1CSZA

Syk tyrosine kinase c-terminal sh2 domain complexed with a phosphopeptidefrom the gamma chain of the high affinity immunoglobin g receptor, nmr
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
112
structure length
112
Chain Sequence
b'GSRRASVGSHEKMPWFHGKISREESEQIVLIGSKTNGKFLIRARDNNGSYALCLLHEGKVLHYRIDKDKTGKLSIPEGKKFDTLWQLVEHYSYKADGLLRVLTVPCQKIGTQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SYK PROTEIN TYROSINE KINASE
publication title Solution structure of the C-terminal SH2 domain of the human tyrosine kinase Syk complexed with a phosphotyrosine pentapeptide.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Complex (phosphotransferase/peptide)
total genus 15
structure length 112
sequence length 112
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 1995-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00017 SH2 SH2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.505.10 Alpha Beta 2-Layer Sandwich SHC Adaptor Protein SH2 domain 1cszA00
2L6KA 1QADA 3GXWA 2DM0A 4GL9E 1QG1E 5DC0B 3N84A 1B47A 1O42A 1X0NA 1XA6A 2IUGA 1PICA 4F5BA 3VRQA 4L1BB 3ZNIA 1HCTB 2C9WA 4H1OA 3OP0A 3VGOA 5J3XA 3UYOA 2LCTA 1BKMA 2EYVA 1FMKA 2DX0A 3VROA 3VS5A 1O4DA 1BFIA 2MRKA 2EYZA 1KA6A 1O4HA 5DC9A 1NRVA 1O4LA 2H46E 3HHMB 2C0IA 3S8OA 3BUMB 3VRNA 3WA4A 1AD5A 2DCRA 3MAZA 2LNXA 2L4KA 2LQWA 2DLZA 1MW4A 3M7FA 1BKLA 1LKKA 4F5AA 2SHPA 2CIAA 4JEGA 1P13A 1SHDA 1UURA 5EELA 3VS4A 3VS0A 5AXIA 1JYQA 2AUGA 3UF4A 4XZ0A 2EO6A 2GE9A 2K79B 4X6SA 4GWFA 1LKLA 3VS6A 2EOBA 1F1WA 1M61A 1GRIA 1Y57A 3CBLA 3OV1A 5BO4A 1Z3KA 3CWGA 1GHUA 1AYAA 1JWOA 3OVEA 4WWQA 1A1BA 1BLKA 1X6CA 4E68A 3BUNB 1O46A 2JYQA 2BBUA 2FO0A 1WQUA 2MC1A 1RPYA 2VIFA 5GJHA 1O43A 4JGHA 1O4FA 1O48A 1YVHA 2CI9A 3OB1B 1D4TA 3PJPA 5EEQA 5D0JA 3BKBA 1AYBA 2CS0A 3PLFB 2MRJA 3K2MA 2H5KA 1H9OA 1KSWA 1TCEA 3KFJA 4E93A 4JE4A 1MILA 1LUNA 5DC4A 3VS1A 1A1CA 4QSYA 2LNWA 1CSYA 2B3OA 2RORA 3CD3A 1O4KA 1TZEE 3VS2A 1JYUA 1BLJA 5EHRA 1LUIA 2L3TA 3EAZA 4U17A 2EYYA 3IN7A 4OHLA 2K7AB 2MK2A 2HDVA 1O41A 3VS7A 1R1SA 3VRYA 1BF5A 1BM2A 1SPRA 1YVLA 2Y1NA 4NWFA 2YSXA 3C7IA 1FBVA 1A09A 1SKJA 2CR4A 2EKXA 3IMJA 3N8MA 4OHEA 3PSJA 2RMXA 1BHFA 5EG3B 1CWDL 1BFJA 2FCIA 2EL8A 1OO3A 1OO4A 1G83A 3TKZA 3S8LA 3VS3A 2XP1A 2AOAA 3GXXA 5IBMA 1O45A 3IN8A 1FU5A 4XZ1A 1R1QA 1M27A 4FL3A 1O4QA 2CI8A 1FYRA 4P9ZA 1HCSB 1QCFA 4OHHA 2HCKA 2KNOA 3VRPA 4K44A 1RJAA 5CDWA 1NZVA 1O4JA 1LCJA 5HKZA 1CSZA 2HDXA 2H8HA 1A07A 4A4CA 5I6VA 1O4RA 1BHHA 1FU6A 3QWYA 1SHAA 1O4CA 2PTKA 2HMHA 4OHDA 1O4GA 1ZFPE 4FL2A 1OPLA 1O4OA 2KK6A 3HCKA 3EACA 3PSKA 3BUXB 1O49A 2DVJA 1A81A 3S9KA 1FHSA 4DGPA 1A08A 2Y3AB 2ETZA 3OB2B 4K2RA 3VRZA 1JU5A 1O47A 5IBSA 1AB2A 3PFVA 1BG1A 1Y1UA 1UUSA 2IUIA 1A1AA 1CJ1A 1O4BA 4EY0A 5HKYA 2RVFA 2C0OA 5HKWA 5DF6A 5GJIA 1O4PA 3T04A 2EO3A 4M4ZA 3N7YA 2DLYA 1R1PA 1AOTF 1CWEA 3NHNA 1OPKA 2IUHA 3PQZA 4NWGA 2IZVA 5KAZA 2QMSA 2MQIA 3PS5A 3HIZB 3MXYA 3BUOB 4TZIA 3QWXX 3GQIB 3CXLA 1KA7A 1X27A 2GSBA 4EIHA 2EU0A 1SHBA 1O44A 1D1ZA 1AYCA 1IJRA 1D4WA 2HUWA 1AYDA 2OQ1A 2SRCA 1F2FA 1O4AA 2PNBA 4K45A 3IMDA 5AULA 4K11A 1O4MA 1I3ZA 2RSYA 3S8NA 4LUEA 1BHHB 4U1PA 2PLEA 4LUDA 4OHIA 1O4IA 2ECDA 4H34A 4F59A 1RQQC 1SPSA 1AOUF 4FBNA 2AOBA 4P9VA 3US4A 4D8KA 2CRHA 1O4NA 1IS0A 2LQNA 4DGXA 2CBLA 2Y1MA 4ROJA 1FBZA 2OZOA 1K9AA 1O4EA 2ABLA 3MXCA 1JYRA 1KC2A 4A4BA 1BMBA 3TL0A 1NZLA 1A1EA 2PNAA 3BUWB 1LUKA 5EHPA 4GPLB 2PLDA 1LUMA 2YU7A 3VRRA 1LCKA 2C0TA
chains in the Genus database with same CATH superfamily
2L6KA 1QADA 3GXWA 2DM0A 4GL9E 1QG1E 5DC0B 3N84A 1B47A 1O42A 1X0NA 1XA6A 2IUGA 1PICA 4F5BA 3VRQA 4L1BB 3ZNIA 1HCTB 2C9WA 4H1OA 3OP0A 3VGOA 5J3XA 3UYOA 2LCTA 1BKMA 2EYVA 1FMKA 2DX0A 3VROA 3VS5A 1O4DA 1BFIA 2MRKA 2EYZA 1KA6A 1O4HA 5DC9A 1NRVA 1O4LA 2H46E 3HHMB 2C0IA 3S8OA 3BUMB 3VRNA 3WA4A 1AD5A 2DCRA 3MAZA 2LNXA 2L4KA 2LQWA 2DLZA 1MW4A 3M7FA 1BKLA 1LKKA 4F5AA 2LRAA 2SHPA 2CIAA 4JEGA 1P13A 1SHDA 1UURA 5EELA 3VS4A 3VS0A 5AXIA 1JYQA 2AUGA 3UF4A 4XZ0A 2EO6A 2GE9A 2K79B 4X6SA 4GWFA 1LKLA 3VS6A 2EOBA 1F1WA 1M61A 1GRIA 1Y57A 3CBLA 3OV1A 5BO4A 1Z3KA 3CWGA 1GHUA 1AYAA 1JWOA 3OVEA 4WWQA 1A1BA 1BLKA 1X6CA 4E68A 3BUNB 1O46A 2JYQA 2BBUA 2FO0A 1WQUA 2MC1A 1RPYA 2VIFA 5GJHA 1O43A 4JGHA 1O4FA 1O48A 1YVHA 2CI9A 3OB1B 1D4TA 3PJPA 5EEQA 5D0JA 3BKBA 1AYBA 2CS0A 3PLFB 2MRJA 2KGYA 3K2MA 2H5KA 1H9OA 1KSWA 1TCEA 3KFJA 4E93A 4JE4A 1MILA 1LUNA 5DC4A 3VS1A 1A1CA 4QSYA 2LNWA 1CSYA 2B3OA 2RORA 3CD3A 1O4KA 1TZEE 3VS2A 1JYUA 1BLJA 5EHRA 1LUIA 2L3TA 3EAZA 4U17A 2EYYA 3IN7A 4OHLA 2K7AB 2MK2A 2HDVA 1O41A 3VS7A 1R1SA 3VRYA 1BF5A 1BM2A 1SPRA 1YVLA 2Y1NA 4NWFA 2YSXA 3C7IA 1FBVA 1A09A 1SKJA 2CR4A 2EKXA 3IMJA 3N8MA 4OHEA 3PSJA 2RMXA 1BHFA 5EG3B 1CWDL 1BFJA 2FCIA 2EL8A 1OO3A 1OO4A 1G83A 3TKZA 3S8LA 3VS3A 2XP1A 2AOAA 3GXXA 5IBMA 1O45A 3IN8A 1FU5A 4XZ1A 1R1QA 1M27A 4FL3A 1O4QA 2CI8A 1FYRA 4P9ZA 1HCSB 1QCFA 4OHHA 2HCKA 2KNOA 3VRPA 4K44A 1RJAA 5CDWA 1NZVA 1O4JA 1LCJA 5HKZA 1CSZA 2HDXA 2H8HA 1A07A 4A4CA 5I6VA 1O4RA 3K2TA 1BHHA 1FU6A 3QWYA 1SHAA 1O4CA 2PTKA 2HMHA 4OHDA 1O4GA 1ZFPE 4FL2A 1OPLA 1O4OA 2KK6A 3HCKA 3EACA 3PSKA 3BUXB 1O49A 2DVJA 1A81A 3S9KA 1FHSA 4DGPA 1A08A 2Y3AB 2ETZA 3OB2B 4K2RA 3VRZA 1JU5A 1O47A 5IBSA 1AB2A 3PFVA 1BG1A 1Y1UA 1UUSA 2IUIA 1A1AA 1CJ1A 1O4BA 4EY0A 5HKYA 2RVFA 2C0OA 5HKWA 5DF6A 5GJIA 1O4PA 3T04A 2EO3A 4M4ZA 3N7YA 2DLYA 1R1PA 1AOTF 1CWEA 3NHNA 1OPKA 2IUHA 3PQZA 4NWGA 2IZVA 5KAZA 2QMSA 2MQIA 3PS5A 3HIZB 3MXYA 3BUOB 4TZIA 3QWXX 3GQIB 3CXLA 1KA7A 1X27A 2GSBA 4EIHA 2EU0A 1SHBA 1O44A 1D1ZA 3LYVA 1AYCA 1IJRA 1D4WA 2HUWA 1AYDA 2OQ1A 2SRCA 1F2FA 1O4AA 2PNBA 4K45A 3IMDA 5AULA 4K11A 1O4MA 1I3ZA 2RSYA 3S8NA 4LUEA 1BHHB 4U1PA 2PLEA 4LUDA 4OHIA 1O4IA 2ECDA 4H34A 4F59A 1RQQC 1SPSA 1AOUF 4FBNA 2AOBA 4P9VA 3US4A 4D8KA 2CRHA 1O4NA 1IS0A 2LQNA 4DGXA 2CBLA 2Y1MA 4ROJA 1FBZA 2OZOA 1K9AA 1O4EA 2ABLA 3MXCA 1JYRA 1KC2A 4A4BA 1BMBA 3TL0A 1NZLA 1A1EA 2PNAA 3BUWB 1LUKA 5EHPA 4GPLB 2PLDA 1LUMA 2YU7A 3VRRA 1LCKA 2C0TA
chains in the Genus database with same CATH topology
2L6KA 1QADA 3GXWA 2DM0A 4GL9E 1QG1E 5DC0B 3N84A 1B47A 1O42A 1X0NA 1XA6A 2IUGA 1PICA 4F5BA 3VRQA 4L1BB 3ZNIA 1HCTB 2C9WA 4H1OA 3OP0A 3VGOA 5J3XA 3UYOA 2LCTA 1BKMA 2EYVA 1FMKA 2DX0A 3VROA 3VS5A 1O4DA 1BFIA 2MRKA 2EYZA 1KA6A 1O4HA 5DC9A 1NRVA 1O4LA 2H46E 3HHMB 2C0IA 3S8OA 3BUMB 3VRNA 3WA4A 1AD5A 2DCRA 3MAZA 2LNXA 2L4KA 2LQWA 2DLZA 1MW4A 3M7FA 1BKLA 1LKKA 4F5AA 2SHPA 2CIAA 4JEGA 1P13A 1SHDA 1UURA 5EELA 3VS4A 3VS0A 5AXIA 1JYQA 2AUGA 3UF4A 4XZ0A 2EO6A 2GE9A 2K79B 4X6SA 4GWFA 1LKLA 3VS6A 2EOBA 1F1WA 1M61A 1GRIA 1Y57A 3CBLA 3OV1A 5BO4A 1Z3KA 3CWGA 1GHUA 1AYAA 1JWOA 3OVEA 4WWQA 1A1BA 1BLKA 1X6CA 4E68A 3BUNB 1O46A 2JYQA 2BBUA 2FO0A 1WQUA 2MC1A 1RPYA 2VIFA 5GJHA 1O43A 4JGHA 1O4FA 1O48A 1YVHA 2CI9A 3OB1B 1D4TA 3PJPA 5EEQA 5D0JA 3BKBA 1AYBA 2CS0A 3PLFB 2MRJA 3K2MA 2H5KA 1H9OA 1KSWA 1TCEA 3KFJA 4E93A 4JE4A 1MILA 1LUNA 5DC4A 3VS1A 1A1CA 4QSYA 2LNWA 1CSYA 2B3OA 2RORA 3CD3A 1O4KA 1TZEE 3VS2A 1JYUA 1BLJA 5EHRA 1LUIA 2L3TA 3EAZA 4U17A 2EYYA 3IN7A 4OHLA 2K7AB 2MK2A 2HDVA 1O41A 3VS7A 1R1SA 3VRYA 1BF5A 1BM2A 1SPRA 1YVLA 2Y1NA 4NWFA 2YSXA 3C7IA 1FBVA 1A09A 1SKJA 2CR4A 2EKXA 3IMJA 3N8MA 4OHEA 3PSJA 2RMXA 1BHFA 5EG3B 1CWDL 1BFJA 2FCIA 2EL8A 1OO3A 1OO4A 1G83A 3TKZA 3S8LA 3VS3A 2XP1A 2AOAA 3GXXA 5IBMA 1O45A 3IN8A 1FU5A 4XZ1A 1R1QA 1M27A 4FL3A 1O4QA 2CI8A 1FYRA 4P9ZA 1HCSB 1QCFA 4OHHA 2HCKA 2KNOA 3VRPA 4K44A 1RJAA 5CDWA 1NZVA 1O4JA 1LCJA 5HKZA 1CSZA 2HDXA 2H8HA 1A07A 4A4CA 5I6VA 1O4RA 1BHHA 1FU6A 3QWYA 1SHAA 1O4CA 2PTKA 2HMHA 4OHDA 1O4GA 1ZFPE 4FL2A 1OPLA 1O4OA 2KK6A 3HCKA 3EACA 3PSKA 3BUXB 1O49A 2DVJA 1A81A 3S9KA 1FHSA 4DGPA 1A08A 2Y3AB 2ETZA 3OB2B 4K2RA 3VRZA 1JU5A 1O47A 5IBSA 1AB2A 3PFVA 1BG1A 1Y1UA 1UUSA 2IUIA 1A1AA 1CJ1A 1O4BA 4EY0A 5HKYA 2RVFA 2C0OA 5HKWA 5DF6A 5GJIA 1O4PA 3T04A 2EO3A 4M4ZA 3N7YA 2DLYA 1R1PA 1AOTF 1CWEA 3NHNA 1OPKA 2IUHA 3PQZA 4NWGA 2IZVA 5KAZA 2QMSA 2MQIA 3PS5A 3HIZB 3MXYA 3BUOB 4TZIA 3QWXX 3GQIB 3CXLA 1KA7A 1X27A 2GSBA 4EIHA 2EU0A 1SHBA 1O44A 1D1ZA 1AYCA 1IJRA 1D4WA 2HUWA 1AYDA 2OQ1A 2SRCA 1F2FA 1O4AA 2PNBA 4K45A 3IMDA 5AULA 4K11A 1O4MA 1I3ZA 2RSYA 3S8NA 4LUEA 1BHHB 4U1PA 2PLEA 4LUDA 4OHIA 1O4IA 2ECDA 4H34A 4F59A 1RQQC 1SPSA 1AOUF 4FBNA 2AOBA 4P9VA 3US4A 4D8KA 2CRHA 1O4NA 1IS0A 2LQNA 4DGXA 2CBLA 2Y1MA 4ROJA 1FBZA 2OZOA 1K9AA 1O4EA 2ABLA 3MXCA 1JYRA 1KC2A 4A4BA 1BMBA 3TL0A 1NZLA 1A1EA 2PNAA 3BUWB 1LUKA 5EHPA 4GPLB 2PLDA 1LUMA 2YU7A 3VRRA 1LCKA 2C0TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L6K A;  1QAD A;  3GXW A;  2DM0 A;  4GL9 E;  1QG1 E;  5DC0 B;  3N84 A;  1B47 A;  1O42 A;  1X0N A;  1XA6 A;  2IUG A;  1PIC A;  4F5B A;  3VRQ A;  4L1B B;  3ZNI A;  1HCT B;  2C9W A;  4H1O A;  3OP0 A;  3VGO A;  5J3X A;  3UYO A;  2LCT A;  1BKM A;  2EYV A;  1FMK A;  2DX0 A;  3VRO A;  3VS5 A;  1O4D A;  1BFI A;  2MRK A;  2EYZ A;  1KA6 A;  1O4H A;  5DC9 A;  1NRV A;  1O4L A;  2H46 E;  3HHM B;  2C0I A;  3S8O A;  3BUM B;  3VRN A;  3WA4 A;  1AD5 A;  2DCR A;  3MAZ A;  2LNX A;  2L4K A;  2LQW A;  2DLZ A;  1MW4 A;  3M7F A;  1BKL A;  1LKK A;  4F5A A;  2SHP A;  2CIA A;  4JEG A;  1P13 A;  1SHD A;  1UUR A;  5EEL A;  3VS4 A;  3VS0 A;  5AXI A;  1JYQ A;  2AUG A;  3UF4 A;  4XZ0 A;  2EO6 A;  2GE9 A;  2K79 B;  4X6S A;  4GWF A;  1LKL A;  3VS6 A;  2EOB A;  1F1W A;  1M61 A;  1GRI A;  1Y57 A;  3CBL A;  3OV1 A;  5BO4 A;  1Z3K A;  3CWG A;  1GHU A;  1AYA A;  1JWO A;  3OVE A;  4WWQ A;  1A1B A;  1BLK A;  1X6C A;  4E68 A;  3BUN B;  1O46 A;  2JYQ A;  2BBU A;  2FO0 A;  1WQU A;  2MC1 A;  1RPY A;  2VIF A;  5GJH A;  1O43 A;  4JGH A;  1O4F A;  1O48 A;  1YVH A;  2CI9 A;  3OB1 B;  1D4T A;  3PJP A;  5EEQ A;  5D0J A;  3BKB A;  1AYB A;  2CS0 A;  3PLF B;  2MRJ A;  3K2M A;  2H5K A;  1H9O A;  1KSW A;  1TCE A;  3KFJ A;  4E93 A;  4JE4 A;  1MIL A;  1LUN A;  5DC4 A;  3VS1 A;  1A1C A;  4QSY A;  2LNW A;  1CSY A;  2B3O A;  2ROR A;  3CD3 A;  1O4K A;  1TZE E;  3VS2 A;  1JYU A;  1BLJ A;  5EHR A;  1LUI A;  2L3T A;  3EAZ A;  4U17 A;  2EYY A;  3IN7 A;  4OHL A;  2K7A B;  2MK2 A;  2HDV A;  1O41 A;  3VS7 A;  1R1S A;  3VRY A;  1BF5 A;  1BM2 A;  1SPR A;  1YVL A;  2Y1N A;  4NWF A;  2YSX A;  3C7I A;  1FBV A;  1A09 A;  1SKJ A;  2CR4 A;  2EKX A;  3IMJ A;  3N8M A;  4OHE A;  3PSJ A;  2RMX A;  1BHF A;  5EG3 B;  1CWD L;  1BFJ A;  2FCI A;  2EL8 A;  1OO3 A;  1OO4 A;  1G83 A;  3TKZ A;  3S8L A;  3VS3 A;  2XP1 A;  2AOA A;  3GXX A;  5IBM A;  1O45 A;  3IN8 A;  1FU5 A;  4XZ1 A;  1R1Q A;  1M27 A;  4FL3 A;  1O4Q A;  2CI8 A;  1FYR A;  4P9Z A;  1HCS B;  1QCF A;  4OHH A;  2HCK A;  2KNO A;  3VRP A;  4K44 A;  1RJA A;  5CDW A;  1NZV A;  1O4J A;  1LCJ A;  5HKZ A;  1CSZ A;  2HDX A;  2H8H A;  1A07 A;  4A4C A;  5I6V A;  1O4R A;  1BHH A;  1FU6 A;  3QWY A;  1SHA A;  1O4C A;  2PTK A;  2HMH A;  4OHD A;  1O4G A;  1ZFP E;  4FL2 A;  1OPL A;  1O4O A;  2KK6 A;  3HCK A;  3EAC A;  3PSK A;  3BUX B;  1O49 A;  2DVJ A;  1A81 A;  3S9K A;  1FHS A;  4DGP A;  1A08 A;  2Y3A B;  2ETZ A;  3OB2 B;  4K2R A;  3VRZ A;  1JU5 A;  1O47 A;  5IBS A;  1AB2 A;  3PFV A;  1BG1 A;  1Y1U A;  1UUS A;  2IUI A;  1A1A A;  1CJ1 A;  1O4B A;  4EY0 A;  5HKY A;  2RVF A;  2C0O A;  5HKW A;  5DF6 A;  5GJI A;  1O4P A;  3T04 A;  2EO3 A;  4M4Z A;  3N7Y A;  2DLY A;  1R1P A;  1AOT F;  1CWE A;  3NHN A;  1OPK A;  2IUH A;  3PQZ A;  4NWG A;  2IZV A;  5KAZ A;  2QMS A;  2MQI A;  3PS5 A;  3HIZ B;  3MXY A;  3BUO B;  4TZI A;  3QWX X;  3GQI B;  3CXL A;  1KA7 A;  1X27 A;  2GSB A;  4EIH A;  2EU0 A;  1SHB A;  1O44 A;  1D1Z A;  1AYC A;  1IJR A;  1D4W A;  2HUW A;  1AYD A;  2OQ1 A;  2SRC A;  1F2F A;  1O4A A;  2PNB A;  4K45 A;  3IMD A;  5AUL A;  4K11 A;  1O4M A;  1I3Z A;  2RSY A;  3S8N A;  4LUE A;  1BHH B;  4U1P A;  2PLE A;  4LUD A;  4OHI A;  1O4I A;  2ECD A;  4H34 A;  4F59 A;  1RQQ C;  1SPS A;  1AOU F;  4FBN A;  2AOB A;  4P9V A;  3US4 A;  4D8K A;  2CRH A;  1O4N A;  1IS0 A;  2LQN A;  4DGX A;  2CBL A;  2Y1M A;  4ROJ A;  1FBZ A;  2OZO A;  1K9A A;  1O4E A;  2ABL A;  3MXC A;  1JYR A;  1KC2 A;  4A4B A;  1BMB A;  3TL0 A;  1NZL A;  1A1E A;  2PNA A;  3BUW B;  1LUK A;  5EHP A;  4GPL B;  2PLD A;  1LUM A;  2YU7 A;  3VRR A;  1LCK A;  2C0T A; 
#chains in the Genus database with same CATH topology
 2L6K A;  1QAD A;  3GXW A;  2DM0 A;  4GL9 E;  1QG1 E;  5DC0 B;  3N84 A;  1B47 A;  1O42 A;  1X0N A;  1XA6 A;  2IUG A;  1PIC A;  4F5B A;  3VRQ A;  4L1B B;  3ZNI A;  1HCT B;  2C9W A;  4H1O A;  3OP0 A;  3VGO A;  5J3X A;  3UYO A;  2LCT A;  1BKM A;  2EYV A;  1FMK A;  2DX0 A;  3VRO A;  3VS5 A;  1O4D A;  1BFI A;  2MRK A;  2EYZ A;  1KA6 A;  1O4H A;  5DC9 A;  1NRV A;  1O4L A;  2H46 E;  3HHM B;  2C0I A;  3S8O A;  3BUM B;  3VRN A;  3WA4 A;  1AD5 A;  2DCR A;  3MAZ A;  2LNX A;  2L4K A;  2LQW A;  2DLZ A;  1MW4 A;  3M7F A;  1BKL A;  1LKK A;  4F5A A;  2LRA A;  2SHP A;  2CIA A;  4JEG A;  1P13 A;  1SHD A;  1UUR A;  5EEL A;  3VS4 A;  3VS0 A;  5AXI A;  1JYQ A;  2AUG A;  3UF4 A;  4XZ0 A;  2EO6 A;  2GE9 A;  2K79 B;  4X6S A;  4GWF A;  1LKL A;  3VS6 A;  2EOB A;  1F1W A;  1M61 A;  1GRI A;  1Y57 A;  3CBL A;  3OV1 A;  5BO4 A;  1Z3K A;  3CWG A;  1GHU A;  1AYA A;  1JWO A;  3OVE A;  4WWQ A;  1A1B A;  1BLK A;  1X6C A;  4E68 A;  3BUN B;  1O46 A;  2JYQ A;  2BBU A;  2FO0 A;  1WQU A;  2MC1 A;  1RPY A;  2VIF A;  5GJH A;  1O43 A;  4JGH A;  1O4F A;  1O48 A;  1YVH A;  2CI9 A;  3OB1 B;  1D4T A;  3PJP A;  5EEQ A;  5D0J A;  3BKB A;  1AYB A;  2CS0 A;  3PLF B;  2MRJ A;  2KGY A;  3K2M A;  2H5K A;  1H9O A;  1KSW A;  1TCE A;  3KFJ A;  4E93 A;  4JE4 A;  1MIL A;  1LUN A;  5DC4 A;  3VS1 A;  1A1C A;  4QSY A;  2LNW A;  1CSY A;  2B3O A;  2ROR A;  3CD3 A;  1O4K A;  1TZE E;  3VS2 A;  1JYU A;  1BLJ A;  5EHR A;  1LUI A;  2L3T A;  3EAZ A;  4U17 A;  2EYY A;  3IN7 A;  4OHL A;  2K7A B;  2MK2 A;  2HDV A;  1O41 A;  3VS7 A;  1R1S A;  3VRY A;  1BF5 A;  1BM2 A;  1SPR A;  1YVL A;  2Y1N A;  4NWF A;  2YSX A;  3C7I A;  1FBV A;  1A09 A;  1SKJ A;  2CR4 A;  2EKX A;  3IMJ A;  3N8M A;  4OHE A;  3PSJ A;  2RMX A;  1BHF A;  5EG3 B;  1CWD L;  1BFJ A;  2FCI A;  2EL8 A;  1OO3 A;  1OO4 A;  1G83 A;  3TKZ A;  3S8L A;  3VS3 A;  2XP1 A;  2AOA A;  3GXX A;  5IBM A;  1O45 A;  3IN8 A;  1FU5 A;  4XZ1 A;  1R1Q A;  1M27 A;  4FL3 A;  1O4Q A;  2CI8 A;  1FYR A;  4P9Z A;  1HCS B;  1QCF A;  4OHH A;  2HCK A;  2KNO A;  3VRP A;  4K44 A;  1RJA A;  5CDW A;  1NZV A;  1O4J A;  1LCJ A;  5HKZ A;  1CSZ A;  2HDX A;  2H8H A;  1A07 A;  4A4C A;  5I6V A;  1O4R A;  3K2T A;  1BHH A;  1FU6 A;  3QWY A;  1SHA A;  1O4C A;  2PTK A;  2HMH A;  4OHD A;  1O4G A;  1ZFP E;  4FL2 A;  1OPL A;  1O4O A;  2KK6 A;  3HCK A;  3EAC A;  3PSK A;  3BUX B;  1O49 A;  2DVJ A;  1A81 A;  3S9K A;  1FHS A;  4DGP A;  1A08 A;  2Y3A B;  2ETZ A;  3OB2 B;  4K2R A;  3VRZ A;  1JU5 A;  1O47 A;  5IBS A;  1AB2 A;  3PFV A;  1BG1 A;  1Y1U A;  1UUS A;  2IUI A;  1A1A A;  1CJ1 A;  1O4B A;  4EY0 A;  5HKY A;  2RVF A;  2C0O A;  5HKW A;  5DF6 A;  5GJI A;  1O4P A;  3T04 A;  2EO3 A;  4M4Z A;  3N7Y A;  2DLY A;  1R1P A;  1AOT F;  1CWE A;  3NHN A;  1OPK A;  2IUH A;  3PQZ A;  4NWG A;  2IZV A;  5KAZ A;  2QMS A;  2MQI A;  3PS5 A;  3HIZ B;  3MXY A;  3BUO B;  4TZI A;  3QWX X;  3GQI B;  3CXL A;  1KA7 A;  1X27 A;  2GSB A;  4EIH A;  2EU0 A;  1SHB A;  1O44 A;  1D1Z A;  3LYV A;  1AYC A;  1IJR A;  1D4W A;  2HUW A;  1AYD A;  2OQ1 A;  2SRC A;  1F2F A;  1O4A A;  2PNB A;  4K45 A;  3IMD A;  5AUL A;  4K11 A;  1O4M A;  1I3Z A;  2RSY A;  3S8N A;  4LUE A;  1BHH B;  4U1P A;  2PLE A;  4LUD A;  4OHI A;  1O4I A;  2ECD A;  4H34 A;  4F59 A;  1RQQ C;  1SPS A;  1AOU F;  4FBN A;  2AOB A;  4P9V A;  3US4 A;  4D8K A;  2CRH A;  1O4N A;  1IS0 A;  2LQN A;  4DGX A;  2CBL A;  2Y1M A;  4ROJ A;  1FBZ A;  2OZO A;  1K9A A;  1O4E A;  2ABL A;  3MXC A;  1JYR A;  1KC2 A;  4A4B A;  1BMB A;  3TL0 A;  1NZL A;  1A1E A;  2PNA A;  3BUW B;  1LUK A;  5EHP A;  4GPL B;  2PLD A;  1LUM A;  2YU7 A;  3VRR A;  1LCK A;  2C0T A; 
#chains in the Genus database with same CATH homology
 2L6K A;  1QAD A;  3GXW A;  2DM0 A;  4GL9 E;  1QG1 E;  5DC0 B;  3N84 A;  1B47 A;  1O42 A;  1X0N A;  1XA6 A;  2IUG A;  1PIC A;  4F5B A;  3VRQ A;  4L1B B;  3ZNI A;  1HCT B;  2C9W A;  4H1O A;  3OP0 A;  3VGO A;  5J3X A;  3UYO A;  2LCT A;  1BKM A;  2EYV A;  1FMK A;  2DX0 A;  3VRO A;  3VS5 A;  1O4D A;  1BFI A;  2MRK A;  2EYZ A;  1KA6 A;  1O4H A;  5DC9 A;  1NRV A;  1O4L A;  2H46 E;  3HHM B;  2C0I A;  3S8O A;  3BUM B;  3VRN A;  3WA4 A;  1AD5 A;  2DCR A;  3MAZ A;  2LNX A;  2L4K A;  2LQW A;  2DLZ A;  1MW4 A;  3M7F A;  1BKL A;  1LKK A;  4F5A A;  2SHP A;  2CIA A;  4JEG A;  1P13 A;  1SHD A;  1UUR A;  5EEL A;  3VS4 A;  3VS0 A;  5AXI A;  1JYQ A;  2AUG A;  3UF4 A;  4XZ0 A;  2EO6 A;  2GE9 A;  2K79 B;  4X6S A;  4GWF A;  1LKL A;  3VS6 A;  2EOB A;  1F1W A;  1M61 A;  1GRI A;  1Y57 A;  3CBL A;  3OV1 A;  5BO4 A;  1Z3K A;  3CWG A;  1GHU A;  1AYA A;  1JWO A;  3OVE A;  4WWQ A;  1A1B A;  1BLK A;  1X6C A;  4E68 A;  3BUN B;  1O46 A;  2JYQ A;  2BBU A;  2FO0 A;  1WQU A;  2MC1 A;  1RPY A;  2VIF A;  5GJH A;  1O43 A;  4JGH A;  1O4F A;  1O48 A;  1YVH A;  2CI9 A;  3OB1 B;  1D4T A;  3PJP A;  5EEQ A;  5D0J A;  3BKB A;  1AYB A;  2CS0 A;  3PLF B;  2MRJ A;  3K2M A;  2H5K A;  1H9O A;  1KSW A;  1TCE A;  3KFJ A;  4E93 A;  4JE4 A;  1MIL A;  1LUN A;  5DC4 A;  3VS1 A;  1A1C A;  4QSY A;  2LNW A;  1CSY A;  2B3O A;  2ROR A;  3CD3 A;  1O4K A;  1TZE E;  3VS2 A;  1JYU A;  1BLJ A;  5EHR A;  1LUI A;  2L3T A;  3EAZ A;  4U17 A;  2EYY A;  3IN7 A;  4OHL A;  2K7A B;  2MK2 A;  2HDV A;  1O41 A;  3VS7 A;  1R1S A;  3VRY A;  1BF5 A;  1BM2 A;  1SPR A;  1YVL A;  2Y1N A;  4NWF A;  2YSX A;  3C7I A;  1FBV A;  1A09 A;  1SKJ A;  2CR4 A;  2EKX A;  3IMJ A;  3N8M A;  4OHE A;  3PSJ A;  2RMX A;  1BHF A;  5EG3 B;  1CWD L;  1BFJ A;  2FCI A;  2EL8 A;  1OO3 A;  1OO4 A;  1G83 A;  3TKZ A;  3S8L A;  3VS3 A;  2XP1 A;  2AOA A;  3GXX A;  5IBM A;  1O45 A;  3IN8 A;  1FU5 A;  4XZ1 A;  1R1Q A;  1M27 A;  4FL3 A;  1O4Q A;  2CI8 A;  1FYR A;  4P9Z A;  1HCS B;  1QCF A;  4OHH A;  2HCK A;  2KNO A;  3VRP A;  4K44 A;  1RJA A;  5CDW A;  1NZV A;  1O4J A;  1LCJ A;  5HKZ A;  1CSZ A;  2HDX A;  2H8H A;  1A07 A;  4A4C A;  5I6V A;  1O4R A;  1BHH A;  1FU6 A;  3QWY A;  1SHA A;  1O4C A;  2PTK A;  2HMH A;  4OHD A;  1O4G A;  1ZFP E;  4FL2 A;  1OPL A;  1O4O A;  2KK6 A;  3HCK A;  3EAC A;  3PSK A;  3BUX B;  1O49 A;  2DVJ A;  1A81 A;  3S9K A;  1FHS A;  4DGP A;  1A08 A;  2Y3A B;  2ETZ A;  3OB2 B;  4K2R A;  3VRZ A;  1JU5 A;  1O47 A;  5IBS A;  1AB2 A;  3PFV A;  1BG1 A;  1Y1U A;  1UUS A;  2IUI A;  1A1A A;  1CJ1 A;  1O4B A;  4EY0 A;  5HKY A;  2RVF A;  2C0O A;  5HKW A;  5DF6 A;  5GJI A;  1O4P A;  3T04 A;  2EO3 A;  4M4Z A;  3N7Y A;  2DLY A;  1R1P A;  1AOT F;  1CWE A;  3NHN A;  1OPK A;  2IUH A;  3PQZ A;  4NWG A;  2IZV A;  5KAZ A;  2QMS A;  2MQI A;  3PS5 A;  3HIZ B;  3MXY A;  3BUO B;  4TZI A;  3QWX X;  3GQI B;  3CXL A;  1KA7 A;  1X27 A;  2GSB A;  4EIH A;  2EU0 A;  1SHB A;  1O44 A;  1D1Z A;  1AYC A;  1IJR A;  1D4W A;  2HUW A;  1AYD A;  2OQ1 A;  2SRC A;  1F2F A;  1O4A A;  2PNB A;  4K45 A;  3IMD A;  5AUL A;  4K11 A;  1O4M A;  1I3Z A;  2RSY A;  3S8N A;  4LUE A;  1BHH B;  4U1P A;  2PLE A;  4LUD A;  4OHI A;  1O4I A;  2ECD A;  4H34 A;  4F59 A;  1RQQ C;  1SPS A;  1AOU F;  4FBN A;  2AOB A;  4P9V A;  3US4 A;  4D8K A;  2CRH A;  1O4N A;  1IS0 A;  2LQN A;  4DGX A;  2CBL A;  2Y1M A;  4ROJ A;  1FBZ A;  2OZO A;  1K9A A;  1O4E A;  2ABL A;  3MXC A;  1JYR A;  1KC2 A;  4A4B A;  1BMB A;  3TL0 A;  1NZL A;  1A1E A;  2PNA A;  3BUW B;  1LUK A;  5EHP A;  4GPL B;  2PLD A;  1LUM A;  2YU7 A;  3VRR A;  1LCK A;  2C0T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...