2OQ1A

Tandem sh2 domains of zap-70 with 19-mer zeta1 peptide
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
254
structure length
254
Chain Sequence
DPAAHLPFFYGSISRAEAEEHLKLAGMADGLFLLRQCLRSLGGYVLSLVHDVRFHHFPIERQLNGTYAIAGGKAHCGPAELCEFYSRDPDGLPCNLRKPCNRPSGLEPQPGVFDCLRDAMVRDYVRQTWKLEGEALEQAIISQAPQVEKLIATTAHERMPWYHSSLTREEAERKLYSGAQTDGKFLLRPRKEQGTYALSLIYGKTVYHYLISQDKAGKYCIPEGTKFDTLWQLVEYLKLKADGLIYCLKEACPN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tyrosine-protein kinase ZAP-70
publication title Molecular basis for the interaction of ZAP-70 with the T-cell receptor
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 65
structure length 254
sequence length 254
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2007-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00017 SH2 SH2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.930.10 Mainly Alpha Orthogonal Bundle Syk Kinase; Chain A, domain 2 Syk Kinase; Chain A, domain 2 2oq1A02
3.30.505.10 Alpha Beta 2-Layer Sandwich SHC Adaptor Protein SH2 domain 2oq1A03
3.30.505.10 Alpha Beta 2-Layer Sandwich SHC Adaptor Protein SH2 domain 2oq1A01
3WA4A 4OHDA 1HCSB 1RQQC 1TZEE 1O46A 3VRNA 1AOTF 3TL0A 2MC1A 5DC4A 2CS0A 3QWXX 2HUWA 5I6VA 1UURA 4P9ZA 1O44A 1F1WA 5EEQA 1BLJA 1TCEA 4LUEA 4OHEA 2MK2A 5IBMA 1SHDA 2LQWA 2FCIA 1F2FA 1LKLA 4H34A 3BUNB 3VRPA 3VGOA 4OHLA 2K7AB 1O4JA 5CDWA 1QCFA 1O4EA 1Z3KA 4XZ1A 2H5KA 1IS0A 1SHBA 1CSZA 4K11A 5IBSA 1CJ1A 1O4BA 1X0NA 1SKJA 3VS4A 1LUMA 3PSJA 4FL3A 3VS2A 3S9KA 5HKYA 1O4LA 1P13A 1LUKA 1JWOA 4OHIA 2DLYA 1X27A 3BUOB 3M7FA 1FBVA 2H46E 1FU6A 5AULA 3N8MA 3OP0A 1A1CA 2L3TA 4M4ZA 4A4BA 3UF4A 5EHPA 2EYVA 1MW4A 2GSBA 5J3XA 4K45A 1O4RA 4ROJA 1O4FA 4FL2A 2EYYA 1AYAA 1B47A 2LCTA 1X6CA 2SRCA 3GXWA 5AXIA 1FMKA 1A81A 1AOUF 1O41A 1M27A 1KC2A 1K9AA 4E68A 1ZFPE 1KSWA 1R1QA 1FHSA 2B3OA 1YVLA 5EELA 1I3ZA 1LUNA 2KK6A 4GPLB 3PSKA 3T04A 4U17A 4L1BB 1GHUA 2HMHA 3NHNA 1O4CA 3VRZA 2YSXA 1AB2A 3N7YA 4H1OA 2IUHA 2LNXA 1BG1A 3UYOA 3OB1B 2HCKA 1G83A 1JYRA 3HCKA 5HKWA 5BO4A 3EACA 2VIFA 4OHHA 1GRIA 1O42A 3VS3A 2C0OA 1LKKA 1O43A 1BFIA 1SPSA 4X6SA 2PTKA 1XA6A 3PLFB 1BFJA 2JYQA 1AYBA 3PS5A 3VS5A 2MRKA 1LCJA 3TKZA 2CBLA 2DVJA 3IN7A 1RJAA 3BUWB 1O4MA 2CI9A 4F59A 1CWEA 1O4QA 3MAZA 2PLDA 1OO3A 2RVFA 2BBUA 2CI8A 3S8LA 4F5AA 2RORA 1BM2A 2PLEA 4NWFA 3HHMB 1O45A 2IZVA 3BUXB 3MXCA 2CR4A 1BMBA 1YVHA 1R1PA 4U1PA 2LQNA 2ABLA 3KFJA 2HDVA 1LUIA 3QWYA 3GXXA 2IUGA 5GJIA 3MXYA 1OO4A 4QSYA 1FYRA 4DGPA 2K79B 2PNAA 2EOBA 4JE4A 5GJHA 1MILA 4NWGA 3VRQA 3K2MA 3PQZA 1O4OA 4A4CA 4K44A 1KA7A 1BKMA 1O4IA 1A1BA 3VS6A 1JYUA 5KAZA 4EY0A 1FBZA 1JU5A 2RMXA 4E93A 4FBNA 1OPKA 2IUIA 3US4A 1UUSA 2EKXA 3C7IA 1QG1E 2KNOA 5DC9A 4XZ0A 3EAZA 4K2RA 1O4PA 1SPRA 4WWQA 1AYDA 2XP1A 1R1SA 1O4NA 1Y57A 2DM0A 3IMJA 1BHHB 1D4WA 3CBLA 1O4HA 1BHFA 2H8HA 1O4GA 1WQUA 3VS0A 3VS1A 1A1AA 3BUMB 3GQIB 3IN8A 3ZNIA 4GL9E 5D0JA 1FU5A 1O49A 2OQ1A 1O4DA 2MQIA 3BKBA 2EL8A 1NRVA 2AUGA 2L4KA 4TZIA 1O48A 1SHAA 4DGXA 1KA6A 1AD5A 2YU7A 1BHHA 5HKZA 1A09A 1BLKA 1AYCA 2Y1NA 1D1ZA 1NZLA 3S8NA 2EO6A 2ECDA 2C9WA 2PNBA 4EIHA 1Y1UA 5DF6A 5EHRA 3CWGA 2CIAA 4JEGA 1HCTB 4D8KA 1IJRA 3CD3A 5DC0B 1JYQA 1RPYA 1A1EA 2C0TA 1PICA 2DX0A 2ETZA 1LCKA 3S8OA 2DCRA 1QADA 1O4AA 3VRRA 2RSYA 3VRYA 2HDXA 2L6KA 2LNWA 2QMSA 1BKLA 2MRJA 4GWFA 2AOAA 2AOBA 2Y1MA 2CRHA 1CSYA 1CWDL 2DLZA 3PFVA 1O47A 1O4KA 1A08A 3OVEA 4JGHA 3N84A 2GE9A 1A07A 3HIZB 2SHPA 4LUDA 5EG3B 3OV1A 4P9VA 1D4TA 1BF5A 2EU0A 3PJPA 1H9OA 3OB2B 2OZOA 2FO0A 2EYZA 1OPLA 3IMDA 1NZVA 3VROA 1M61A 2EO3A 3CXLA 3VS7A 2C0IA 2Y3AB 4F5BA
chains in the Genus database with same CATH superfamily
3WA4A 4OHDA 1HCSB 1RQQC 1TZEE 1O46A 3VRNA 1AOTF 3TL0A 2MC1A 5DC4A 2CS0A 3QWXX 2HUWA 5I6VA 1UURA 4P9ZA 1O44A 1F1WA 5EEQA 1BLJA 1TCEA 4LUEA 4OHEA 2MK2A 5IBMA 1SHDA 2LQWA 2FCIA 1F2FA 1LKLA 4H34A 3BUNB 3VRPA 3VGOA 4OHLA 2K7AB 1O4JA 5CDWA 1QCFA 1O4EA 1Z3KA 4XZ1A 2H5KA 1IS0A 1SHBA 1CSZA 4K11A 5IBSA 1CJ1A 1O4BA 1X0NA 1SKJA 3VS4A 1LUMA 3PSJA 4FL3A 3VS2A 3S9KA 5HKYA 1O4LA 1P13A 1LUKA 1JWOA 4OHIA 2DLYA 1X27A 3BUOB 3M7FA 1FBVA 2H46E 1FU6A 5AULA 3N8MA 3OP0A 1A1CA 2L3TA 4M4ZA 4A4BA 3UF4A 5EHPA 2EYVA 1MW4A 2GSBA 5J3XA 4K45A 1O4RA 4ROJA 1O4FA 4FL2A 2EYYA 1AYAA 1B47A 2LCTA 1X6CA 2SRCA 3GXWA 5AXIA 1FMKA 1A81A 1AOUF 1O41A 1M27A 1KC2A 1K9AA 4E68A 1ZFPE 2LRAA 1KSWA 1R1QA 1FHSA 2B3OA 1YVLA 5EELA 1I3ZA 1LUNA 2KK6A 4GPLB 3PSKA 3T04A 4U17A 4L1BB 1GHUA 2HMHA 3NHNA 1O4CA 3VRZA 2YSXA 1AB2A 3N7YA 4H1OA 2IUHA 2LNXA 1BG1A 3UYOA 3OB1B 2HCKA 1G83A 1JYRA 3HCKA 5HKWA 5BO4A 3EACA 2VIFA 4OHHA 1GRIA 1O42A 3VS3A 3K2TA 2C0OA 1LKKA 1O43A 1BFIA 1SPSA 4X6SA 2PTKA 1XA6A 3PLFB 1BFJA 2JYQA 1AYBA 3PS5A 3VS5A 2MRKA 1LCJA 3TKZA 2CBLA 2DVJA 3IN7A 1RJAA 3BUWB 1O4MA 2CI9A 4F59A 1CWEA 1O4QA 3MAZA 2PLDA 1OO3A 2RVFA 2BBUA 2CI8A 3S8LA 4F5AA 2RORA 1BM2A 2PLEA 4NWFA 3HHMB 1O45A 2IZVA 3BUXB 3MXCA 2CR4A 1BMBA 1YVHA 1R1PA 4U1PA 2LQNA 2ABLA 3KFJA 2HDVA 1LUIA 3QWYA 3GXXA 2IUGA 5GJIA 3MXYA 1OO4A 4QSYA 1FYRA 4DGPA 2K79B 2PNAA 2EOBA 4JE4A 5GJHA 1MILA 4NWGA 3VRQA 3K2MA 3PQZA 1O4OA 3LYVA 4A4CA 4K44A 1KA7A 1BKMA 1O4IA 1A1BA 3VS6A 1JYUA 5KAZA 4EY0A 1FBZA 1JU5A 2RMXA 4E93A 4FBNA 1OPKA 2IUIA 3US4A 1UUSA 2EKXA 3C7IA 1QG1E 2KNOA 5DC9A 4XZ0A 3EAZA 2KGYA 4K2RA 1O4PA 1SPRA 4WWQA 1AYDA 2XP1A 1R1SA 1O4NA 1Y57A 2DM0A 3IMJA 1BHHB 1D4WA 3CBLA 1O4HA 1BHFA 2H8HA 1O4GA 1WQUA 3VS0A 3VS1A 1A1AA 3BUMB 3GQIB 3IN8A 3ZNIA 4GL9E 5D0JA 1FU5A 1O49A 2OQ1A 1O4DA 2MQIA 3BKBA 2EL8A 1NRVA 2AUGA 2L4KA 4TZIA 1O48A 1SHAA 4DGXA 1KA6A 1AD5A 2YU7A 1BHHA 5HKZA 1A09A 1BLKA 1AYCA 2Y1NA 1D1ZA 1NZLA 3S8NA 2EO6A 2ECDA 2C9WA 2PNBA 4EIHA 1Y1UA 5DF6A 5EHRA 3CWGA 2CIAA 4JEGA 1HCTB 4D8KA 1IJRA 3CD3A 5DC0B 1JYQA 1RPYA 1A1EA 2C0TA 1PICA 2DX0A 2ETZA 1LCKA 3S8OA 2DCRA 1QADA 1O4AA 3VRRA 2RSYA 3VRYA 2HDXA 2L6KA 2LNWA 2QMSA 1BKLA 2MRJA 4GWFA 2AOAA 2AOBA 2Y1MA 2CRHA 1CSYA 1CWDL 2DLZA 3PFVA 1O47A 1O4KA 1A08A 3OVEA 4JGHA 3N84A 2GE9A 1A07A 3HIZB 2SHPA 4LUDA 5EG3B 3OV1A 4P9VA 1D4TA 1BF5A 2EU0A 3PJPA 1H9OA 3OB2B 2OZOA 2FO0A 2EYZA 1OPLA 3IMDA 1NZVA 3VROA 1M61A 2EO3A 3CXLA 3VS7A 2C0IA 2Y3AB 4F5BA
chains in the Genus database with same CATH topology
3WA4A 4OHDA 1HCSB 1RQQC 1TZEE 1O46A 3VRNA 1AOTF 3TL0A 2MC1A 5DC4A 2CS0A 3QWXX 2HUWA 5I6VA 1UURA 4P9ZA 1O44A 1F1WA 5EEQA 1BLJA 1TCEA 4LUEA 4OHEA 2MK2A 5IBMA 1SHDA 2LQWA 2FCIA 1F2FA 1LKLA 4H34A 3BUNB 3VRPA 3VGOA 4OHLA 2K7AB 1O4JA 5CDWA 1QCFA 1O4EA 1Z3KA 4XZ1A 2H5KA 1IS0A 1SHBA 1CSZA 4K11A 5IBSA 1CJ1A 1O4BA 1X0NA 1SKJA 3VS4A 1LUMA 3PSJA 4FL3A 3VS2A 3S9KA 5HKYA 1O4LA 1P13A 1LUKA 1JWOA 4OHIA 2DLYA 1X27A 3BUOB 3M7FA 1FBVA 2H46E 1FU6A 5AULA 3N8MA 3OP0A 1A1CA 2L3TA 4M4ZA 4A4BA 3UF4A 5EHPA 2EYVA 1MW4A 2GSBA 5J3XA 4K45A 1O4RA 4ROJA 1O4FA 4FL2A 2EYYA 1AYAA 1B47A 2LCTA 1X6CA 2SRCA 3GXWA 5AXIA 1FMKA 1A81A 1AOUF 1O41A 1M27A 1KC2A 1K9AA 4E68A 1ZFPE 1KSWA 1R1QA 1FHSA 2B3OA 1YVLA 5EELA 1I3ZA 1LUNA 2KK6A 4GPLB 3PSKA 3T04A 4U17A 4L1BB 1GHUA 2HMHA 3NHNA 1O4CA 3VRZA 2YSXA 1AB2A 3N7YA 4H1OA 2IUHA 2LNXA 1BG1A 3UYOA 3OB1B 2HCKA 1G83A 1JYRA 3HCKA 5HKWA 5BO4A 3EACA 2VIFA 4OHHA 1GRIA 1O42A 3VS3A 2C0OA 1LKKA 1O43A 1BFIA 1SPSA 4X6SA 2PTKA 1XA6A 3PLFB 1BFJA 2JYQA 1AYBA 3PS5A 3VS5A 2MRKA 1LCJA 3TKZA 2CBLA 2DVJA 3IN7A 1RJAA 3BUWB 1O4MA 2CI9A 4F59A 1CWEA 1O4QA 3MAZA 2PLDA 1OO3A 2RVFA 2BBUA 2CI8A 3S8LA 4F5AA 2RORA 1BM2A 2PLEA 4NWFA 3HHMB 1O45A 2IZVA 3BUXB 3MXCA 2CR4A 1BMBA 1YVHA 1R1PA 4U1PA 2LQNA 2ABLA 3KFJA 2HDVA 1LUIA 3QWYA 3GXXA 2IUGA 5GJIA 3MXYA 1OO4A 4QSYA 1FYRA 4DGPA 2K79B 2PNAA 2EOBA 4JE4A 5GJHA 1MILA 4NWGA 3VRQA 3K2MA 3PQZA 1O4OA 4A4CA 4K44A 1KA7A 1BKMA 1O4IA 1A1BA 3VS6A 1JYUA 5KAZA 4EY0A 1FBZA 1JU5A 2RMXA 4E93A 4FBNA 1OPKA 2IUIA 3US4A 1UUSA 2EKXA 3C7IA 1QG1E 2KNOA 5DC9A 4XZ0A 3EAZA 4K2RA 1O4PA 1SPRA 4WWQA 1AYDA 2XP1A 1R1SA 1O4NA 1Y57A 2DM0A 3IMJA 1BHHB 1D4WA 3CBLA 1O4HA 1BHFA 2H8HA 1O4GA 1WQUA 3VS0A 3VS1A 1A1AA 3BUMB 3GQIB 3IN8A 3ZNIA 4GL9E 5D0JA 1FU5A 1O49A 2OQ1A 1O4DA 2MQIA 3BKBA 2EL8A 1NRVA 2AUGA 2L4KA 4TZIA 1O48A 1SHAA 4DGXA 1KA6A 1AD5A 2YU7A 1BHHA 5HKZA 1A09A 1BLKA 1AYCA 2Y1NA 1D1ZA 1NZLA 3S8NA 2EO6A 2ECDA 2C9WA 2PNBA 4EIHA 1Y1UA 5DF6A 5EHRA 3CWGA 2CIAA 4JEGA 1HCTB 4D8KA 1IJRA 3CD3A 5DC0B 1JYQA 1RPYA 1A1EA 2C0TA 1PICA 2DX0A 2ETZA 1LCKA 3S8OA 2DCRA 1QADA 1O4AA 3VRRA 2RSYA 3VRYA 2HDXA 2L6KA 2LNWA 2QMSA 1BKLA 2MRJA 4GWFA 2AOAA 2AOBA 2Y1MA 2CRHA 1CSYA 1CWDL 2DLZA 3PFVA 1O47A 1O4KA 1A08A 3OVEA 4JGHA 3N84A 2GE9A 1A07A 3HIZB 2SHPA 4LUDA 5EG3B 3OV1A 4P9VA 1D4TA 1BF5A 2EU0A 3PJPA 1H9OA 3OB2B 2OZOA 2FO0A 2EYZA 1OPLA 3IMDA 1NZVA 3VROA 1M61A 2EO3A 3CXLA 3VS7A 2C0IA 2Y3AB 4F5BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WA4 A;  4OHD A;  1HCS B;  1RQQ C;  1TZE E;  1O46 A;  3VRN A;  1AOT F;  3TL0 A;  2MC1 A;  5DC4 A;  2CS0 A;  3QWX X;  2HUW A;  5I6V A;  1UUR A;  4P9Z A;  1O44 A;  1F1W A;  5EEQ A;  1BLJ A;  1TCE A;  4LUE A;  4OHE A;  2MK2 A;  5IBM A;  1SHD A;  2LQW A;  2FCI A;  1F2F A;  1LKL A;  4H34 A;  3BUN B;  3VRP A;  3VGO A;  4OHL A;  2K7A B;  1O4J A;  5CDW A;  1QCF A;  1O4E A;  1Z3K A;  4XZ1 A;  2H5K A;  1IS0 A;  1SHB A;  1CSZ A;  4K11 A;  5IBS A;  1CJ1 A;  1O4B A;  1X0N A;  1SKJ A;  3VS4 A;  1LUM A;  3PSJ A;  4FL3 A;  3VS2 A;  3S9K A;  5HKY A;  1O4L A;  1P13 A;  1LUK A;  1JWO A;  4OHI A;  2DLY A;  1X27 A;  3BUO B;  3M7F A;  1FBV A;  2H46 E;  1FU6 A;  5AUL A;  3N8M A;  3OP0 A;  1A1C A;  2L3T A;  4M4Z A;  4A4B A;  3UF4 A;  5EHP A;  2EYV A;  1MW4 A;  2GSB A;  5J3X A;  4K45 A;  1O4R A;  4ROJ A;  1O4F A;  4FL2 A;  2EYY A;  1AYA A;  1B47 A;  2LCT A;  1X6C A;  2SRC A;  3GXW A;  5AXI A;  1FMK A;  1A81 A;  1AOU F;  1O41 A;  1M27 A;  1KC2 A;  1K9A A;  4E68 A;  1ZFP E;  1KSW A;  1R1Q A;  1FHS A;  2B3O A;  1YVL A;  5EEL A;  1I3Z A;  1LUN A;  2KK6 A;  4GPL B;  3PSK A;  3T04 A;  4U17 A;  4L1B B;  1GHU A;  2HMH A;  3NHN A;  1O4C A;  3VRZ A;  2YSX A;  1AB2 A;  3N7Y A;  4H1O A;  2IUH A;  2LNX A;  1BG1 A;  3UYO A;  3OB1 B;  2HCK A;  1G83 A;  1JYR A;  3HCK A;  5HKW A;  5BO4 A;  3EAC A;  2VIF A;  4OHH A;  1GRI A;  1O42 A;  3VS3 A;  2C0O A;  1LKK A;  1O43 A;  1BFI A;  1SPS A;  4X6S A;  2PTK A;  1XA6 A;  3PLF B;  1BFJ A;  2JYQ A;  1AYB A;  3PS5 A;  3VS5 A;  2MRK A;  1LCJ A;  3TKZ A;  2CBL A;  2DVJ A;  3IN7 A;  1RJA A;  3BUW B;  1O4M A;  2CI9 A;  4F59 A;  1CWE A;  1O4Q A;  3MAZ A;  2PLD A;  1OO3 A;  2RVF A;  2BBU A;  2CI8 A;  3S8L A;  4F5A A;  2ROR A;  1BM2 A;  2PLE A;  4NWF A;  3HHM B;  1O45 A;  2IZV A;  3BUX B;  3MXC A;  2CR4 A;  1BMB A;  1YVH A;  1R1P A;  4U1P A;  2LQN A;  2ABL A;  3KFJ A;  2HDV A;  1LUI A;  3QWY A;  3GXX A;  2IUG A;  5GJI A;  3MXY A;  1OO4 A;  4QSY A;  1FYR A;  4DGP A;  2K79 B;  2PNA A;  2EOB A;  4JE4 A;  5GJH A;  1MIL A;  4NWG A;  3VRQ A;  3K2M A;  3PQZ A;  1O4O A;  4A4C A;  4K44 A;  1KA7 A;  1BKM A;  1O4I A;  1A1B A;  3VS6 A;  1JYU A;  5KAZ A;  4EY0 A;  1FBZ A;  1JU5 A;  2RMX A;  4E93 A;  4FBN A;  1OPK A;  2IUI A;  3US4 A;  1UUS A;  2EKX A;  3C7I A;  1QG1 E;  2KNO A;  5DC9 A;  4XZ0 A;  3EAZ A;  4K2R A;  1O4P A;  1SPR A;  4WWQ A;  1AYD A;  2XP1 A;  1R1S A;  1O4N A;  1Y57 A;  2DM0 A;  3IMJ A;  1BHH B;  1D4W A;  3CBL A;  1O4H A;  1BHF A;  2H8H A;  1O4G A;  1WQU A;  3VS0 A;  3VS1 A;  1A1A A;  3BUM B;  3GQI B;  3IN8 A;  3ZNI A;  4GL9 E;  5D0J A;  1FU5 A;  1O49 A;  2OQ1 A;  1O4D A;  2MQI A;  3BKB A;  2EL8 A;  1NRV A;  2AUG A;  2L4K A;  4TZI A;  1O48 A;  1SHA A;  4DGX A;  1KA6 A;  1AD5 A;  2YU7 A;  1BHH A;  5HKZ A;  1A09 A;  1BLK A;  1AYC A;  2Y1N A;  1D1Z A;  1NZL A;  3S8N A;  2EO6 A;  2ECD A;  2C9W A;  2PNB A;  4EIH A;  1Y1U A;  5DF6 A;  5EHR A;  3CWG A;  2CIA A;  4JEG A;  1HCT B;  4D8K A;  1IJR A;  3CD3 A;  5DC0 B;  1JYQ A;  1RPY A;  1A1E A;  2C0T A;  1PIC A;  2DX0 A;  2ETZ A;  1LCK A;  3S8O A;  2DCR A;  1QAD A;  1O4A A;  3VRR A;  2RSY A;  3VRY A;  2HDX A;  2L6K A;  2LNW A;  2QMS A;  1BKL A;  2MRJ A;  4GWF A;  2AOA A;  2AOB A;  2Y1M A;  2CRH A;  1CSY A;  1CWD L;  2DLZ A;  3PFV A;  1O47 A;  1O4K A;  1A08 A;  3OVE A;  4JGH A;  3N84 A;  2GE9 A;  1A07 A;  3HIZ B;  2SHP A;  4LUD A;  5EG3 B;  3OV1 A;  4P9V A;  1D4T A;  1BF5 A;  2EU0 A;  3PJP A;  1H9O A;  3OB2 B;  2OZO A;  2FO0 A;  2EYZ A;  1OPL A;  3IMD A;  1NZV A;  3VRO A;  1M61 A;  2EO3 A;  3CXL A;  3VS7 A;  2C0I A;  2Y3A B;  4F5B A; 
#chains in the Genus database with same CATH topology
 3WA4 A;  4OHD A;  1HCS B;  1RQQ C;  1TZE E;  1O46 A;  3VRN A;  1AOT F;  3TL0 A;  2MC1 A;  5DC4 A;  2CS0 A;  3QWX X;  2HUW A;  5I6V A;  1UUR A;  4P9Z A;  1O44 A;  1F1W A;  5EEQ A;  1BLJ A;  1TCE A;  4LUE A;  4OHE A;  2MK2 A;  5IBM A;  1SHD A;  2LQW A;  2FCI A;  1F2F A;  1LKL A;  4H34 A;  3BUN B;  3VRP A;  3VGO A;  4OHL A;  2K7A B;  1O4J A;  5CDW A;  1QCF A;  1O4E A;  1Z3K A;  4XZ1 A;  2H5K A;  1IS0 A;  1SHB A;  1CSZ A;  4K11 A;  5IBS A;  1CJ1 A;  1O4B A;  1X0N A;  1SKJ A;  3VS4 A;  1LUM A;  3PSJ A;  4FL3 A;  3VS2 A;  3S9K A;  5HKY A;  1O4L A;  1P13 A;  1LUK A;  1JWO A;  4OHI A;  2DLY A;  1X27 A;  3BUO B;  3M7F A;  1FBV A;  2H46 E;  1FU6 A;  5AUL A;  3N8M A;  3OP0 A;  1A1C A;  2L3T A;  4M4Z A;  4A4B A;  3UF4 A;  5EHP A;  2EYV A;  1MW4 A;  2GSB A;  5J3X A;  4K45 A;  1O4R A;  4ROJ A;  1O4F A;  4FL2 A;  2EYY A;  1AYA A;  1B47 A;  2LCT A;  1X6C A;  2SRC A;  3GXW A;  5AXI A;  1FMK A;  1A81 A;  1AOU F;  1O41 A;  1M27 A;  1KC2 A;  1K9A A;  4E68 A;  1ZFP E;  2LRA A;  1KSW A;  1R1Q A;  1FHS A;  2B3O A;  1YVL A;  5EEL A;  1I3Z A;  1LUN A;  2KK6 A;  4GPL B;  3PSK A;  3T04 A;  4U17 A;  4L1B B;  1GHU A;  2HMH A;  3NHN A;  1O4C A;  3VRZ A;  2YSX A;  1AB2 A;  3N7Y A;  4H1O A;  2IUH A;  2LNX A;  1BG1 A;  3UYO A;  3OB1 B;  2HCK A;  1G83 A;  1JYR A;  3HCK A;  5HKW A;  5BO4 A;  3EAC A;  2VIF A;  4OHH A;  1GRI A;  1O42 A;  3VS3 A;  3K2T A;  2C0O A;  1LKK A;  1O43 A;  1BFI A;  1SPS A;  4X6S A;  2PTK A;  1XA6 A;  3PLF B;  1BFJ A;  2JYQ A;  1AYB A;  3PS5 A;  3VS5 A;  2MRK A;  1LCJ A;  3TKZ A;  2CBL A;  2DVJ A;  3IN7 A;  1RJA A;  3BUW B;  1O4M A;  2CI9 A;  4F59 A;  1CWE A;  1O4Q A;  3MAZ A;  2PLD A;  1OO3 A;  2RVF A;  2BBU A;  2CI8 A;  3S8L A;  4F5A A;  2ROR A;  1BM2 A;  2PLE A;  4NWF A;  3HHM B;  1O45 A;  2IZV A;  3BUX B;  3MXC A;  2CR4 A;  1BMB A;  1YVH A;  1R1P A;  4U1P A;  2LQN A;  2ABL A;  3KFJ A;  2HDV A;  1LUI A;  3QWY A;  3GXX A;  2IUG A;  5GJI A;  3MXY A;  1OO4 A;  4QSY A;  1FYR A;  4DGP A;  2K79 B;  2PNA A;  2EOB A;  4JE4 A;  5GJH A;  1MIL A;  4NWG A;  3VRQ A;  3K2M A;  3PQZ A;  1O4O A;  3LYV A;  4A4C A;  4K44 A;  1KA7 A;  1BKM A;  1O4I A;  1A1B A;  3VS6 A;  1JYU A;  5KAZ A;  4EY0 A;  1FBZ A;  1JU5 A;  2RMX A;  4E93 A;  4FBN A;  1OPK A;  2IUI A;  3US4 A;  1UUS A;  2EKX A;  3C7I A;  1QG1 E;  2KNO A;  5DC9 A;  4XZ0 A;  3EAZ A;  2KGY A;  4K2R A;  1O4P A;  1SPR A;  4WWQ A;  1AYD A;  2XP1 A;  1R1S A;  1O4N A;  1Y57 A;  2DM0 A;  3IMJ A;  1BHH B;  1D4W A;  3CBL A;  1O4H A;  1BHF A;  2H8H A;  1O4G A;  1WQU A;  3VS0 A;  3VS1 A;  1A1A A;  3BUM B;  3GQI B;  3IN8 A;  3ZNI A;  4GL9 E;  5D0J A;  1FU5 A;  1O49 A;  2OQ1 A;  1O4D A;  2MQI A;  3BKB A;  2EL8 A;  1NRV A;  2AUG A;  2L4K A;  4TZI A;  1O48 A;  1SHA A;  4DGX A;  1KA6 A;  1AD5 A;  2YU7 A;  1BHH A;  5HKZ A;  1A09 A;  1BLK A;  1AYC A;  2Y1N A;  1D1Z A;  1NZL A;  3S8N A;  2EO6 A;  2ECD A;  2C9W A;  2PNB A;  4EIH A;  1Y1U A;  5DF6 A;  5EHR A;  3CWG A;  2CIA A;  4JEG A;  1HCT B;  4D8K A;  1IJR A;  3CD3 A;  5DC0 B;  1JYQ A;  1RPY A;  1A1E A;  2C0T A;  1PIC A;  2DX0 A;  2ETZ A;  1LCK A;  3S8O A;  2DCR A;  1QAD A;  1O4A A;  3VRR A;  2RSY A;  3VRY A;  2HDX A;  2L6K A;  2LNW A;  2QMS A;  1BKL A;  2MRJ A;  4GWF A;  2AOA A;  2AOB A;  2Y1M A;  2CRH A;  1CSY A;  1CWD L;  2DLZ A;  3PFV A;  1O47 A;  1O4K A;  1A08 A;  3OVE A;  4JGH A;  3N84 A;  2GE9 A;  1A07 A;  3HIZ B;  2SHP A;  4LUD A;  5EG3 B;  3OV1 A;  4P9V A;  1D4T A;  1BF5 A;  2EU0 A;  3PJP A;  1H9O A;  3OB2 B;  2OZO A;  2FO0 A;  2EYZ A;  1OPL A;  3IMD A;  1NZV A;  3VRO A;  1M61 A;  2EO3 A;  3CXL A;  3VS7 A;  2C0I A;  2Y3A B;  4F5B A; 
#chains in the Genus database with same CATH homology
 3WA4 A;  4OHD A;  1HCS B;  1RQQ C;  1TZE E;  1O46 A;  3VRN A;  1AOT F;  3TL0 A;  2MC1 A;  5DC4 A;  2CS0 A;  3QWX X;  2HUW A;  5I6V A;  1UUR A;  4P9Z A;  1O44 A;  1F1W A;  5EEQ A;  1BLJ A;  1TCE A;  4LUE A;  4OHE A;  2MK2 A;  5IBM A;  1SHD A;  2LQW A;  2FCI A;  1F2F A;  1LKL A;  4H34 A;  3BUN B;  3VRP A;  3VGO A;  4OHL A;  2K7A B;  1O4J A;  5CDW A;  1QCF A;  1O4E A;  1Z3K A;  4XZ1 A;  2H5K A;  1IS0 A;  1SHB A;  1CSZ A;  4K11 A;  5IBS A;  1CJ1 A;  1O4B A;  1X0N A;  1SKJ A;  3VS4 A;  1LUM A;  3PSJ A;  4FL3 A;  3VS2 A;  3S9K A;  5HKY A;  1O4L A;  1P13 A;  1LUK A;  1JWO A;  4OHI A;  2DLY A;  1X27 A;  3BUO B;  3M7F A;  1FBV A;  2H46 E;  1FU6 A;  5AUL A;  3N8M A;  3OP0 A;  1A1C A;  2L3T A;  4M4Z A;  4A4B A;  3UF4 A;  5EHP A;  2EYV A;  1MW4 A;  2GSB A;  5J3X A;  4K45 A;  1O4R A;  4ROJ A;  1O4F A;  4FL2 A;  2EYY A;  1AYA A;  1B47 A;  2LCT A;  1X6C A;  2SRC A;  3GXW A;  5AXI A;  1FMK A;  1A81 A;  1AOU F;  1O41 A;  1M27 A;  1KC2 A;  1K9A A;  4E68 A;  1ZFP E;  1KSW A;  1R1Q A;  1FHS A;  2B3O A;  1YVL A;  5EEL A;  1I3Z A;  1LUN A;  2KK6 A;  4GPL B;  3PSK A;  3T04 A;  4U17 A;  4L1B B;  1GHU A;  2HMH A;  3NHN A;  1O4C A;  3VRZ A;  2YSX A;  1AB2 A;  3N7Y A;  4H1O A;  2IUH A;  2LNX A;  1BG1 A;  3UYO A;  3OB1 B;  2HCK A;  1G83 A;  1JYR A;  3HCK A;  5HKW A;  5BO4 A;  3EAC A;  2VIF A;  4OHH A;  1GRI A;  1O42 A;  3VS3 A;  2C0O A;  1LKK A;  1O43 A;  1BFI A;  1SPS A;  4X6S A;  2PTK A;  1XA6 A;  3PLF B;  1BFJ A;  2JYQ A;  1AYB A;  3PS5 A;  3VS5 A;  2MRK A;  1LCJ A;  3TKZ A;  2CBL A;  2DVJ A;  3IN7 A;  1RJA A;  3BUW B;  1O4M A;  2CI9 A;  4F59 A;  1CWE A;  1O4Q A;  3MAZ A;  2PLD A;  1OO3 A;  2RVF A;  2BBU A;  2CI8 A;  3S8L A;  4F5A A;  2ROR A;  1BM2 A;  2PLE A;  4NWF A;  3HHM B;  1O45 A;  2IZV A;  3BUX B;  3MXC A;  2CR4 A;  1BMB A;  1YVH A;  1R1P A;  4U1P A;  2LQN A;  2ABL A;  3KFJ A;  2HDV A;  1LUI A;  3QWY A;  3GXX A;  2IUG A;  5GJI A;  3MXY A;  1OO4 A;  4QSY A;  1FYR A;  4DGP A;  2K79 B;  2PNA A;  2EOB A;  4JE4 A;  5GJH A;  1MIL A;  4NWG A;  3VRQ A;  3K2M A;  3PQZ A;  1O4O A;  4A4C A;  4K44 A;  1KA7 A;  1BKM A;  1O4I A;  1A1B A;  3VS6 A;  1JYU A;  5KAZ A;  4EY0 A;  1FBZ A;  1JU5 A;  2RMX A;  4E93 A;  4FBN A;  1OPK A;  2IUI A;  3US4 A;  1UUS A;  2EKX A;  3C7I A;  1QG1 E;  2KNO A;  5DC9 A;  4XZ0 A;  3EAZ A;  4K2R A;  1O4P A;  1SPR A;  4WWQ A;  1AYD A;  2XP1 A;  1R1S A;  1O4N A;  1Y57 A;  2DM0 A;  3IMJ A;  1BHH B;  1D4W A;  3CBL A;  1O4H A;  1BHF A;  2H8H A;  1O4G A;  1WQU A;  3VS0 A;  3VS1 A;  1A1A A;  3BUM B;  3GQI B;  3IN8 A;  3ZNI A;  4GL9 E;  5D0J A;  1FU5 A;  1O49 A;  2OQ1 A;  1O4D A;  2MQI A;  3BKB A;  2EL8 A;  1NRV A;  2AUG A;  2L4K A;  4TZI A;  1O48 A;  1SHA A;  4DGX A;  1KA6 A;  1AD5 A;  2YU7 A;  1BHH A;  5HKZ A;  1A09 A;  1BLK A;  1AYC A;  2Y1N A;  1D1Z A;  1NZL A;  3S8N A;  2EO6 A;  2ECD A;  2C9W A;  2PNB A;  4EIH A;  1Y1U A;  5DF6 A;  5EHR A;  3CWG A;  2CIA A;  4JEG A;  1HCT B;  4D8K A;  1IJR A;  3CD3 A;  5DC0 B;  1JYQ A;  1RPY A;  1A1E A;  2C0T A;  1PIC A;  2DX0 A;  2ETZ A;  1LCK A;  3S8O A;  2DCR A;  1QAD A;  1O4A A;  3VRR A;  2RSY A;  3VRY A;  2HDX A;  2L6K A;  2LNW A;  2QMS A;  1BKL A;  2MRJ A;  4GWF A;  2AOA A;  2AOB A;  2Y1M A;  2CRH A;  1CSY A;  1CWD L;  2DLZ A;  3PFV A;  1O47 A;  1O4K A;  1A08 A;  3OVE A;  4JGH A;  3N84 A;  2GE9 A;  1A07 A;  3HIZ B;  2SHP A;  4LUD A;  5EG3 B;  3OV1 A;  4P9V A;  1D4T A;  1BF5 A;  2EU0 A;  3PJP A;  1H9O A;  3OB2 B;  2OZO A;  2FO0 A;  2EYZ A;  1OPL A;  3IMD A;  1NZV A;  3VRO A;  1M61 A;  2EO3 A;  3CXL A;  3VS7 A;  2C0I A;  2Y3A B;  4F5B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...