3US4A

Crystal structure of a sh2 domain of a megakaryocyte-associated tyrosine kinase (matk) from homo sapiens at 1.50 a resolution
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
97
structure length
97
Chain Sequence
LSLMPWFHGKISGQEAVQQLQPPEDGLFLVRESARHPGDYVLCVSFGRDVIHYRVLHRDGHLTIDEAVFFCNLMDMVEHYSKDKGAICTKLVRPKRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Megakaryocyte-associated tyrosine-protein kinase
publication title Crystal structure of a SH2 domain of a megakaryocyte-associated tyrosine kinase (MATK) from Homo sapiens at 1.50 A resolution
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 21
structure length 97
sequence length 97
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2011-11-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00017 SH2 SH2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.505.10 Alpha Beta 2-Layer Sandwich SHC Adaptor Protein SH2 domain 3us4A00
1QCFA 2MQIA 1A09A 1H9OA 1TCEA 4LUEA 3VRQA 4TZIA 1JU5A 3GXWA 1X0NA 2K7AB 1O49A 2XP1A 2VIFA 5DF6A 1O4QA 1AYBA 3VROA 4FL2A 1FHSA 4A4BA 1BMBA 1Y57A 1CJ1A 2AOAA 5I6VA 2HCKA 2H5KA 1AYDA 2Y1NA 1A07A 3VRYA 3KFJA 2RMXA 2MC1A 2PNBA 3WA4A 1SHAA 1OPKA 2LQNA 2AOBA 2HUWA 3TKZA 1O4AA 5EELA 1O4CA 5IBSA 2AUGA 2ECDA 4DGXA 1G83A 5DC9A 2C0OA 1BHFA 1WQUA 1OO4A 2DM0A 1QADA 3TL0A 1CSZA 1HCTB 2L4KA 2LQWA 2PLEA 4H1OA 4GPLB 5D0JA 4E68A 5EEQA 2CR4A 1O42A 1O44A 2LNXA 1O4MA 3CXLA 1BKMA 3CWGA 1CWDL 1LKLA 1LUMA 1R1PA 3GXXA 3VS4A 1SPRA 2K79B 1BFJA 1I3ZA 2PLDA 1O4FA 1BHHB 2C0IA 2JYQA 4NWFA 1O4EA 3HHMB 4F59A 4XZ1A 2Y3AB 1LKKA 5EG3B 1D1ZA 1O4NA 3IMDA 3BUNB 1MILA 1KSWA 3VS1A 2EL8A 1JYUA 2C9WA 3VS6A 1BFIA 2RORA 3OVEA 4NWGA 1FYRA 1GHUA 2EU0A 2DLYA 2EKXA 1HCSB 3PS5A 2YU7A 5IBMA 4K44A 1P13A 1O4BA 4OHDA 3MAZA 2MRKA 4K2RA 1SPSA 4XZ0A 1CWEA 2FO0A 2ETZA 1SKJA 4A4CA 2DVJA 2EYYA 2H8HA 3S8OA 1O4OA 3S9KA 1AOTF 1O41A 2EYVA 3BUOB 3OP0A 3T04A 1PICA 1TZEE 1BLJA 1X6CA 4DGPA 1M27A 2Y1MA 2CIAA 3PSJA 3N8MA 1K9AA 5GJHA 2IUGA 2MK2A 3BUWB 3CBLA 3EAZA 4EIHA 3GQIB 1AB2A 3VGOA 1FBZA 1R1SA 1A1EA 3PFVA 1NZVA 3IN8A 1OO3A 4U17A 1KA6A 1X27A 1AD5A 1JWOA 3UYOA 1O4IA 2HDVA 4OHEA 1KC2A 3QWXX 1MW4A 2KK6A 4LUDA 2YSXA 2DLZA 2PNAA 2H46E 1LUKA 2PTKA 4ROJA 4L1BB 2BBUA 3BUMB 3CD3A 1A1AA 4P9ZA 4WWQA 1O4RA 3OB1B 1BG1A 3VS2A 1QG1E 3BUXB 2GSBA 2ABLA 3PSKA 1FU6A 1RJAA 4K45A 1A08A 2QMSA 3K2MA 1O4JA 2SHPA 1NZLA 5EHRA 1KA7A 1F1WA 3QWYA 1AYAA 3VS3A 1YVHA 1BKLA 1F2FA 2EOBA 4OHHA 5AULA 1BF5A 2EO3A 1SHDA 1BHHA 2L6KA 5DC4A 3S8NA 3EACA 5EHPA 5GJIA 1D4TA 2CRHA 5KAZA 1M61A 1ZFPE 5BO4A 1IS0A 2L3TA 1Y1UA 3VS7A 1FBVA 5DC0B 1LCJA 3BKBA 1LCKA 1R1QA 5HKWA 3US4A 2CI8A 3VRZA 1FMKA 1LUIA 2IUIA 5HKYA 1O47A 1O48A 1O4GA 1RPYA 2DX0A 4QSYA 2EYZA 4K11A 3HCKA 4D8KA 2GE9A 3PJPA 4F5BA 4JE4A 3OB2B 1D4WA 1Z3KA 1LUNA 2HDXA 4X6SA 2RSYA 1JYRA 4FL3A 4P9VA 1A81A 1BLKA 4EY0A 3M7FA 1O4HA 2CS0A 3UF4A 1O45A 1A1BA 1O4PA 4U1PA 1FU5A 1O4KA 2SRCA 4JGHA 3VRPA 4M4ZA 2IUHA 1OPLA 1BM2A 2HMHA 3S8LA 1GRIA 4E93A 5J3XA 3PQZA 4H34A 3VS0A 1UURA 5HKZA 5CDWA 4FBNA 3IMJA 2LCTA 4JEGA 2CBLA 3C7IA 1AYCA 1O43A 3OV1A 4GWFA 2MRJA 3MXYA 2KNOA 3IN7A 3NHNA 1B47A 2OZOA 3N84A 3PLFB 3MXCA 1CSYA 3VS5A 1O46A 2EO6A 1SHBA 1AOUF 5AXIA 1UUSA 3VRNA 4GL9E 2LNWA 1A1CA 2RVFA 1YVLA 2OQ1A 1RQQC 3ZNIA 2IZVA 1XA6A 2FCIA 2CI9A 4OHIA 3VRRA 4OHLA 1O4DA 1NRVA 1JYQA 4F5AA 2DCRA 3HIZB 2B3OA 2C0TA 1IJRA 3N7YA 1O4LA
chains in the Genus database with same CATH superfamily
1QCFA 2MQIA 1A09A 1H9OA 1TCEA 4LUEA 3VRQA 4TZIA 1JU5A 3GXWA 1X0NA 2K7AB 1O49A 2XP1A 2VIFA 5DF6A 1O4QA 1AYBA 3VROA 4FL2A 1FHSA 4A4BA 1BMBA 1Y57A 1CJ1A 2AOAA 5I6VA 2HCKA 2H5KA 1AYDA 2Y1NA 1A07A 3VRYA 3KFJA 2RMXA 2MC1A 2PNBA 3WA4A 1SHAA 1OPKA 2LQNA 2AOBA 2HUWA 3TKZA 1O4AA 5EELA 1O4CA 5IBSA 2AUGA 2ECDA 4DGXA 1G83A 5DC9A 2C0OA 1BHFA 1WQUA 1OO4A 2DM0A 1QADA 3TL0A 1CSZA 1HCTB 2L4KA 2LQWA 2PLEA 4H1OA 4GPLB 5D0JA 4E68A 5EEQA 2CR4A 1O42A 1O44A 2LNXA 1O4MA 3CXLA 1BKMA 3CWGA 1CWDL 1LKLA 1LUMA 1R1PA 3GXXA 3VS4A 1SPRA 2K79B 1BFJA 1I3ZA 2PLDA 1O4FA 1BHHB 2C0IA 2JYQA 4NWFA 1O4EA 3HHMB 4F59A 4XZ1A 2Y3AB 1LKKA 5EG3B 1D1ZA 1O4NA 3IMDA 3BUNB 1MILA 1KSWA 3VS1A 2EL8A 1JYUA 2C9WA 3VS6A 1BFIA 2RORA 3OVEA 4NWGA 1FYRA 1GHUA 2EU0A 2DLYA 2EKXA 1HCSB 3PS5A 2YU7A 5IBMA 4K44A 1P13A 1O4BA 4OHDA 3MAZA 2MRKA 4K2RA 1SPSA 4XZ0A 1CWEA 2FO0A 2ETZA 1SKJA 4A4CA 2DVJA 2EYYA 2H8HA 3S8OA 1O4OA 3S9KA 1AOTF 1O41A 2EYVA 3BUOB 3OP0A 3T04A 1PICA 1TZEE 1BLJA 1X6CA 4DGPA 1M27A 2Y1MA 2CIAA 3PSJA 3N8MA 1K9AA 5GJHA 2IUGA 2MK2A 3BUWB 3CBLA 3EAZA 4EIHA 3GQIB 1AB2A 3VGOA 1FBZA 1R1SA 1A1EA 3PFVA 1NZVA 3IN8A 1OO3A 4U17A 1KA6A 1X27A 1AD5A 1JWOA 3UYOA 1O4IA 2HDVA 4OHEA 1KC2A 3QWXX 1MW4A 2KK6A 4LUDA 2YSXA 2DLZA 2PNAA 2H46E 1LUKA 2PTKA 4ROJA 4L1BB 2BBUA 3BUMB 3CD3A 1A1AA 4P9ZA 4WWQA 1O4RA 3OB1B 1BG1A 3VS2A 1QG1E 3BUXB 2GSBA 2ABLA 3PSKA 1FU6A 1RJAA 2KGYA 4K45A 1A08A 2QMSA 3K2MA 1O4JA 2SHPA 1NZLA 5EHRA 1KA7A 1F1WA 3QWYA 1AYAA 3VS3A 1YVHA 1BKLA 1F2FA 2EOBA 4OHHA 5AULA 1BF5A 2EO3A 1SHDA 1BHHA 2L6KA 5DC4A 3S8NA 3EACA 5EHPA 5GJIA 2LRAA 1D4TA 2CRHA 5KAZA 1M61A 1ZFPE 5BO4A 1IS0A 2L3TA 1Y1UA 3VS7A 1FBVA 5DC0B 1LCJA 3BKBA 1LCKA 1R1QA 5HKWA 3US4A 2CI8A 3VRZA 1FMKA 1LUIA 2IUIA 5HKYA 1O47A 1O48A 1O4GA 1RPYA 2DX0A 4QSYA 2EYZA 4K11A 3HCKA 4D8KA 2GE9A 3PJPA 4F5BA 4JE4A 3OB2B 1D4WA 1Z3KA 1LUNA 2HDXA 4X6SA 2RSYA 1JYRA 4FL3A 4P9VA 1A81A 1BLKA 4EY0A 3M7FA 1O4HA 2CS0A 3UF4A 1O45A 1A1BA 1O4PA 4U1PA 1FU5A 1O4KA 2SRCA 4JGHA 3VRPA 4M4ZA 2IUHA 1OPLA 1BM2A 2HMHA 3S8LA 1GRIA 4E93A 5J3XA 3PQZA 4H34A 3VS0A 1UURA 5HKZA 5CDWA 4FBNA 3IMJA 2LCTA 4JEGA 2CBLA 3C7IA 1AYCA 1O43A 3K2TA 3OV1A 4GWFA 2MRJA 3MXYA 2KNOA 3IN7A 3NHNA 1B47A 2OZOA 3N84A 3PLFB 3MXCA 1CSYA 3VS5A 1O46A 2EO6A 1SHBA 1AOUF 5AXIA 1UUSA 3VRNA 3LYVA 4GL9E 2LNWA 1A1CA 2RVFA 1YVLA 2OQ1A 1RQQC 3ZNIA 2IZVA 1XA6A 2FCIA 2CI9A 4OHIA 3VRRA 4OHLA 1O4DA 1NRVA 1JYQA 4F5AA 2DCRA 3HIZB 2B3OA 2C0TA 1IJRA 3N7YA 1O4LA
chains in the Genus database with same CATH topology
1QCFA 2MQIA 1A09A 1H9OA 1TCEA 4LUEA 3VRQA 4TZIA 1JU5A 3GXWA 1X0NA 2K7AB 1O49A 2XP1A 2VIFA 5DF6A 1O4QA 1AYBA 3VROA 4FL2A 1FHSA 4A4BA 1BMBA 1Y57A 1CJ1A 2AOAA 5I6VA 2HCKA 2H5KA 1AYDA 2Y1NA 1A07A 3VRYA 3KFJA 2RMXA 2MC1A 2PNBA 3WA4A 1SHAA 1OPKA 2LQNA 2AOBA 2HUWA 3TKZA 1O4AA 5EELA 1O4CA 5IBSA 2AUGA 2ECDA 4DGXA 1G83A 5DC9A 2C0OA 1BHFA 1WQUA 1OO4A 2DM0A 1QADA 3TL0A 1CSZA 1HCTB 2L4KA 2LQWA 2PLEA 4H1OA 4GPLB 5D0JA 4E68A 5EEQA 2CR4A 1O42A 1O44A 2LNXA 1O4MA 3CXLA 1BKMA 3CWGA 1CWDL 1LKLA 1LUMA 1R1PA 3GXXA 3VS4A 1SPRA 2K79B 1BFJA 1I3ZA 2PLDA 1O4FA 1BHHB 2C0IA 2JYQA 4NWFA 1O4EA 3HHMB 4F59A 4XZ1A 2Y3AB 1LKKA 5EG3B 1D1ZA 1O4NA 3IMDA 3BUNB 1MILA 1KSWA 3VS1A 2EL8A 1JYUA 2C9WA 3VS6A 1BFIA 2RORA 3OVEA 4NWGA 1FYRA 1GHUA 2EU0A 2DLYA 2EKXA 1HCSB 3PS5A 2YU7A 5IBMA 4K44A 1P13A 1O4BA 4OHDA 3MAZA 2MRKA 4K2RA 1SPSA 4XZ0A 1CWEA 2FO0A 2ETZA 1SKJA 4A4CA 2DVJA 2EYYA 2H8HA 3S8OA 1O4OA 3S9KA 1AOTF 1O41A 2EYVA 3BUOB 3OP0A 3T04A 1PICA 1TZEE 1BLJA 1X6CA 4DGPA 1M27A 2Y1MA 2CIAA 3PSJA 3N8MA 1K9AA 5GJHA 2IUGA 2MK2A 3BUWB 3CBLA 3EAZA 4EIHA 3GQIB 1AB2A 3VGOA 1FBZA 1R1SA 1A1EA 3PFVA 1NZVA 3IN8A 1OO3A 4U17A 1KA6A 1X27A 1AD5A 1JWOA 3UYOA 1O4IA 2HDVA 4OHEA 1KC2A 3QWXX 1MW4A 2KK6A 4LUDA 2YSXA 2DLZA 2PNAA 2H46E 1LUKA 2PTKA 4ROJA 4L1BB 2BBUA 3BUMB 3CD3A 1A1AA 4P9ZA 4WWQA 1O4RA 3OB1B 1BG1A 3VS2A 1QG1E 3BUXB 2GSBA 2ABLA 3PSKA 1FU6A 1RJAA 4K45A 1A08A 2QMSA 3K2MA 1O4JA 2SHPA 1NZLA 5EHRA 1KA7A 1F1WA 3QWYA 1AYAA 3VS3A 1YVHA 1BKLA 1F2FA 2EOBA 4OHHA 5AULA 1BF5A 2EO3A 1SHDA 1BHHA 2L6KA 5DC4A 3S8NA 3EACA 5EHPA 5GJIA 1D4TA 2CRHA 5KAZA 1M61A 1ZFPE 5BO4A 1IS0A 2L3TA 1Y1UA 3VS7A 1FBVA 5DC0B 1LCJA 3BKBA 1LCKA 1R1QA 5HKWA 3US4A 2CI8A 3VRZA 1FMKA 1LUIA 2IUIA 5HKYA 1O47A 1O48A 1O4GA 1RPYA 2DX0A 4QSYA 2EYZA 4K11A 3HCKA 4D8KA 2GE9A 3PJPA 4F5BA 4JE4A 3OB2B 1D4WA 1Z3KA 1LUNA 2HDXA 4X6SA 2RSYA 1JYRA 4FL3A 4P9VA 1A81A 1BLKA 4EY0A 3M7FA 1O4HA 2CS0A 3UF4A 1O45A 1A1BA 1O4PA 4U1PA 1FU5A 1O4KA 2SRCA 4JGHA 3VRPA 4M4ZA 2IUHA 1OPLA 1BM2A 2HMHA 3S8LA 1GRIA 4E93A 5J3XA 3PQZA 4H34A 3VS0A 1UURA 5HKZA 5CDWA 4FBNA 3IMJA 2LCTA 4JEGA 2CBLA 3C7IA 1AYCA 1O43A 3OV1A 4GWFA 2MRJA 3MXYA 2KNOA 3IN7A 3NHNA 1B47A 2OZOA 3N84A 3PLFB 3MXCA 1CSYA 3VS5A 1O46A 2EO6A 1SHBA 1AOUF 5AXIA 1UUSA 3VRNA 4GL9E 2LNWA 1A1CA 2RVFA 1YVLA 2OQ1A 1RQQC 3ZNIA 2IZVA 1XA6A 2FCIA 2CI9A 4OHIA 3VRRA 4OHLA 1O4DA 1NRVA 1JYQA 4F5AA 2DCRA 3HIZB 2B3OA 2C0TA 1IJRA 3N7YA 1O4LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QCF A;  2MQI A;  1A09 A;  1H9O A;  1TCE A;  4LUE A;  3VRQ A;  4TZI A;  1JU5 A;  3GXW A;  1X0N A;  2K7A B;  1O49 A;  2XP1 A;  2VIF A;  5DF6 A;  1O4Q A;  1AYB A;  3VRO A;  4FL2 A;  1FHS A;  4A4B A;  1BMB A;  1Y57 A;  1CJ1 A;  2AOA A;  5I6V A;  2HCK A;  2H5K A;  1AYD A;  2Y1N A;  1A07 A;  3VRY A;  3KFJ A;  2RMX A;  2MC1 A;  2PNB A;  3WA4 A;  1SHA A;  1OPK A;  2LQN A;  2AOB A;  2HUW A;  3TKZ A;  1O4A A;  5EEL A;  1O4C A;  5IBS A;  2AUG A;  2ECD A;  4DGX A;  1G83 A;  5DC9 A;  2C0O A;  1BHF A;  1WQU A;  1OO4 A;  2DM0 A;  1QAD A;  3TL0 A;  1CSZ A;  1HCT B;  2L4K A;  2LQW A;  2PLE A;  4H1O A;  4GPL B;  5D0J A;  4E68 A;  5EEQ A;  2CR4 A;  1O42 A;  1O44 A;  2LNX A;  1O4M A;  3CXL A;  1BKM A;  3CWG A;  1CWD L;  1LKL A;  1LUM A;  1R1P A;  3GXX A;  3VS4 A;  1SPR A;  2K79 B;  1BFJ A;  1I3Z A;  2PLD A;  1O4F A;  1BHH B;  2C0I A;  2JYQ A;  4NWF A;  1O4E A;  3HHM B;  4F59 A;  4XZ1 A;  2Y3A B;  1LKK A;  5EG3 B;  1D1Z A;  1O4N A;  3IMD A;  3BUN B;  1MIL A;  1KSW A;  3VS1 A;  2EL8 A;  1JYU A;  2C9W A;  3VS6 A;  1BFI A;  2ROR A;  3OVE A;  4NWG A;  1FYR A;  1GHU A;  2EU0 A;  2DLY A;  2EKX A;  1HCS B;  3PS5 A;  2YU7 A;  5IBM A;  4K44 A;  1P13 A;  1O4B A;  4OHD A;  3MAZ A;  2MRK A;  4K2R A;  1SPS A;  4XZ0 A;  1CWE A;  2FO0 A;  2ETZ A;  1SKJ A;  4A4C A;  2DVJ A;  2EYY A;  2H8H A;  3S8O A;  1O4O A;  3S9K A;  1AOT F;  1O41 A;  2EYV A;  3BUO B;  3OP0 A;  3T04 A;  1PIC A;  1TZE E;  1BLJ A;  1X6C A;  4DGP A;  1M27 A;  2Y1M A;  2CIA A;  3PSJ A;  3N8M A;  1K9A A;  5GJH A;  2IUG A;  2MK2 A;  3BUW B;  3CBL A;  3EAZ A;  4EIH A;  3GQI B;  1AB2 A;  3VGO A;  1FBZ A;  1R1S A;  1A1E A;  3PFV A;  1NZV A;  3IN8 A;  1OO3 A;  4U17 A;  1KA6 A;  1X27 A;  1AD5 A;  1JWO A;  3UYO A;  1O4I A;  2HDV A;  4OHE A;  1KC2 A;  3QWX X;  1MW4 A;  2KK6 A;  4LUD A;  2YSX A;  2DLZ A;  2PNA A;  2H46 E;  1LUK A;  2PTK A;  4ROJ A;  4L1B B;  2BBU A;  3BUM B;  3CD3 A;  1A1A A;  4P9Z A;  4WWQ A;  1O4R A;  3OB1 B;  1BG1 A;  3VS2 A;  1QG1 E;  3BUX B;  2GSB A;  2ABL A;  3PSK A;  1FU6 A;  1RJA A;  4K45 A;  1A08 A;  2QMS A;  3K2M A;  1O4J A;  2SHP A;  1NZL A;  5EHR A;  1KA7 A;  1F1W A;  3QWY A;  1AYA A;  3VS3 A;  1YVH A;  1BKL A;  1F2F A;  2EOB A;  4OHH A;  5AUL A;  1BF5 A;  2EO3 A;  1SHD A;  1BHH A;  2L6K A;  5DC4 A;  3S8N A;  3EAC A;  5EHP A;  5GJI A;  1D4T A;  2CRH A;  5KAZ A;  1M61 A;  1ZFP E;  5BO4 A;  1IS0 A;  2L3T A;  1Y1U A;  3VS7 A;  1FBV A;  5DC0 B;  1LCJ A;  3BKB A;  1LCK A;  1R1Q A;  5HKW A;  3US4 A;  2CI8 A;  3VRZ A;  1FMK A;  1LUI A;  2IUI A;  5HKY A;  1O47 A;  1O48 A;  1O4G A;  1RPY A;  2DX0 A;  4QSY A;  2EYZ A;  4K11 A;  3HCK A;  4D8K A;  2GE9 A;  3PJP A;  4F5B A;  4JE4 A;  3OB2 B;  1D4W A;  1Z3K A;  1LUN A;  2HDX A;  4X6S A;  2RSY A;  1JYR A;  4FL3 A;  4P9V A;  1A81 A;  1BLK A;  4EY0 A;  3M7F A;  1O4H A;  2CS0 A;  3UF4 A;  1O45 A;  1A1B A;  1O4P A;  4U1P A;  1FU5 A;  1O4K A;  2SRC A;  4JGH A;  3VRP A;  4M4Z A;  2IUH A;  1OPL A;  1BM2 A;  2HMH A;  3S8L A;  1GRI A;  4E93 A;  5J3X A;  3PQZ A;  4H34 A;  3VS0 A;  1UUR A;  5HKZ A;  5CDW A;  4FBN A;  3IMJ A;  2LCT A;  4JEG A;  2CBL A;  3C7I A;  1AYC A;  1O43 A;  3OV1 A;  4GWF A;  2MRJ A;  3MXY A;  2KNO A;  3IN7 A;  3NHN A;  1B47 A;  2OZO A;  3N84 A;  3PLF B;  3MXC A;  1CSY A;  3VS5 A;  1O46 A;  2EO6 A;  1SHB A;  1AOU F;  5AXI A;  1UUS A;  3VRN A;  4GL9 E;  2LNW A;  1A1C A;  2RVF A;  1YVL A;  2OQ1 A;  1RQQ C;  3ZNI A;  2IZV A;  1XA6 A;  2FCI A;  2CI9 A;  4OHI A;  3VRR A;  4OHL A;  1O4D A;  1NRV A;  1JYQ A;  4F5A A;  2DCR A;  3HIZ B;  2B3O A;  2C0T A;  1IJR A;  3N7Y A;  1O4L A; 
#chains in the Genus database with same CATH topology
 1QCF A;  2MQI A;  1A09 A;  1H9O A;  1TCE A;  4LUE A;  3VRQ A;  4TZI A;  1JU5 A;  3GXW A;  1X0N A;  2K7A B;  1O49 A;  2XP1 A;  2VIF A;  5DF6 A;  1O4Q A;  1AYB A;  3VRO A;  4FL2 A;  1FHS A;  4A4B A;  1BMB A;  1Y57 A;  1CJ1 A;  2AOA A;  5I6V A;  2HCK A;  2H5K A;  1AYD A;  2Y1N A;  1A07 A;  3VRY A;  3KFJ A;  2RMX A;  2MC1 A;  2PNB A;  3WA4 A;  1SHA A;  1OPK A;  2LQN A;  2AOB A;  2HUW A;  3TKZ A;  1O4A A;  5EEL A;  1O4C A;  5IBS A;  2AUG A;  2ECD A;  4DGX A;  1G83 A;  5DC9 A;  2C0O A;  1BHF A;  1WQU A;  1OO4 A;  2DM0 A;  1QAD A;  3TL0 A;  1CSZ A;  1HCT B;  2L4K A;  2LQW A;  2PLE A;  4H1O A;  4GPL B;  5D0J A;  4E68 A;  5EEQ A;  2CR4 A;  1O42 A;  1O44 A;  2LNX A;  1O4M A;  3CXL A;  1BKM A;  3CWG A;  1CWD L;  1LKL A;  1LUM A;  1R1P A;  3GXX A;  3VS4 A;  1SPR A;  2K79 B;  1BFJ A;  1I3Z A;  2PLD A;  1O4F A;  1BHH B;  2C0I A;  2JYQ A;  4NWF A;  1O4E A;  3HHM B;  4F59 A;  4XZ1 A;  2Y3A B;  1LKK A;  5EG3 B;  1D1Z A;  1O4N A;  3IMD A;  3BUN B;  1MIL A;  1KSW A;  3VS1 A;  2EL8 A;  1JYU A;  2C9W A;  3VS6 A;  1BFI A;  2ROR A;  3OVE A;  4NWG A;  1FYR A;  1GHU A;  2EU0 A;  2DLY A;  2EKX A;  1HCS B;  3PS5 A;  2YU7 A;  5IBM A;  4K44 A;  1P13 A;  1O4B A;  4OHD A;  3MAZ A;  2MRK A;  4K2R A;  1SPS A;  4XZ0 A;  1CWE A;  2FO0 A;  2ETZ A;  1SKJ A;  4A4C A;  2DVJ A;  2EYY A;  2H8H A;  3S8O A;  1O4O A;  3S9K A;  1AOT F;  1O41 A;  2EYV A;  3BUO B;  3OP0 A;  3T04 A;  1PIC A;  1TZE E;  1BLJ A;  1X6C A;  4DGP A;  1M27 A;  2Y1M A;  2CIA A;  3PSJ A;  3N8M A;  1K9A A;  5GJH A;  2IUG A;  2MK2 A;  3BUW B;  3CBL A;  3EAZ A;  4EIH A;  3GQI B;  1AB2 A;  3VGO A;  1FBZ A;  1R1S A;  1A1E A;  3PFV A;  1NZV A;  3IN8 A;  1OO3 A;  4U17 A;  1KA6 A;  1X27 A;  1AD5 A;  1JWO A;  3UYO A;  1O4I A;  2HDV A;  4OHE A;  1KC2 A;  3QWX X;  1MW4 A;  2KK6 A;  4LUD A;  2YSX A;  2DLZ A;  2PNA A;  2H46 E;  1LUK A;  2PTK A;  4ROJ A;  4L1B B;  2BBU A;  3BUM B;  3CD3 A;  1A1A A;  4P9Z A;  4WWQ A;  1O4R A;  3OB1 B;  1BG1 A;  3VS2 A;  1QG1 E;  3BUX B;  2GSB A;  2ABL A;  3PSK A;  1FU6 A;  1RJA A;  2KGY A;  4K45 A;  1A08 A;  2QMS A;  3K2M A;  1O4J A;  2SHP A;  1NZL A;  5EHR A;  1KA7 A;  1F1W A;  3QWY A;  1AYA A;  3VS3 A;  1YVH A;  1BKL A;  1F2F A;  2EOB A;  4OHH A;  5AUL A;  1BF5 A;  2EO3 A;  1SHD A;  1BHH A;  2L6K A;  5DC4 A;  3S8N A;  3EAC A;  5EHP A;  5GJI A;  2LRA A;  1D4T A;  2CRH A;  5KAZ A;  1M61 A;  1ZFP E;  5BO4 A;  1IS0 A;  2L3T A;  1Y1U A;  3VS7 A;  1FBV A;  5DC0 B;  1LCJ A;  3BKB A;  1LCK A;  1R1Q A;  5HKW A;  3US4 A;  2CI8 A;  3VRZ A;  1FMK A;  1LUI A;  2IUI A;  5HKY A;  1O47 A;  1O48 A;  1O4G A;  1RPY A;  2DX0 A;  4QSY A;  2EYZ A;  4K11 A;  3HCK A;  4D8K A;  2GE9 A;  3PJP A;  4F5B A;  4JE4 A;  3OB2 B;  1D4W A;  1Z3K A;  1LUN A;  2HDX A;  4X6S A;  2RSY A;  1JYR A;  4FL3 A;  4P9V A;  1A81 A;  1BLK A;  4EY0 A;  3M7F A;  1O4H A;  2CS0 A;  3UF4 A;  1O45 A;  1A1B A;  1O4P A;  4U1P A;  1FU5 A;  1O4K A;  2SRC A;  4JGH A;  3VRP A;  4M4Z A;  2IUH A;  1OPL A;  1BM2 A;  2HMH A;  3S8L A;  1GRI A;  4E93 A;  5J3X A;  3PQZ A;  4H34 A;  3VS0 A;  1UUR A;  5HKZ A;  5CDW A;  4FBN A;  3IMJ A;  2LCT A;  4JEG A;  2CBL A;  3C7I A;  1AYC A;  1O43 A;  3K2T A;  3OV1 A;  4GWF A;  2MRJ A;  3MXY A;  2KNO A;  3IN7 A;  3NHN A;  1B47 A;  2OZO A;  3N84 A;  3PLF B;  3MXC A;  1CSY A;  3VS5 A;  1O46 A;  2EO6 A;  1SHB A;  1AOU F;  5AXI A;  1UUS A;  3VRN A;  3LYV A;  4GL9 E;  2LNW A;  1A1C A;  2RVF A;  1YVL A;  2OQ1 A;  1RQQ C;  3ZNI A;  2IZV A;  1XA6 A;  2FCI A;  2CI9 A;  4OHI A;  3VRR A;  4OHL A;  1O4D A;  1NRV A;  1JYQ A;  4F5A A;  2DCR A;  3HIZ B;  2B3O A;  2C0T A;  1IJR A;  3N7Y A;  1O4L A; 
#chains in the Genus database with same CATH homology
 1QCF A;  2MQI A;  1A09 A;  1H9O A;  1TCE A;  4LUE A;  3VRQ A;  4TZI A;  1JU5 A;  3GXW A;  1X0N A;  2K7A B;  1O49 A;  2XP1 A;  2VIF A;  5DF6 A;  1O4Q A;  1AYB A;  3VRO A;  4FL2 A;  1FHS A;  4A4B A;  1BMB A;  1Y57 A;  1CJ1 A;  2AOA A;  5I6V A;  2HCK A;  2H5K A;  1AYD A;  2Y1N A;  1A07 A;  3VRY A;  3KFJ A;  2RMX A;  2MC1 A;  2PNB A;  3WA4 A;  1SHA A;  1OPK A;  2LQN A;  2AOB A;  2HUW A;  3TKZ A;  1O4A A;  5EEL A;  1O4C A;  5IBS A;  2AUG A;  2ECD A;  4DGX A;  1G83 A;  5DC9 A;  2C0O A;  1BHF A;  1WQU A;  1OO4 A;  2DM0 A;  1QAD A;  3TL0 A;  1CSZ A;  1HCT B;  2L4K A;  2LQW A;  2PLE A;  4H1O A;  4GPL B;  5D0J A;  4E68 A;  5EEQ A;  2CR4 A;  1O42 A;  1O44 A;  2LNX A;  1O4M A;  3CXL A;  1BKM A;  3CWG A;  1CWD L;  1LKL A;  1LUM A;  1R1P A;  3GXX A;  3VS4 A;  1SPR A;  2K79 B;  1BFJ A;  1I3Z A;  2PLD A;  1O4F A;  1BHH B;  2C0I A;  2JYQ A;  4NWF A;  1O4E A;  3HHM B;  4F59 A;  4XZ1 A;  2Y3A B;  1LKK A;  5EG3 B;  1D1Z A;  1O4N A;  3IMD A;  3BUN B;  1MIL A;  1KSW A;  3VS1 A;  2EL8 A;  1JYU A;  2C9W A;  3VS6 A;  1BFI A;  2ROR A;  3OVE A;  4NWG A;  1FYR A;  1GHU A;  2EU0 A;  2DLY A;  2EKX A;  1HCS B;  3PS5 A;  2YU7 A;  5IBM A;  4K44 A;  1P13 A;  1O4B A;  4OHD A;  3MAZ A;  2MRK A;  4K2R A;  1SPS A;  4XZ0 A;  1CWE A;  2FO0 A;  2ETZ A;  1SKJ A;  4A4C A;  2DVJ A;  2EYY A;  2H8H A;  3S8O A;  1O4O A;  3S9K A;  1AOT F;  1O41 A;  2EYV A;  3BUO B;  3OP0 A;  3T04 A;  1PIC A;  1TZE E;  1BLJ A;  1X6C A;  4DGP A;  1M27 A;  2Y1M A;  2CIA A;  3PSJ A;  3N8M A;  1K9A A;  5GJH A;  2IUG A;  2MK2 A;  3BUW B;  3CBL A;  3EAZ A;  4EIH A;  3GQI B;  1AB2 A;  3VGO A;  1FBZ A;  1R1S A;  1A1E A;  3PFV A;  1NZV A;  3IN8 A;  1OO3 A;  4U17 A;  1KA6 A;  1X27 A;  1AD5 A;  1JWO A;  3UYO A;  1O4I A;  2HDV A;  4OHE A;  1KC2 A;  3QWX X;  1MW4 A;  2KK6 A;  4LUD A;  2YSX A;  2DLZ A;  2PNA A;  2H46 E;  1LUK A;  2PTK A;  4ROJ A;  4L1B B;  2BBU A;  3BUM B;  3CD3 A;  1A1A A;  4P9Z A;  4WWQ A;  1O4R A;  3OB1 B;  1BG1 A;  3VS2 A;  1QG1 E;  3BUX B;  2GSB A;  2ABL A;  3PSK A;  1FU6 A;  1RJA A;  4K45 A;  1A08 A;  2QMS A;  3K2M A;  1O4J A;  2SHP A;  1NZL A;  5EHR A;  1KA7 A;  1F1W A;  3QWY A;  1AYA A;  3VS3 A;  1YVH A;  1BKL A;  1F2F A;  2EOB A;  4OHH A;  5AUL A;  1BF5 A;  2EO3 A;  1SHD A;  1BHH A;  2L6K A;  5DC4 A;  3S8N A;  3EAC A;  5EHP A;  5GJI A;  1D4T A;  2CRH A;  5KAZ A;  1M61 A;  1ZFP E;  5BO4 A;  1IS0 A;  2L3T A;  1Y1U A;  3VS7 A;  1FBV A;  5DC0 B;  1LCJ A;  3BKB A;  1LCK A;  1R1Q A;  5HKW A;  3US4 A;  2CI8 A;  3VRZ A;  1FMK A;  1LUI A;  2IUI A;  5HKY A;  1O47 A;  1O48 A;  1O4G A;  1RPY A;  2DX0 A;  4QSY A;  2EYZ A;  4K11 A;  3HCK A;  4D8K A;  2GE9 A;  3PJP A;  4F5B A;  4JE4 A;  3OB2 B;  1D4W A;  1Z3K A;  1LUN A;  2HDX A;  4X6S A;  2RSY A;  1JYR A;  4FL3 A;  4P9V A;  1A81 A;  1BLK A;  4EY0 A;  3M7F A;  1O4H A;  2CS0 A;  3UF4 A;  1O45 A;  1A1B A;  1O4P A;  4U1P A;  1FU5 A;  1O4K A;  2SRC A;  4JGH A;  3VRP A;  4M4Z A;  2IUH A;  1OPL A;  1BM2 A;  2HMH A;  3S8L A;  1GRI A;  4E93 A;  5J3X A;  3PQZ A;  4H34 A;  3VS0 A;  1UUR A;  5HKZ A;  5CDW A;  4FBN A;  3IMJ A;  2LCT A;  4JEG A;  2CBL A;  3C7I A;  1AYC A;  1O43 A;  3OV1 A;  4GWF A;  2MRJ A;  3MXY A;  2KNO A;  3IN7 A;  3NHN A;  1B47 A;  2OZO A;  3N84 A;  3PLF B;  3MXC A;  1CSY A;  3VS5 A;  1O46 A;  2EO6 A;  1SHB A;  1AOU F;  5AXI A;  1UUS A;  3VRN A;  4GL9 E;  2LNW A;  1A1C A;  2RVF A;  1YVL A;  2OQ1 A;  1RQQ C;  3ZNI A;  2IZV A;  1XA6 A;  2FCI A;  2CI9 A;  4OHI A;  3VRR A;  4OHL A;  1O4D A;  1NRV A;  1JYQ A;  4F5A A;  2DCR A;  3HIZ B;  2B3O A;  2C0T A;  1IJR A;  3N7Y A;  1O4L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...