3US4A

Crystal structure of a sh2 domain of a megakaryocyte-associated tyrosine kinase (matk) from homo sapiens at 1.50 a resolution
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
97
structure length
97
Chain Sequence
b'LSLMPWFHGKISGQEAVQQLQPPEDGLFLVRESARHPGDYVLCVSFGRDVIHYRVLHRDGHLTIDEAVFFCNLMDMVEHYSKDKGAICTKLVRPKRK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Megakaryocyte-associated tyrosine-protein kinase
publication title Crystal structure of a SH2 domain of a megakaryocyte-associated tyrosine kinase (MATK) from Homo sapiens at 1.50 A resolution
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 21
structure length 97
sequence length 97
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2011-11-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00017 SH2 SH2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.505.10 Alpha Beta 2-Layer Sandwich SHC Adaptor Protein SH2 domain 3us4A00
5EHRA 4ROJA 3UYOA 2EYZA 5EEQA 2YU7A 1Y57A 1O46A 2MC1A 1D4WA 5HKWA 1O4NA 2LNXA 3N7YA 1OO3A 4GL9E 3VROA 2HMHA 1UUSA 3VS6A 1A09A 1KA7A 1H9OA 1LUMA 4F59A 2L3TA 2CI9A 1NZLA 4K44A 1BKMA 2DLZA 2HCKA 1FBZA 2CRHA 1BLKA 1JYQA 5J3XA 1O49A 4TZIA 2QMSA 1O4DA 4P9ZA 1SPSA 1TCEA 3PLFB 4K45A 5AULA 1BHHB 1BFIA 2RORA 4XZ1A 1YVHA 3HHMB 3PSKA 1Z3KA 1M27A 2H8HA 1O42A 2C9WA 3PFVA 4WWQA 5HKZA 5D0JA 3VS2A 2K7AB 1M61A 5DF6A 1RJAA 2ECDA 1QCFA 2GE9A 3VS5A 1AOTF 2PLDA 1O45A 2CS0A 2HDXA 5GJIA 4A4BA 2MK2A 1BFJA 1K9AA 3HCKA 1AOUF 1JYUA 1LUKA 1AB2A 1LUIA 3EACA 1A07A 2AOBA 1O4HA 2Y1MA 2DVJA 1JYRA 5DC4A 1UURA 2PNBA 5DC0B 4X6SA 2CBLA 5HKYA 1BM2A 3PJPA 1IJRA 1MILA 1O4KA 5KAZA 1O4IA 2KK6A 3QWXX 2RSYA 3VS3A 2EO3A 5GJHA 1O4RA 1X6CA 2IUGA 1D1ZA 3GXWA 3OB1B 1FMKA 3IMJA 1WQUA 3S9KA 1CJ1A 2Y1NA 4XZ0A 4H1OA 1SKJA 2BBUA 3VRZA 3VS7A 1AYAA 1O4LA 1IS0A 2EKXA 4D8KA 1KSWA 4JEGA 1A1AA 5AXIA 3BUNB 4OHIA 1BMBA 2EL8A 1OO4A 1HCTB 1OPKA 1A81A 4NWFA 1LKLA 4OHEA 2AOAA 2H46E 2CR4A 3BUXB 1FHSA 1CWEA 1O48A 3MXCA 2C0OA 2EOBA 1R1SA 1X0NA 2FCIA 1BHHA 2KNOA 1GRIA 1O4OA 3OV1A 1AYCA 2C0TA 3QWYA 4JE4A 1YVLA 2DLYA 2PNAA 3MXYA 1O4PA 1QADA 1F1WA 2K79B 3VRYA 1AD5A 2B3OA 2L4KA 1JWOA 5CDWA 1O43A 2LQNA 1PICA 3OP0A 1FBVA 1BKLA 3VGOA 4U17A 2DM0A 1XA6A 2L6KA 3ZNIA 3PSJA 1O4MA 1R1QA 2AUGA 3S8NA 1CWDL 4EIHA 3BKBA 1O4QA 4OHHA 2HUWA 4K2RA 4FL3A 3CD3A 1MW4A 3MAZA 1KC2A 1BHFA 5I6VA 3CXLA 1O4AA 3CWGA 1SHAA 2LCTA 1RPYA 2LNWA 3N8MA 1OPLA 1P13A 2EU0A 3VS4A 2CIAA 3C7IA 2ABLA 4F5BA 3WA4A 2RVFA 3GXXA 1Y1UA 3VRRA 3HIZB 4P9VA 2OQ1A 1FU6A 1F2FA 3BUWB 3M7FA 1R1PA 4E68A 5EELA 2SRCA 4DGXA 1SPRA 3GQIB 1LCJA 1O44A 2EYYA 1D4TA 2H5KA 4U1PA 2JYQA 4OHLA 2IUIA 2C0IA 3VRQA 3N84A 4LUEA 3VRNA 1KA6A 1O4CA 3EAZA 3S8LA 1BF5A 4JGHA 2DCRA 1CSYA 1O4EA 4FBNA 2ETZA 1JU5A 1A1EA 1NZVA 1TZEE 4FL2A 1LUNA 4DGPA 2EYVA 4LUDA 1NRVA 1G83A 3VRPA 1GHUA 1O4BA 1LCKA 5BO4A 4GWFA 5IBMA 2CI8A 4OHDA 1X27A 3BUMB 4H34A 2RMXA 1O4JA 1BLJA 2OZOA 2DX0A 2HDVA 2XP1A 3OVEA 4EY0A 1BG1A 3UF4A 2MRKA 4K11A 1O47A 1I3ZA 1CSZA 3VS0A 4A4CA 4E93A 1LKKA 3OB2B 3US4A 3K2MA 4QSYA 3BUOB 4L1BB 2IUHA 5EHPA 3VS1A 4F5AA 1ZFPE 2Y3AB 1AYBA 2EO6A 3S8OA 2LQWA 1RQQC 3PS5A 1SHDA 1AYDA 1A1BA 3CBLA 1O4GA 2MRJA 4GPLB 2GSBA 2SHPA 5IBSA 2MQIA 2FO0A 3T04A 1SHBA 2YSXA 4M4ZA 3NHNA 2VIFA 3IN8A 2PTKA 1QG1E 2PLEA 5EG3B 1O4FA 1A08A 4NWGA 3TL0A 3IN7A 2IZVA 1FYRA 1B47A 1A1CA 1FU5A 5DC9A 1HCSB 3KFJA 3IMDA 1O41A 3TKZA 3PQZA
chains in the Genus database with same CATH superfamily
5EHRA 4ROJA 3UYOA 2EYZA 5EEQA 2YU7A 1Y57A 1O46A 2MC1A 1D4WA 5HKWA 1O4NA 2LNXA 3N7YA 1OO3A 4GL9E 3VROA 2HMHA 1UUSA 3VS6A 1A09A 1KA7A 1H9OA 1LUMA 4F59A 2L3TA 2KGYA 2CI9A 1NZLA 4K44A 1BKMA 2DLZA 2HCKA 1FBZA 2CRHA 1BLKA 1JYQA 5J3XA 1O49A 4TZIA 2QMSA 1O4DA 4P9ZA 1SPSA 1TCEA 3PLFB 4K45A 5AULA 1BHHB 1BFIA 2RORA 4XZ1A 1YVHA 3HHMB 3PSKA 1Z3KA 1M27A 2H8HA 1O42A 2C9WA 3PFVA 4WWQA 5HKZA 5D0JA 3VS2A 2K7AB 1M61A 5DF6A 1RJAA 2ECDA 1QCFA 2GE9A 3VS5A 1AOTF 2PLDA 1O45A 2CS0A 2HDXA 5GJIA 4A4BA 2MK2A 1BFJA 1K9AA 3HCKA 1AOUF 1JYUA 1LUKA 2LRAA 1AB2A 1LUIA 3EACA 1A07A 2AOBA 1O4HA 2Y1MA 2DVJA 1JYRA 5DC4A 1UURA 2PNBA 5DC0B 4X6SA 2CBLA 5HKYA 1BM2A 3PJPA 1IJRA 1MILA 1O4KA 5KAZA 1O4IA 2KK6A 3QWXX 2RSYA 3VS3A 2EO3A 5GJHA 1O4RA 1X6CA 2IUGA 1D1ZA 3GXWA 3OB1B 1FMKA 3IMJA 1WQUA 3S9KA 1CJ1A 2Y1NA 4XZ0A 4H1OA 1SKJA 2BBUA 3VRZA 3VS7A 1AYAA 1O4LA 1IS0A 2EKXA 4D8KA 1KSWA 4JEGA 1A1AA 5AXIA 3BUNB 4OHIA 1BMBA 2EL8A 1OO4A 1HCTB 1OPKA 1A81A 4NWFA 1LKLA 4OHEA 2AOAA 2H46E 2CR4A 3BUXB 1FHSA 1CWEA 1O48A 3MXCA 2C0OA 2EOBA 1R1SA 1X0NA 2FCIA 1BHHA 2KNOA 1GRIA 1O4OA 3OV1A 1AYCA 2C0TA 3QWYA 4JE4A 1YVLA 2DLYA 2PNAA 3MXYA 1O4PA 1QADA 1F1WA 2K79B 3VRYA 1AD5A 2B3OA 2L4KA 1JWOA 5CDWA 1O43A 2LQNA 1PICA 3OP0A 1FBVA 1BKLA 3VGOA 4U17A 2DM0A 1XA6A 2L6KA 3ZNIA 3PSJA 1O4MA 1R1QA 2AUGA 3S8NA 1CWDL 4EIHA 3BKBA 1O4QA 4OHHA 2HUWA 4K2RA 4FL3A 3CD3A 1MW4A 3MAZA 1KC2A 1BHFA 5I6VA 3CXLA 1O4AA 3CWGA 1SHAA 2LCTA 1RPYA 2LNWA 3N8MA 1OPLA 1P13A 2EU0A 3VS4A 2CIAA 3C7IA 2ABLA 4F5BA 3WA4A 2RVFA 3GXXA 1Y1UA 3VRRA 3HIZB 4P9VA 2OQ1A 1FU6A 1F2FA 3BUWB 3M7FA 1R1PA 4E68A 5EELA 2SRCA 4DGXA 1SPRA 3GQIB 1LCJA 1O44A 2EYYA 1D4TA 2H5KA 4U1PA 2JYQA 4OHLA 2IUIA 2C0IA 3VRQA 3N84A 4LUEA 3VRNA 1KA6A 1O4CA 3EAZA 3S8LA 1BF5A 4JGHA 2DCRA 1CSYA 1O4EA 4FBNA 2ETZA 1JU5A 1A1EA 1NZVA 1TZEE 4FL2A 1LUNA 4DGPA 2EYVA 4LUDA 1NRVA 1G83A 3VRPA 1GHUA 1O4BA 1LCKA 5BO4A 4GWFA 3LYVA 5IBMA 2CI8A 4OHDA 1X27A 3BUMB 4H34A 2RMXA 1O4JA 1BLJA 2OZOA 2DX0A 2HDVA 2XP1A 3OVEA 4EY0A 1BG1A 3UF4A 2MRKA 4K11A 1O47A 1I3ZA 1CSZA 3VS0A 4A4CA 4E93A 1LKKA 3OB2B 3US4A 3K2MA 4QSYA 3BUOB 4L1BB 2IUHA 5EHPA 3VS1A 4F5AA 1ZFPE 2Y3AB 1AYBA 2EO6A 3S8OA 2LQWA 1RQQC 3PS5A 1SHDA 1AYDA 1A1BA 3CBLA 1O4GA 2MRJA 4GPLB 2GSBA 2SHPA 5IBSA 2MQIA 2FO0A 3T04A 1SHBA 2YSXA 4M4ZA 3NHNA 2VIFA 3IN8A 2PTKA 1QG1E 2PLEA 5EG3B 1O4FA 1A08A 4NWGA 3TL0A 3IN7A 2IZVA 1FYRA 1B47A 1A1CA 1FU5A 3K2TA 5DC9A 1HCSB 3KFJA 3IMDA 1O41A 3TKZA 3PQZA
chains in the Genus database with same CATH topology
5EHRA 4ROJA 3UYOA 2EYZA 5EEQA 2YU7A 1Y57A 1O46A 2MC1A 1D4WA 5HKWA 1O4NA 2LNXA 3N7YA 1OO3A 4GL9E 3VROA 2HMHA 1UUSA 3VS6A 1A09A 1KA7A 1H9OA 1LUMA 4F59A 2L3TA 2CI9A 1NZLA 4K44A 1BKMA 2DLZA 2HCKA 1FBZA 2CRHA 1BLKA 1JYQA 5J3XA 1O49A 4TZIA 2QMSA 1O4DA 4P9ZA 1SPSA 1TCEA 3PLFB 4K45A 5AULA 1BHHB 1BFIA 2RORA 4XZ1A 1YVHA 3HHMB 3PSKA 1Z3KA 1M27A 2H8HA 1O42A 2C9WA 3PFVA 4WWQA 5HKZA 5D0JA 3VS2A 2K7AB 1M61A 5DF6A 1RJAA 2ECDA 1QCFA 2GE9A 3VS5A 1AOTF 2PLDA 1O45A 2CS0A 2HDXA 5GJIA 4A4BA 2MK2A 1BFJA 1K9AA 3HCKA 1AOUF 1JYUA 1LUKA 1AB2A 1LUIA 3EACA 1A07A 2AOBA 1O4HA 2Y1MA 2DVJA 1JYRA 5DC4A 1UURA 2PNBA 5DC0B 4X6SA 2CBLA 5HKYA 1BM2A 3PJPA 1IJRA 1MILA 1O4KA 5KAZA 1O4IA 2KK6A 3QWXX 2RSYA 3VS3A 2EO3A 5GJHA 1O4RA 1X6CA 2IUGA 1D1ZA 3GXWA 3OB1B 1FMKA 3IMJA 1WQUA 3S9KA 1CJ1A 2Y1NA 4XZ0A 4H1OA 1SKJA 2BBUA 3VRZA 3VS7A 1AYAA 1O4LA 1IS0A 2EKXA 4D8KA 1KSWA 4JEGA 1A1AA 5AXIA 3BUNB 4OHIA 1BMBA 2EL8A 1OO4A 1HCTB 1OPKA 1A81A 4NWFA 1LKLA 4OHEA 2AOAA 2H46E 2CR4A 3BUXB 1FHSA 1CWEA 1O48A 3MXCA 2C0OA 2EOBA 1R1SA 1X0NA 2FCIA 1BHHA 2KNOA 1GRIA 1O4OA 3OV1A 1AYCA 2C0TA 3QWYA 4JE4A 1YVLA 2DLYA 2PNAA 3MXYA 1O4PA 1QADA 1F1WA 2K79B 3VRYA 1AD5A 2B3OA 2L4KA 1JWOA 5CDWA 1O43A 2LQNA 1PICA 3OP0A 1FBVA 1BKLA 3VGOA 4U17A 2DM0A 1XA6A 2L6KA 3ZNIA 3PSJA 1O4MA 1R1QA 2AUGA 3S8NA 1CWDL 4EIHA 3BKBA 1O4QA 4OHHA 2HUWA 4K2RA 4FL3A 3CD3A 1MW4A 3MAZA 1KC2A 1BHFA 5I6VA 3CXLA 1O4AA 3CWGA 1SHAA 2LCTA 1RPYA 2LNWA 3N8MA 1OPLA 1P13A 2EU0A 3VS4A 2CIAA 3C7IA 2ABLA 4F5BA 3WA4A 2RVFA 3GXXA 1Y1UA 3VRRA 3HIZB 4P9VA 2OQ1A 1FU6A 1F2FA 3BUWB 3M7FA 1R1PA 4E68A 5EELA 2SRCA 4DGXA 1SPRA 3GQIB 1LCJA 1O44A 2EYYA 1D4TA 2H5KA 4U1PA 2JYQA 4OHLA 2IUIA 2C0IA 3VRQA 3N84A 4LUEA 3VRNA 1KA6A 1O4CA 3EAZA 3S8LA 1BF5A 4JGHA 2DCRA 1CSYA 1O4EA 4FBNA 2ETZA 1JU5A 1A1EA 1NZVA 1TZEE 4FL2A 1LUNA 4DGPA 2EYVA 4LUDA 1NRVA 1G83A 3VRPA 1GHUA 1O4BA 1LCKA 5BO4A 4GWFA 5IBMA 2CI8A 4OHDA 1X27A 3BUMB 4H34A 2RMXA 1O4JA 1BLJA 2OZOA 2DX0A 2HDVA 2XP1A 3OVEA 4EY0A 1BG1A 3UF4A 2MRKA 4K11A 1O47A 1I3ZA 1CSZA 3VS0A 4A4CA 4E93A 1LKKA 3OB2B 3US4A 3K2MA 4QSYA 3BUOB 4L1BB 2IUHA 5EHPA 3VS1A 4F5AA 1ZFPE 2Y3AB 1AYBA 2EO6A 3S8OA 2LQWA 1RQQC 3PS5A 1SHDA 1AYDA 1A1BA 3CBLA 1O4GA 2MRJA 4GPLB 2GSBA 2SHPA 5IBSA 2MQIA 2FO0A 3T04A 1SHBA 2YSXA 4M4ZA 3NHNA 2VIFA 3IN8A 2PTKA 1QG1E 2PLEA 5EG3B 1O4FA 1A08A 4NWGA 3TL0A 3IN7A 2IZVA 1FYRA 1B47A 1A1CA 1FU5A 5DC9A 1HCSB 3KFJA 3IMDA 1O41A 3TKZA 3PQZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EHR A;  4ROJ A;  3UYO A;  2EYZ A;  5EEQ A;  2YU7 A;  1Y57 A;  1O46 A;  2MC1 A;  1D4W A;  5HKW A;  1O4N A;  2LNX A;  3N7Y A;  1OO3 A;  4GL9 E;  3VRO A;  2HMH A;  1UUS A;  3VS6 A;  1A09 A;  1KA7 A;  1H9O A;  1LUM A;  4F59 A;  2L3T A;  2CI9 A;  1NZL A;  4K44 A;  1BKM A;  2DLZ A;  2HCK A;  1FBZ A;  2CRH A;  1BLK A;  1JYQ A;  5J3X A;  1O49 A;  4TZI A;  2QMS A;  1O4D A;  4P9Z A;  1SPS A;  1TCE A;  3PLF B;  4K45 A;  5AUL A;  1BHH B;  1BFI A;  2ROR A;  4XZ1 A;  1YVH A;  3HHM B;  3PSK A;  1Z3K A;  1M27 A;  2H8H A;  1O42 A;  2C9W A;  3PFV A;  4WWQ A;  5HKZ A;  5D0J A;  3VS2 A;  2K7A B;  1M61 A;  5DF6 A;  1RJA A;  2ECD A;  1QCF A;  2GE9 A;  3VS5 A;  1AOT F;  2PLD A;  1O45 A;  2CS0 A;  2HDX A;  5GJI A;  4A4B A;  2MK2 A;  1BFJ A;  1K9A A;  3HCK A;  1AOU F;  1JYU A;  1LUK A;  1AB2 A;  1LUI A;  3EAC A;  1A07 A;  2AOB A;  1O4H A;  2Y1M A;  2DVJ A;  1JYR A;  5DC4 A;  1UUR A;  2PNB A;  5DC0 B;  4X6S A;  2CBL A;  5HKY A;  1BM2 A;  3PJP A;  1IJR A;  1MIL A;  1O4K A;  5KAZ A;  1O4I A;  2KK6 A;  3QWX X;  2RSY A;  3VS3 A;  2EO3 A;  5GJH A;  1O4R A;  1X6C A;  2IUG A;  1D1Z A;  3GXW A;  3OB1 B;  1FMK A;  3IMJ A;  1WQU A;  3S9K A;  1CJ1 A;  2Y1N A;  4XZ0 A;  4H1O A;  1SKJ A;  2BBU A;  3VRZ A;  3VS7 A;  1AYA A;  1O4L A;  1IS0 A;  2EKX A;  4D8K A;  1KSW A;  4JEG A;  1A1A A;  5AXI A;  3BUN B;  4OHI A;  1BMB A;  2EL8 A;  1OO4 A;  1HCT B;  1OPK A;  1A81 A;  4NWF A;  1LKL A;  4OHE A;  2AOA A;  2H46 E;  2CR4 A;  3BUX B;  1FHS A;  1CWE A;  1O48 A;  3MXC A;  2C0O A;  2EOB A;  1R1S A;  1X0N A;  2FCI A;  1BHH A;  2KNO A;  1GRI A;  1O4O A;  3OV1 A;  1AYC A;  2C0T A;  3QWY A;  4JE4 A;  1YVL A;  2DLY A;  2PNA A;  3MXY A;  1O4P A;  1QAD A;  1F1W A;  2K79 B;  3VRY A;  1AD5 A;  2B3O A;  2L4K A;  1JWO A;  5CDW A;  1O43 A;  2LQN A;  1PIC A;  3OP0 A;  1FBV A;  1BKL A;  3VGO A;  4U17 A;  2DM0 A;  1XA6 A;  2L6K A;  3ZNI A;  3PSJ A;  1O4M A;  1R1Q A;  2AUG A;  3S8N A;  1CWD L;  4EIH A;  3BKB A;  1O4Q A;  4OHH A;  2HUW A;  4K2R A;  4FL3 A;  3CD3 A;  1MW4 A;  3MAZ A;  1KC2 A;  1BHF A;  5I6V A;  3CXL A;  1O4A A;  3CWG A;  1SHA A;  2LCT A;  1RPY A;  2LNW A;  3N8M A;  1OPL A;  1P13 A;  2EU0 A;  3VS4 A;  2CIA A;  3C7I A;  2ABL A;  4F5B A;  3WA4 A;  2RVF A;  3GXX A;  1Y1U A;  3VRR A;  3HIZ B;  4P9V A;  2OQ1 A;  1FU6 A;  1F2F A;  3BUW B;  3M7F A;  1R1P A;  4E68 A;  5EEL A;  2SRC A;  4DGX A;  1SPR A;  3GQI B;  1LCJ A;  1O44 A;  2EYY A;  1D4T A;  2H5K A;  4U1P A;  2JYQ A;  4OHL A;  2IUI A;  2C0I A;  3VRQ A;  3N84 A;  4LUE A;  3VRN A;  1KA6 A;  1O4C A;  3EAZ A;  3S8L A;  1BF5 A;  4JGH A;  2DCR A;  1CSY A;  1O4E A;  4FBN A;  2ETZ A;  1JU5 A;  1A1E A;  1NZV A;  1TZE E;  4FL2 A;  1LUN A;  4DGP A;  2EYV A;  4LUD A;  1NRV A;  1G83 A;  3VRP A;  1GHU A;  1O4B A;  1LCK A;  5BO4 A;  4GWF A;  5IBM A;  2CI8 A;  4OHD A;  1X27 A;  3BUM B;  4H34 A;  2RMX A;  1O4J A;  1BLJ A;  2OZO A;  2DX0 A;  2HDV A;  2XP1 A;  3OVE A;  4EY0 A;  1BG1 A;  3UF4 A;  2MRK A;  4K11 A;  1O47 A;  1I3Z A;  1CSZ A;  3VS0 A;  4A4C A;  4E93 A;  1LKK A;  3OB2 B;  3US4 A;  3K2M A;  4QSY A;  3BUO B;  4L1B B;  2IUH A;  5EHP A;  3VS1 A;  4F5A A;  1ZFP E;  2Y3A B;  1AYB A;  2EO6 A;  3S8O A;  2LQW A;  1RQQ C;  3PS5 A;  1SHD A;  1AYD A;  1A1B A;  3CBL A;  1O4G A;  2MRJ A;  4GPL B;  2GSB A;  2SHP A;  5IBS A;  2MQI A;  2FO0 A;  3T04 A;  1SHB A;  2YSX A;  4M4Z A;  3NHN A;  2VIF A;  3IN8 A;  2PTK A;  1QG1 E;  2PLE A;  5EG3 B;  1O4F A;  1A08 A;  4NWG A;  3TL0 A;  3IN7 A;  2IZV A;  1FYR A;  1B47 A;  1A1C A;  1FU5 A;  5DC9 A;  1HCS B;  3KFJ A;  3IMD A;  1O41 A;  3TKZ A;  3PQZ A; 
#chains in the Genus database with same CATH topology
 5EHR A;  4ROJ A;  3UYO A;  2EYZ A;  5EEQ A;  2YU7 A;  1Y57 A;  1O46 A;  2MC1 A;  1D4W A;  5HKW A;  1O4N A;  2LNX A;  3N7Y A;  1OO3 A;  4GL9 E;  3VRO A;  2HMH A;  1UUS A;  3VS6 A;  1A09 A;  1KA7 A;  1H9O A;  1LUM A;  4F59 A;  2L3T A;  2KGY A;  2CI9 A;  1NZL A;  4K44 A;  1BKM A;  2DLZ A;  2HCK A;  1FBZ A;  2CRH A;  1BLK A;  1JYQ A;  5J3X A;  1O49 A;  4TZI A;  2QMS A;  1O4D A;  4P9Z A;  1SPS A;  1TCE A;  3PLF B;  4K45 A;  5AUL A;  1BHH B;  1BFI A;  2ROR A;  4XZ1 A;  1YVH A;  3HHM B;  3PSK A;  1Z3K A;  1M27 A;  2H8H A;  1O42 A;  2C9W A;  3PFV A;  4WWQ A;  5HKZ A;  5D0J A;  3VS2 A;  2K7A B;  1M61 A;  5DF6 A;  1RJA A;  2ECD A;  1QCF A;  2GE9 A;  3VS5 A;  1AOT F;  2PLD A;  1O45 A;  2CS0 A;  2HDX A;  5GJI A;  4A4B A;  2MK2 A;  1BFJ A;  1K9A A;  3HCK A;  1AOU F;  1JYU A;  1LUK A;  2LRA A;  1AB2 A;  1LUI A;  3EAC A;  1A07 A;  2AOB A;  1O4H A;  2Y1M A;  2DVJ A;  1JYR A;  5DC4 A;  1UUR A;  2PNB A;  5DC0 B;  4X6S A;  2CBL A;  5HKY A;  1BM2 A;  3PJP A;  1IJR A;  1MIL A;  1O4K A;  5KAZ A;  1O4I A;  2KK6 A;  3QWX X;  2RSY A;  3VS3 A;  2EO3 A;  5GJH A;  1O4R A;  1X6C A;  2IUG A;  1D1Z A;  3GXW A;  3OB1 B;  1FMK A;  3IMJ A;  1WQU A;  3S9K A;  1CJ1 A;  2Y1N A;  4XZ0 A;  4H1O A;  1SKJ A;  2BBU A;  3VRZ A;  3VS7 A;  1AYA A;  1O4L A;  1IS0 A;  2EKX A;  4D8K A;  1KSW A;  4JEG A;  1A1A A;  5AXI A;  3BUN B;  4OHI A;  1BMB A;  2EL8 A;  1OO4 A;  1HCT B;  1OPK A;  1A81 A;  4NWF A;  1LKL A;  4OHE A;  2AOA A;  2H46 E;  2CR4 A;  3BUX B;  1FHS A;  1CWE A;  1O48 A;  3MXC A;  2C0O A;  2EOB A;  1R1S A;  1X0N A;  2FCI A;  1BHH A;  2KNO A;  1GRI A;  1O4O A;  3OV1 A;  1AYC A;  2C0T A;  3QWY A;  4JE4 A;  1YVL A;  2DLY A;  2PNA A;  3MXY A;  1O4P A;  1QAD A;  1F1W A;  2K79 B;  3VRY A;  1AD5 A;  2B3O A;  2L4K A;  1JWO A;  5CDW A;  1O43 A;  2LQN A;  1PIC A;  3OP0 A;  1FBV A;  1BKL A;  3VGO A;  4U17 A;  2DM0 A;  1XA6 A;  2L6K A;  3ZNI A;  3PSJ A;  1O4M A;  1R1Q A;  2AUG A;  3S8N A;  1CWD L;  4EIH A;  3BKB A;  1O4Q A;  4OHH A;  2HUW A;  4K2R A;  4FL3 A;  3CD3 A;  1MW4 A;  3MAZ A;  1KC2 A;  1BHF A;  5I6V A;  3CXL A;  1O4A A;  3CWG A;  1SHA A;  2LCT A;  1RPY A;  2LNW A;  3N8M A;  1OPL A;  1P13 A;  2EU0 A;  3VS4 A;  2CIA A;  3C7I A;  2ABL A;  4F5B A;  3WA4 A;  2RVF A;  3GXX A;  1Y1U A;  3VRR A;  3HIZ B;  4P9V A;  2OQ1 A;  1FU6 A;  1F2F A;  3BUW B;  3M7F A;  1R1P A;  4E68 A;  5EEL A;  2SRC A;  4DGX A;  1SPR A;  3GQI B;  1LCJ A;  1O44 A;  2EYY A;  1D4T A;  2H5K A;  4U1P A;  2JYQ A;  4OHL A;  2IUI A;  2C0I A;  3VRQ A;  3N84 A;  4LUE A;  3VRN A;  1KA6 A;  1O4C A;  3EAZ A;  3S8L A;  1BF5 A;  4JGH A;  2DCR A;  1CSY A;  1O4E A;  4FBN A;  2ETZ A;  1JU5 A;  1A1E A;  1NZV A;  1TZE E;  4FL2 A;  1LUN A;  4DGP A;  2EYV A;  4LUD A;  1NRV A;  1G83 A;  3VRP A;  1GHU A;  1O4B A;  1LCK A;  5BO4 A;  4GWF A;  3LYV A;  5IBM A;  2CI8 A;  4OHD A;  1X27 A;  3BUM B;  4H34 A;  2RMX A;  1O4J A;  1BLJ A;  2OZO A;  2DX0 A;  2HDV A;  2XP1 A;  3OVE A;  4EY0 A;  1BG1 A;  3UF4 A;  2MRK A;  4K11 A;  1O47 A;  1I3Z A;  1CSZ A;  3VS0 A;  4A4C A;  4E93 A;  1LKK A;  3OB2 B;  3US4 A;  3K2M A;  4QSY A;  3BUO B;  4L1B B;  2IUH A;  5EHP A;  3VS1 A;  4F5A A;  1ZFP E;  2Y3A B;  1AYB A;  2EO6 A;  3S8O A;  2LQW A;  1RQQ C;  3PS5 A;  1SHD A;  1AYD A;  1A1B A;  3CBL A;  1O4G A;  2MRJ A;  4GPL B;  2GSB A;  2SHP A;  5IBS A;  2MQI A;  2FO0 A;  3T04 A;  1SHB A;  2YSX A;  4M4Z A;  3NHN A;  2VIF A;  3IN8 A;  2PTK A;  1QG1 E;  2PLE A;  5EG3 B;  1O4F A;  1A08 A;  4NWG A;  3TL0 A;  3IN7 A;  2IZV A;  1FYR A;  1B47 A;  1A1C A;  1FU5 A;  3K2T A;  5DC9 A;  1HCS B;  3KFJ A;  3IMD A;  1O41 A;  3TKZ A;  3PQZ A; 
#chains in the Genus database with same CATH homology
 5EHR A;  4ROJ A;  3UYO A;  2EYZ A;  5EEQ A;  2YU7 A;  1Y57 A;  1O46 A;  2MC1 A;  1D4W A;  5HKW A;  1O4N A;  2LNX A;  3N7Y A;  1OO3 A;  4GL9 E;  3VRO A;  2HMH A;  1UUS A;  3VS6 A;  1A09 A;  1KA7 A;  1H9O A;  1LUM A;  4F59 A;  2L3T A;  2CI9 A;  1NZL A;  4K44 A;  1BKM A;  2DLZ A;  2HCK A;  1FBZ A;  2CRH A;  1BLK A;  1JYQ A;  5J3X A;  1O49 A;  4TZI A;  2QMS A;  1O4D A;  4P9Z A;  1SPS A;  1TCE A;  3PLF B;  4K45 A;  5AUL A;  1BHH B;  1BFI A;  2ROR A;  4XZ1 A;  1YVH A;  3HHM B;  3PSK A;  1Z3K A;  1M27 A;  2H8H A;  1O42 A;  2C9W A;  3PFV A;  4WWQ A;  5HKZ A;  5D0J A;  3VS2 A;  2K7A B;  1M61 A;  5DF6 A;  1RJA A;  2ECD A;  1QCF A;  2GE9 A;  3VS5 A;  1AOT F;  2PLD A;  1O45 A;  2CS0 A;  2HDX A;  5GJI A;  4A4B A;  2MK2 A;  1BFJ A;  1K9A A;  3HCK A;  1AOU F;  1JYU A;  1LUK A;  1AB2 A;  1LUI A;  3EAC A;  1A07 A;  2AOB A;  1O4H A;  2Y1M A;  2DVJ A;  1JYR A;  5DC4 A;  1UUR A;  2PNB A;  5DC0 B;  4X6S A;  2CBL A;  5HKY A;  1BM2 A;  3PJP A;  1IJR A;  1MIL A;  1O4K A;  5KAZ A;  1O4I A;  2KK6 A;  3QWX X;  2RSY A;  3VS3 A;  2EO3 A;  5GJH A;  1O4R A;  1X6C A;  2IUG A;  1D1Z A;  3GXW A;  3OB1 B;  1FMK A;  3IMJ A;  1WQU A;  3S9K A;  1CJ1 A;  2Y1N A;  4XZ0 A;  4H1O A;  1SKJ A;  2BBU A;  3VRZ A;  3VS7 A;  1AYA A;  1O4L A;  1IS0 A;  2EKX A;  4D8K A;  1KSW A;  4JEG A;  1A1A A;  5AXI A;  3BUN B;  4OHI A;  1BMB A;  2EL8 A;  1OO4 A;  1HCT B;  1OPK A;  1A81 A;  4NWF A;  1LKL A;  4OHE A;  2AOA A;  2H46 E;  2CR4 A;  3BUX B;  1FHS A;  1CWE A;  1O48 A;  3MXC A;  2C0O A;  2EOB A;  1R1S A;  1X0N A;  2FCI A;  1BHH A;  2KNO A;  1GRI A;  1O4O A;  3OV1 A;  1AYC A;  2C0T A;  3QWY A;  4JE4 A;  1YVL A;  2DLY A;  2PNA A;  3MXY A;  1O4P A;  1QAD A;  1F1W A;  2K79 B;  3VRY A;  1AD5 A;  2B3O A;  2L4K A;  1JWO A;  5CDW A;  1O43 A;  2LQN A;  1PIC A;  3OP0 A;  1FBV A;  1BKL A;  3VGO A;  4U17 A;  2DM0 A;  1XA6 A;  2L6K A;  3ZNI A;  3PSJ A;  1O4M A;  1R1Q A;  2AUG A;  3S8N A;  1CWD L;  4EIH A;  3BKB A;  1O4Q A;  4OHH A;  2HUW A;  4K2R A;  4FL3 A;  3CD3 A;  1MW4 A;  3MAZ A;  1KC2 A;  1BHF A;  5I6V A;  3CXL A;  1O4A A;  3CWG A;  1SHA A;  2LCT A;  1RPY A;  2LNW A;  3N8M A;  1OPL A;  1P13 A;  2EU0 A;  3VS4 A;  2CIA A;  3C7I A;  2ABL A;  4F5B A;  3WA4 A;  2RVF A;  3GXX A;  1Y1U A;  3VRR A;  3HIZ B;  4P9V A;  2OQ1 A;  1FU6 A;  1F2F A;  3BUW B;  3M7F A;  1R1P A;  4E68 A;  5EEL A;  2SRC A;  4DGX A;  1SPR A;  3GQI B;  1LCJ A;  1O44 A;  2EYY A;  1D4T A;  2H5K A;  4U1P A;  2JYQ A;  4OHL A;  2IUI A;  2C0I A;  3VRQ A;  3N84 A;  4LUE A;  3VRN A;  1KA6 A;  1O4C A;  3EAZ A;  3S8L A;  1BF5 A;  4JGH A;  2DCR A;  1CSY A;  1O4E A;  4FBN A;  2ETZ A;  1JU5 A;  1A1E A;  1NZV A;  1TZE E;  4FL2 A;  1LUN A;  4DGP A;  2EYV A;  4LUD A;  1NRV A;  1G83 A;  3VRP A;  1GHU A;  1O4B A;  1LCK A;  5BO4 A;  4GWF A;  5IBM A;  2CI8 A;  4OHD A;  1X27 A;  3BUM B;  4H34 A;  2RMX A;  1O4J A;  1BLJ A;  2OZO A;  2DX0 A;  2HDV A;  2XP1 A;  3OVE A;  4EY0 A;  1BG1 A;  3UF4 A;  2MRK A;  4K11 A;  1O47 A;  1I3Z A;  1CSZ A;  3VS0 A;  4A4C A;  4E93 A;  1LKK A;  3OB2 B;  3US4 A;  3K2M A;  4QSY A;  3BUO B;  4L1B B;  2IUH A;  5EHP A;  3VS1 A;  4F5A A;  1ZFP E;  2Y3A B;  1AYB A;  2EO6 A;  3S8O A;  2LQW A;  1RQQ C;  3PS5 A;  1SHD A;  1AYD A;  1A1B A;  3CBL A;  1O4G A;  2MRJ A;  4GPL B;  2GSB A;  2SHP A;  5IBS A;  2MQI A;  2FO0 A;  3T04 A;  1SHB A;  2YSX A;  4M4Z A;  3NHN A;  2VIF A;  3IN8 A;  2PTK A;  1QG1 E;  2PLE A;  5EG3 B;  1O4F A;  1A08 A;  4NWG A;  3TL0 A;  3IN7 A;  2IZV A;  1FYR A;  1B47 A;  1A1C A;  1FU5 A;  5DC9 A;  1HCS B;  3KFJ A;  3IMD A;  1O41 A;  3TKZ A;  3PQZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...