34 A;  4JE4 A;  1O45 A;  1GHU A;  2CIA A;  1AYC A;  1BFJ A;  5J3X A;  2PTK A;  2EL8 A;  2XP1 A;  1TCE A;  1JYR A;  3VS7 A;  1BG1 A;  2DCR A;  1AOT F;  3VS3 A;  1PIC A;  3VS5 A;  1ZFP E;  5GJI A;  3PSJ A;  3VRY A;  1O41 A;  1O4I A;  1OPL A;  2EYV A;  1FU6 A;  2PNB A;  3CWG A;  1FMK A;  1HCT B;  1O4O A;  2IUI A;  4X6S A;  1GRI A;  2EO6 A;  3C7I A;  3BUX B;  2HCK A;  1O4Q A;  1OO4 A;  3IMD A;  2FO0 A;  2RVF A;  3CXL A;  4K2R A;  3S8O A;  2EYZ A;  3VRR A;  2DLY A;  1O4N A;  1JU5 A;  1A1B A;  3VRP A;  4F5A A;  1CWE A;  3T04 A;  2PLE A;  1BKL A;  3VRO A;  1A81 A;  4OHI A;  3PFV A;  1R1S A;  1I3Z A;  1CSZ A;  5IBS A;  4OHH A;  4ROJ A;  2LCT A;  1RQQ C;  3N84 A;  4JEG A;  1A1C A;  2QMS A;  1TZE E;  1QCF A;  5CDW A;  4DGP A;  1BMB A;  5EEQ A;  1LUI A;  4NWF A;  1A07 A;  4A4B A;  3M7F A;  2OZO A;  5AXI A;  2IUG A;  3VRZ A;  4U1P A;  1BFI A;  3VS0 A;  1K9A A;  5BO4 A;  4QSY A;  1BHF A;  1Y1U A;  2JYQ A;  1O4H A;  4OHD A;  1KA6 A;  4FBN A;  4E93 A;  1Y57 A;  2MRK A;  3MXY A;  4JGH A;  1NZV A;  3QWX X;  1H9O A;  4K11 A;  1D1Z A;  1FBZ A;  4F59 A;  4XZ1 A;  1A08 A;  5EEL A;  1RJA A;  2GE9 A;  2MRJ A;  1P13 A;  2EO3 A;  1CJ1 A;  3PS5 A;  1LUM A;  1RPY A;  2AUG A;  2L6K A;  2LRA A;  3GXX A;  1IJR A;  2L4K A;  3BUN B;  1LCJ A;  1O46 A;  2H46 E;  5DF6 A;  4P9V A;  3OB2 B;  1X27 A;  3S9K A;  4OHL A;  4EIH A;  1O4P A;  1YVH A;  2IZV A;  2FCI A;  1BLK A;  1JWO A;  4K45 A;  3PQZ A;  2ECD A;  2CRH A;  1O43 A;  3BUO B;  3BKB A;  4LUD A;  1O49 A;  2KNO A;  1AD5 A;  1AB2 A;  3TKZ A;  3IN7 A;  3PJP A;  3VS4 A;  2SRC A;  2K79 B;  3CBL A;  2B3O A;  2RSY A;  1LUN A;  3IN8 A;  3IMJ A;  3OP0 A;  1MIL A;  2ETZ A;  1O4G A;  2CR4 A;  3VGO A;  1A1E A;  2AOA A;  1JYQ A;  3S8N A;  4LUE A;  3MXC A;  5I6V A;  2IUH A;  2ROR A;  1D4T A;  2BBU A;  1X6C A;  1O44 A;  2C0T A;  5KAZ A;  3ZNI A;  1F2F A;  4FL2 A;  1D4W A;  3VS6 A;  3WA4 A;  1G83 A;  2MK2 A;  4GL9 E;  1R1Q A;  3N8M A;  1KSW A;  1OO3 A;  5D0J A;  3UF4 A;  1YVL A;  1O4F A;  3QWY A;  2C9W A;  1O48 A;  3VRQ A;  3MAZ A;  1BHH A;  1O4L A;  1O4M A;  2Y1M A;  1AOU F;  3K2T A;  2DLZ A;  3NHN A;  5IBM A;  5HKY A;  1BKM A;  1SPR A;  1FYR A;  2HUW A;  1A1A A;  2PLD A;  1FHS A;  2HMH A;  1BHH B;  1M61 A;  3VRN A;  2EOB A;  1SPS A;  1O4D A;  1IS0 A;  3EAZ A;  5EHR A;  4GPL B;  1NZL A;  1O4E A;  4A4C A;  1JYU A;  1AYD A;  3TL0 A;  4TZI A;  3OB1 B;  1R1P A;  2AOB A;  2YSX A;  3US4 A;  3VS2 A;  3BUM B;  3GXW A;  1B47 A;  1LUK A;  1O4A A;  1FBV A;  4FL3 A;  1BM2 A;  1SHB A;  4U17 A;  1KC2 A;  1M27 A;  2HDX A;  4K44 A;  2DM0 A;  2LNW A;  2OQ1 A;  4DGX A;  4WWQ A;  5EHP A;  2EYY A;  1QG1 E;  2RMX A;  5DC9 A;  2DVJ A;  3S8L A;  1UUS A;  2CI8 A;  1BF5 A;  2K7A B;  5GJH A;  1SHD A;  3HHM B;  1CWD L;  2LQW A;  1NRV A;  3LYV A;  1MW4 A;  1XA6 A;  4EY0 A;  2H5K A;  2EKX A;  1Z3K A;  2C0O A;  3K2M A;  3VS1 A;  1CSY A;  1KA7 A;  1O4R A;  4M4Z A;  1BLJ A;  2KGY A;  5EG3 B;  2CI9 A;  4XZ0 A;  3EAC A;  2VIF A;  5DC0 B;  1SKJ A;  1O4J A;  1LCK A;  4F5B A;  1O42 A;  4D8K A;  2SHP A;  2EU0 A;  3OVE A;  1O4K A;  1LKL A;  1HCS B;  2L3T A;  2GSB A;  2ABL A;  1UUR A;  5HKZ A;  2PNA A;  2LQN A;  2Y3A B;  4OHE A;  1AYA A;  5HKW A;  2CS0 A;  2HDV A;  5AUL A;  1X0N A;  3CD3 A;  4L1B B;  3PLF B;  2LNX A;  1WQU A;  2CBL A;  2DX0 A;  2KK6 A;  4GWF A;  4E68 A;  1QAD A;  2H8H A;  1O4B A;  3PSK A;  3BUW B;  2MC1 A; 
#chains in the Genus database with same CATH homology
 1SHA A;  3HCK A;  2MQI A;  1F1W A;  2Y1N A;  1A09 A;  3GQI B;  1AYB A;  5DC4 A;  3KFJ A;  1OPK A;  1FU5 A;  3N7Y A;  4P9Z A;  2YU7 A;  1O47 A;  3HIZ B;  3UYO A;  4NWG A;  1O4C A;  2C0I A;  4H1O A;  3OV1 A;  1LKK A;  4H34 A;  4JE4 A;  1O45 A;  1GHU A;  2CIA A;  1AYC A;  1BFJ A;  5J3X A;  2PTK A;  2EL8 A;  2XP1 A;  1TCE A;  1JYR A;  3VS7 A;  1BG1 A;  2DCR A;  1AOT F;  3VS3 A;  1PIC A;  3VS5 A;  1ZFP E;  5GJI A;  3PSJ A;  3VRY A;  1O41 A;  1O4I A;  1OPL A;  2EYV A;  1FU6 A;  2PNB A;  3CWG A;  1FMK A;  1HCT B;  1O4O A;  2IUI A;  4X6S A;  1GRI A;  2EO6 A;  3C7I A;  3BUX B;  2HCK A;  1O4Q A;  1OO4 A;  3IMD A;  2FO0 A;  2RVF A;  3CXL A;  4K2R A;  3S8O A;  2EYZ A;  3VRR A;  2DLY A;  1O4N A;  1JU5 A;  1A1B A;  3VRP A;  4F5A A;  1CWE A;  3T04 A;  2PLE A;  1BKL A;  3VRO A;  1A81 A;  4OHI A;  3PFV A;  1R1S A;  1I3Z A;  1CSZ A;  5IBS A;  4OHH A;  4ROJ A;  2LCT A;  1RQQ C;  3N84 A;  4JEG A;  1A1C A;  2QMS A;  1TZE E;  1QCF A;  5CDW A;  4DGP A;  1BMB A;  5EEQ A;  1LUI A;  4NWF A;  1A07 A;  4A4B A;  3M7F A;  2OZO A;  5AXI A;  2IUG A;  3VRZ A;  4U1P A;  1BFI A;  3VS0 A;  1K9A A;  5BO4 A;  4QSY A;  1BHF A;  1Y1U A;  2JYQ A;  1O4H A;  4OHD A;  1KA6 A;  4FBN A;  4E93 A;  1Y57 A;  2MRK A;  3MXY A;  4JGH A;  1NZV A;  3QWX X;  1H9O A;  4K11 A;  1D1Z A;  1FBZ A;  4F59 A;  4XZ1 A;  1A08 A;  5EEL A;  1RJA A;  2GE9 A;  2MRJ A;  1P13 A;  2EO3 A;  1CJ1 A;  3PS5 A;  1LUM A;  1RPY A;  2AUG A;  2L6K A;  3GXX A;  1IJR A;  2L4K A;  3BUN B;  1LCJ A;  1O46 A;  2H46 E;  5DF6 A;  4P9V A;  3OB2 B;  1X27 A;  3S9K A;  4OHL A;  4EIH A;  1O4P A;  1YVH A;  2IZV A;  2FCI A;  1BLK A;  1JWO A;  4K45 A;  3PQZ A;  2ECD A;  2CRH A;  1O43 A;  3BUO B;  3BKB A;  4LUD A;  1O49 A;  2KNO A;  1AD5 A;  1AB2 A;  3TKZ A;  3IN7 A;  3PJP A;  3VS4 A;  2SRC A;  2K79 B;  3CBL A;  2B3O A;  2RSY A;  1LUN A;  3IN8 A;  3IMJ A;  3OP0 A;  1MIL A;  2ETZ A;  1O4G A;  2CR4 A;  3VGO A;  1A1E A;  2AOA A;  1JYQ A;  3S8N A;  4LUE A;  3MXC A;  5I6V A;  2IUH A;  2ROR A;  1D4T A;  2BBU A;  1X6C A;  1O44 A;  2C0T A;  5KAZ A;  3ZNI A;  1F2F A;  4FL2 A;  1D4W A;  3VS6 A;  3WA4 A;  1G83 A;  2MK2 A;  4GL9 E;  1R1Q A;  3N8M A;  1KSW A;  1OO3 A;  5D0J A;  3UF4 A;  1YVL A;  1O4F A;  3QWY A;  2C9W A;  1O48 A;  3VRQ A;  3MAZ A;  1BHH A;  1O4L A;  1O4M A;  2Y1M A;  1AOU F;  2DLZ A;  3NHN A;  5IBM A;  5HKY A;  1BKM A;  1SPR A;  1FYR A;  2HUW A;  1A1A A;  2PLD A;  1FHS A;  2HMH A;  1BHH B;  1M61 A;  3VRN A;  2EOB A;  1SPS A;  1O4D A;  1IS0 A;  3EAZ A;  5EHR A;  4GPL B;  1NZL A;  1O4E A;  4A4C A;  1JYU A;  1AYD A;  3TL0 A;  4TZI A;  3OB1 B;  1R1P A;  2AOB A;  2YSX A;  3US4 A;  3VS2 A;  3BUM B;  3GXW A;  1B47 A;  1LUK A;  1O4A A;  1FBV A;  4FL3 A;  1BM2 A;  1SHB A;  4U17 A;  1KC2 A;  1M27 A;  2HDX A;  4K44 A;  2DM0 A;  2LNW A;  2OQ1 A;  4DGX A;  4WWQ A;  5EHP A;  2EYY A;  1QG1 E;  2RMX A;  5DC9 A;  2DVJ A;  3S8L A;  1UUS A;  2CI8 A;  1BF5 A;  2K7A B;  5GJH A;  1SHD A;  3HHM B;  1CWD L;  2LQW A;  1NRV A;  1MW4 A;  1XA6 A;  4EY0 A;  2H5K A;  2EKX A;  1Z3K A;  2C0O A;  3K2M A;  3VS1 A;  1CSY A;  1KA7 A;  1O4R A;  4M4Z A;  1BLJ A;  5EG3 B;  2CI9 A;  4XZ0 A;  3EAC A;  2VIF A;  5DC0 B;  1SKJ A;  1O4J A;  1LCK A;  4F5B A;  1O42 A;  4D8K A;  2SHP A;  2EU0 A;  3OVE A;  1O4K A;  1LKL A;  1HCS B;  2L3T A;  2GSB A;  2ABL A;  1UUR A;  5HKZ A;  2PNA A;  2LQN A;  2Y3A B;  4OHE A;  1AYA A;  5HKW A;  2CS0 A;  2HDV A;  5AUL A;  1X0N A;  3CD3 A;  4L1B B;  3PLF B;  2LNX A;  1WQU A;  2CBL A;  2DX0 A;  2KK6 A;  4GWF A;  4E68 A;  1QAD A;  2H8H A;  1O4B A;  3PSK A;  3BUW B;  2MC1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...