2HDXA

Crystal structure of the src homology-2 domain of sh2-b in complex with jak2 ptyr813 phosphopeptide
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
108
structure length
108
Chain Sequence
QPLSGYPWFHGMLSRLKAAQLVLEGGTGSHGVFLVRQSETRRGECVLTFNFQGKAKHLRLSLNAAGQCRVQHLHFQSIFDMLEHFRVHPIPLESGGSSDVVLVSYVPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Signaling protein
molecule keywords SH2-B PH domain containing signaling mediator 1 gamma isofor
publication title Structural Basis for Phosphotyrosine Recognition by the Src Homology-2 Domains of the Adapter Proteins SH2-B and APS.
pubmed doi rcsb
source organism Mus musculus
total genus 28
structure length 108
sequence length 108
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2006-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00017 SH2 SH2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.505.10 Alpha Beta 2-Layer Sandwich SHC Adaptor Protein SH2 domain 2hdxA00
1BKLA 1R1PA 5EELA 4U17A 4A4BA 1LCKA 1O4PA 3TKZA 3IN8A 4P9VA 1NRVA 3MXCA 3VGOA 2VIFA 1XA6A 3BUNB 4NWGA 3T04A 1RJAA 1AYAA 1O42A 3OP0A 4F5AA 1AB2A 1JU5A 1YVHA 1BKMA 2B3OA 1SHDA 1SHAA 1KA6A 1O49A 3GQIB 3VRRA 1I3ZA 1O4DA 3HCKA 2DM0A 1QG1E 2KK6A 1A1BA 5EEQA 1O4NA 2DX0A 3QWXX 1AYCA 2RSYA 3S8OA 3CWGA 2IUGA 3TL0A 1FBVA 2IUIA 1ZFPE 3VS0A 3WA4A 1OO3A 1SHBA 2CBLA 2EO6A 1GRIA 2OQ1A 5EHRA 4K2RA 5GJHA 5AULA 5DC4A 2H46E 2DLZA 4U1PA 4D8KA 1SPRA 4JGHA 2DVJA 2C0TA 4XZ0A 1M61A 1LKLA 4ROJA 4TZIA 1IS0A 5I6VA 1D1ZA 1O4CA 3OB1B 2OZOA 3HIZB 1FHSA 5DC9A 4GWFA 2SHPA 3VS2A 4F59A 2LCTA 1SPSA 1AD5A 1QCFA 4EY0A 2MK2A 1BHFA 5AXIA 2LNXA 3C7IA 1CWEA 4JEGA 1HCSB 4X6SA 1O4OA 1UUSA 4OHEA 2EYZA 2PLEA 2LQWA 2ABLA 3BUXB 3PSJA 5HKYA 1PICA 1OPLA 1A1EA 5HKZA 1O4KA 1O4RA 1BLJA 3IMJA 3BUMB 2EKXA 1AOUF 2CS0A 1P13A 2PNAA 4F5BA 1MW4A 2Y1MA 3MXYA 3S8LA 1M27A 1LUMA 4LUDA 1YVLA 1R1QA 3VS7A 2Y3AB 1WQUA 1O4HA 2AUGA 1O4QA 2YU7A 1O47A 2RVFA 3EAZA 2ETZA 1O43A 1O41A 3VRNA 4QSYA 5CDWA 1O4AA 3UYOA 3QWYA 2PLDA 1G83A 1OPKA 2CI8A 1CSZA 1O44A 3PS5A 1X0NA 3GXXA 4NWFA 3VS1A 5IBSA 3VS4A 3EACA 5DF6A 1O46A 1LCJA 1X6CA 3US4A 2CRHA 1BFIA 2KNOA 1H9OA 1A08A 4K45A 1HCTB 1O4LA 1JYRA 4K11A 1LUKA 1KC2A 1F2FA 2LNWA 1SKJA 1RPYA 3N84A 2H5KA 4FBNA 1JYUA 1A09A 1TCEA 4GL9E 3PFVA 3UF4A 2GSBA 3OV1A 2C9WA 2MQIA 1RQQC 1O4BA 1OO4A 4E93A 2EOBA 4K44A 2AOAA 1X27A 3VS3A 3NHNA 3BKBA 3VS5A 3HHMB 3PQZA 4WWQA 4EIHA 3CD3A 1Y57A 1CSYA 3K2MA 1R1SA 1A81A 2MC1A 5KAZA 2QMSA 2AOBA 5HKWA 2HDVA 3N8MA 2FO0A 3S9KA 2BBUA 2K7AB 2HUWA 2HDXA 1BLKA 3BUOB 1NZVA 2H8HA 1O4IA 4OHLA 1LUNA 5EG3B 1O4MA 4E68A 4JE4A 3MAZA 1O4FA 3CXLA 3ZNIA 1BM2A 1B47A 1BFJA 2SRCA 1FBZA 4FL3A 5DC0B 2JYQA 5BO4A 3PJPA 1MILA 2HMHA 1LKKA 1F1WA 2CR4A 2EO3A 2EYVA 2DLYA 2MRJA 1Y1UA 2C0IA 1LUIA 3N7YA 2MRKA 3CBLA 2L3TA 3PLFB 1BHHB 2IUHA 1JYQA 1O48A 2HCKA 1BHHA 2Y1NA 5D0JA 2L4KA 3IMDA 3VRYA 4FL2A 1KA7A 4OHDA 3VRZA 2PTKA 2C0OA 2YSXA 1FMKA 1D4TA 4H34A 2CI9A 3OVEA 4GPLB 1FU5A 2RORA 2PNBA 5GJIA 1O4GA 1NZLA 4LUEA 4M4ZA 2RMXA 2XP1A 3S8NA 1O4EA 2LQNA 3M7FA 1AOTF 1D4WA 1CWDL 1A07A 1GHUA 2FCIA 1IJRA 4A4CA 3BUWB 4XZ1A 1FU6A 1BMBA 3VROA 1Z3KA 2IZVA 5EHPA 2L6KA 2EU0A 4L1BB 4DGPA 4OHHA 1A1CA 3PSKA 1BG1A 1AYDA 1KSWA 4OHIA 1CJ1A 3VRQA 2ECDA 4H1OA 3KFJA 1AYBA 1UURA 3VRPA 2K79B 1K9AA 3IN7A 2CIAA 4P9ZA 3VS6A 3OB2B 4DGXA 5J3XA 5IBMA 1O45A 2EYYA 2GE9A 2EL8A 3GXWA 1QADA 1A1AA 1JWOA 1O4JA 1FYRA 1TZEE 1BF5A 2DCRA
chains in the Genus database with same CATH superfamily
1BKLA 1R1PA 5EELA 4U17A 4A4BA 1LCKA 1O4PA 3TKZA 3IN8A 4P9VA 1NRVA 3MXCA 3VGOA 2VIFA 1XA6A 3BUNB 4NWGA 3T04A 1RJAA 1AYAA 1O42A 3OP0A 4F5AA 1AB2A 1JU5A 1YVHA 1BKMA 2B3OA 1SHDA 1SHAA 1KA6A 1O49A 3GQIB 3VRRA 1I3ZA 1O4DA 3HCKA 2DM0A 1QG1E 2KK6A 1A1BA 5EEQA 1O4NA 2DX0A 3QWXX 1AYCA 2RSYA 3S8OA 3CWGA 2IUGA 3TL0A 1FBVA 2IUIA 1ZFPE 3VS0A 3WA4A 1OO3A 1SHBA 2CBLA 2EO6A 1GRIA 2OQ1A 5EHRA 4K2RA 5GJHA 5AULA 5DC4A 2H46E 2DLZA 4U1PA 4D8KA 1SPRA 4JGHA 2DVJA 2C0TA 4XZ0A 1M61A 1LKLA 4ROJA 2KGYA 4TZIA 1IS0A 5I6VA 1D1ZA 1O4CA 3OB1B 2OZOA 3HIZB 1FHSA 5DC9A 4GWFA 2SHPA 3VS2A 4F59A 2LCTA 1SPSA 1AD5A 1QCFA 4EY0A 2MK2A 1BHFA 5AXIA 2LNXA 3C7IA 1CWEA 4JEGA 1HCSB 4X6SA 1O4OA 1UUSA 4OHEA 2EYZA 2PLEA 2LQWA 2ABLA 3BUXB 3PSJA 5HKYA 1PICA 1OPLA 1A1EA 5HKZA 1O4KA 1O4RA 1BLJA 3IMJA 3BUMB 2EKXA 1AOUF 2CS0A 1P13A 2PNAA 4F5BA 1MW4A 2Y1MA 3MXYA 3S8LA 1M27A 1LUMA 4LUDA 1YVLA 1R1QA 3VS7A 2Y3AB 1WQUA 1O4HA 2AUGA 1O4QA 2YU7A 1O47A 2RVFA 3EAZA 2ETZA 1O43A 1O41A 3VRNA 4QSYA 5CDWA 1O4AA 3UYOA 3QWYA 2PLDA 1G83A 1OPKA 2CI8A 1CSZA 1O44A 3PS5A 1X0NA 3GXXA 4NWFA 3VS1A 5IBSA 3VS4A 3EACA 5DF6A 1O46A 1LCJA 1X6CA 3US4A 2CRHA 1BFIA 2KNOA 1H9OA 1A08A 4K45A 1HCTB 1O4LA 1JYRA 4K11A 1LUKA 1KC2A 1F2FA 2LNWA 1SKJA 1RPYA 3N84A 2H5KA 4FBNA 1JYUA 1A09A 1TCEA 4GL9E 3PFVA 3UF4A 2GSBA 3OV1A 2C9WA 2MQIA 1RQQC 1O4BA 1OO4A 4E93A 2EOBA 4K44A 2AOAA 1X27A 3VS3A 3NHNA 3BKBA 3VS5A 3HHMB 3PQZA 4WWQA 4EIHA 3CD3A 1Y57A 1CSYA 3K2MA 1R1SA 1A81A 2MC1A 5KAZA 2QMSA 2AOBA 5HKWA 2HDVA 3N8MA 2FO0A 3S9KA 2BBUA 2K7AB 2HUWA 2HDXA 1BLKA 3BUOB 1NZVA 2H8HA 1O4IA 4OHLA 1LUNA 5EG3B 1O4MA 4E68A 4JE4A 3MAZA 1O4FA 3CXLA 3ZNIA 1BM2A 1B47A 1BFJA 2SRCA 1FBZA 4FL3A 5DC0B 2JYQA 5BO4A 3PJPA 1MILA 2HMHA 1LKKA 1F1WA 3LYVA 2CR4A 2EO3A 2EYVA 2DLYA 2MRJA 1Y1UA 2C0IA 1LUIA 3N7YA 3K2TA 2MRKA 3CBLA 2L3TA 3PLFB 1BHHB 2IUHA 1JYQA 1O48A 2HCKA 1BHHA 2Y1NA 5D0JA 2L4KA 3IMDA 3VRYA 4FL2A 1KA7A 4OHDA 3VRZA 2PTKA 2C0OA 2YSXA 1FMKA 1D4TA 4H34A 2CI9A 3OVEA 4GPLB 1FU5A 2RORA 2PNBA 5GJIA 1O4GA 1NZLA 4LUEA 4M4ZA 2RMXA 2XP1A 3S8NA 1O4EA 2LQNA 3M7FA 1AOTF 1D4WA 1CWDL 1A07A 1GHUA 2FCIA 1IJRA 4A4CA 3BUWB 4XZ1A 1FU6A 1BMBA 3VROA 1Z3KA 2IZVA 5EHPA 2LRAA 2L6KA 2EU0A 4L1BB 4DGPA 4OHHA 1A1CA 3PSKA 1BG1A 1AYDA 1KSWA 4OHIA 1CJ1A 3VRQA 2ECDA 4H1OA 3KFJA 1AYBA 1UURA 3VRPA 2K79B 1K9AA 3IN7A 2CIAA 4P9ZA 3VS6A 3OB2B 4DGXA 5J3XA 5IBMA 1O45A 2EYYA 2GE9A 2EL8A 3GXWA 1QADA 1A1AA 1JWOA 1O4JA 1FYRA 1TZEE 1BF5A 2DCRA
chains in the Genus database with same CATH topology
1BKLA 1R1PA 5EELA 4U17A 4A4BA 1LCKA 1O4PA 3TKZA 3IN8A 4P9VA 1NRVA 3MXCA 3VGOA 2VIFA 1XA6A 3BUNB 4NWGA 3T04A 1RJAA 1AYAA 1O42A 3OP0A 4F5AA 1AB2A 1JU5A 1YVHA 1BKMA 2B3OA 1SHDA 1SHAA 1KA6A 1O49A 3GQIB 3VRRA 1I3ZA 1O4DA 3HCKA 2DM0A 1QG1E 2KK6A 1A1BA 5EEQA 1O4NA 2DX0A 3QWXX 1AYCA 2RSYA 3S8OA 3CWGA 2IUGA 3TL0A 1FBVA 2IUIA 1ZFPE 3VS0A 3WA4A 1OO3A 1SHBA 2CBLA 2EO6A 1GRIA 2OQ1A 5EHRA 4K2RA 5GJHA 5AULA 5DC4A 2H46E 2DLZA 4U1PA 4D8KA 1SPRA 4JGHA 2DVJA 2C0TA 4XZ0A 1M61A 1LKLA 4ROJA 4TZIA 1IS0A 5I6VA 1D1ZA 1O4CA 3OB1B 2OZOA 3HIZB 1FHSA 5DC9A 4GWFA 2SHPA 3VS2A 4F59A 2LCTA 1SPSA 1AD5A 1QCFA 4EY0A 2MK2A 1BHFA 5AXIA 2LNXA 3C7IA 1CWEA 4JEGA 1HCSB 4X6SA 1O4OA 1UUSA 4OHEA 2EYZA 2PLEA 2LQWA 2ABLA 3BUXB 3PSJA 5HKYA 1PICA 1OPLA 1A1EA 5HKZA 1O4KA 1O4RA 1BLJA 3IMJA 3BUMB 2EKXA 1AOUF 2CS0A 1P13A 2PNAA 4F5BA 1MW4A 2Y1MA 3MXYA 3S8LA 1M27A 1LUMA 4LUDA 1YVLA 1R1QA 3VS7A 2Y3AB 1WQUA 1O4HA 2AUGA 1O4QA 2YU7A 1O47A 2RVFA 3EAZA 2ETZA 1O43A 1O41A 3VRNA 4QSYA 5CDWA 1O4AA 3UYOA 3QWYA 2PLDA 1G83A 1OPKA 2CI8A 1CSZA 1O44A 3PS5A 1X0NA 3GXXA 4NWFA 3VS1A 5IBSA 3VS4A 3EACA 5DF6A 1O46A 1LCJA 1X6CA 3US4A 2CRHA 1BFIA 2KNOA 1H9OA 1A08A 4K45A 1HCTB 1O4LA 1JYRA 4K11A 1LUKA 1KC2A 1F2FA 2LNWA 1SKJA 1RPYA 3N84A 2H5KA 4FBNA 1JYUA 1A09A 1TCEA 4GL9E 3PFVA 3UF4A 2GSBA 3OV1A 2C9WA 2MQIA 1RQQC 1O4BA 1OO4A 4E93A 2EOBA 4K44A 2AOAA 1X27A 3VS3A 3NHNA 3BKBA 3VS5A 3HHMB 3PQZA 4WWQA 4EIHA 3CD3A 1Y57A 1CSYA 3K2MA 1R1SA 1A81A 2MC1A 5KAZA 2QMSA 2AOBA 5HKWA 2HDVA 3N8MA 2FO0A 3S9KA 2BBUA 2K7AB 2HUWA 2HDXA 1BLKA 3BUOB 1NZVA 2H8HA 1O4IA 4OHLA 1LUNA 5EG3B 1O4MA 4E68A 4JE4A 3MAZA 1O4FA 3CXLA 3ZNIA 1BM2A 1B47A 1BFJA 2SRCA 1FBZA 4FL3A 5DC0B 2JYQA 5BO4A 3PJPA 1MILA 2HMHA 1LKKA 1F1WA 2CR4A 2EO3A 2EYVA 2DLYA 2MRJA 1Y1UA 2C0IA 1LUIA 3N7YA 2MRKA 3CBLA 2L3TA 3PLFB 1BHHB 2IUHA 1JYQA 1O48A 2HCKA 1BHHA 2Y1NA 5D0JA 2L4KA 3IMDA 3VRYA 4FL2A 1KA7A 4OHDA 3VRZA 2PTKA 2C0OA 2YSXA 1FMKA 1D4TA 4H34A 2CI9A 3OVEA 4GPLB 1FU5A 2RORA 2PNBA 5GJIA 1O4GA 1NZLA 4LUEA 4M4ZA 2RMXA 2XP1A 3S8NA 1O4EA 2LQNA 3M7FA 1AOTF 1D4WA 1CWDL 1A07A 1GHUA 2FCIA 1IJRA 4A4CA 3BUWB 4XZ1A 1FU6A 1BMBA 3VROA 1Z3KA 2IZVA 5EHPA 2L6KA 2EU0A 4L1BB 4DGPA 4OHHA 1A1CA 3PSKA 1BG1A 1AYDA 1KSWA 4OHIA 1CJ1A 3VRQA 2ECDA 4H1OA 3KFJA 1AYBA 1UURA 3VRPA 2K79B 1K9AA 3IN7A 2CIAA 4P9ZA 3VS6A 3OB2B 4DGXA 5J3XA 5IBMA 1O45A 2EYYA 2GE9A 2EL8A 3GXWA 1QADA 1A1AA 1JWOA 1O4JA 1FYRA 1TZEE 1BF5A 2DCRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BKL A;  1R1P A;  5EEL A;  4U17 A;  4A4B A;  1LCK A;  1O4P A;  3TKZ A;  3IN8 A;  4P9V A;  1NRV A;  3MXC A;  3VGO A;  2VIF A;  1XA6 A;  3BUN B;  4NWG A;  3T04 A;  1RJA A;  1AYA A;  1O42 A;  3OP0 A;  4F5A A;  1AB2 A;  1JU5 A;  1YVH A;  1BKM A;  2B3O A;  1SHD A;  1SHA A;  1KA6 A;  1O49 A;  3GQI B;  3VRR A;  1I3Z A;  1O4D A;  3HCK A;  2DM0 A;  1QG1 E;  2KK6 A;  1A1B A;  5EEQ A;  1O4N A;  2DX0 A;  3QWX X;  1AYC A;  2RSY A;  3S8O A;  3CWG A;  2IUG A;  3TL0 A;  1FBV A;  2IUI A;  1ZFP E;  3VS0 A;  3WA4 A;  1OO3 A;  1SHB A;  2CBL A;  2EO6 A;  1GRI A;  2OQ1 A;  5EHR A;  4K2R A;  5GJH A;  5AUL A;  5DC4 A;  2H46 E;  2DLZ A;  4U1P A;  4D8K A;  1SPR A;  4JGH A;  2DVJ A;  2C0T A;  4XZ0 A;  1M61 A;  1LKL A;  4ROJ A;  4TZI A;  1IS0 A;  5I6V A;  1D1Z A;  1O4C A;  3OB1 B;  2OZO A;  3HIZ B;  1FHS A;  5DC9 A;  4GWF A;  2SHP A;  3VS2 A;  4F59 A;  2LCT A;  1SPS A;  1AD5 A;  1QCF A;  4EY0 A;  2MK2 A;  1BHF A;  5AXI A;  2LNX A;  3C7I A;  1CWE A;  4JEG A;  1HCS B;  4X6S A;  1O4O A;  1UUS A;  4OHE A;  2EYZ A;  2PLE A;  2LQW A;  2ABL A;  3BUX B;  3PSJ A;  5HKY A;  1PIC A;  1OPL A;  1A1E A;  5HKZ A;  1O4K A;  1O4R A;  1BLJ A;  3IMJ A;  3BUM B;  2EKX A;  1AOU F;  2CS0 A;  1P13 A;  2PNA A;  4F5B A;  1MW4 A;  2Y1M A;  3MXY A;  3S8L A;  1M27 A;  1LUM A;  4LUD A;  1YVL A;  1R1Q A;  3VS7 A;  2Y3A B;  1WQU A;  1O4H A;  2AUG A;  1O4Q A;  2YU7 A;  1O47 A;  2RVF A;  3EAZ A;  2ETZ A;  1O43 A;  1O41 A;  3VRN A;  4QSY A;  5CDW A;  1O4A A;  3UYO A;  3QWY A;  2PLD A;  1G83 A;  1OPK A;  2CI8 A;  1CSZ A;  1O44 A;  3PS5 A;  1X0N A;  3GXX A;  4NWF A;  3VS1 A;  5IBS A;  3VS4 A;  3EAC A;  5DF6 A;  1O46 A;  1LCJ A;  1X6C A;  3US4 A;  2CRH A;  1BFI A;  2KNO A;  1H9O A;  1A08 A;  4K45 A;  1HCT B;  1O4L A;  1JYR A;  4K11 A;  1LUK A;  1KC2 A;  1F2F A;  2LNW A;  1SKJ A;  1RPY A;  3N84 A;  2H5K A;  4FBN A;  1JYU A;  1A09 A;  1TCE A;  4GL9 E;  3PFV A;  3UF4 A;  2GSB A;  3OV1 A;  2C9W A;  2MQI A;  1RQQ C;  1O4B A;  1OO4 A;  4E93 A;  2EOB A;  4K44 A;  2AOA A;  1X27 A;  3VS3 A;  3NHN A;  3BKB A;  3VS5 A;  3HHM B;  3PQZ A;  4WWQ A;  4EIH A;  3CD3 A;  1Y57 A;  1CSY A;  3K2M A;  1R1S A;  1A81 A;  2MC1 A;  5KAZ A;  2QMS A;  2AOB A;  5HKW A;  2HDV A;  3N8M A;  2FO0 A;  3S9K A;  2BBU A;  2K7A B;  2HUW A;  2HDX A;  1BLK A;  3BUO B;  1NZV A;  2H8H A;  1O4I A;  4OHL A;  1LUN A;  5EG3 B;  1O4M A;  4E68 A;  4JE4 A;  3MAZ A;  1O4F A;  3CXL A;  3ZNI A;  1BM2 A;  1B47 A;  1BFJ A;  2SRC A;  1FBZ A;  4FL3 A;  5DC0 B;  2JYQ A;  5BO4 A;  3PJP A;  1MIL A;  2HMH A;  1LKK A;  1F1W A;  2CR4 A;  2EO3 A;  2EYV A;  2DLY A;  2MRJ A;  1Y1U A;  2C0I A;  1LUI A;  3N7Y A;  2MRK A;  3CBL A;  2L3T A;  3PLF B;  1BHH B;  2IUH A;  1JYQ A;  1O48 A;  2HCK A;  1BHH A;  2Y1N A;  5D0J A;  2L4K A;  3IMD A;  3VRY A;  4FL2 A;  1KA7 A;  4OHD A;  3VRZ A;  2PTK A;  2C0O A;  2YSX A;  1FMK A;  1D4T A;  4H34 A;  2CI9 A;  3OVE A;  4GPL B;  1FU5 A;  2ROR A;  2PNB A;  5GJI A;  1O4G A;  1NZL A;  4LUE A;  4M4Z A;  2RMX A;  2XP1 A;  3S8N A;  1O4E A;  2LQN A;  3M7F A;  1AOT F;  1D4W A;  1CWD L;  1A07 A;  1GHU A;  2FCI A;  1IJR A;  4A4C A;  3BUW B;  4XZ1 A;  1FU6 A;  1BMB A;  3VRO A;  1Z3K A;  2IZV A;  5EHP A;  2L6K A;  2EU0 A;  4L1B B;  4DGP A;  4OHH A;  1A1C A;  3PSK A;  1BG1 A;  1AYD A;  1KSW A;  4OHI A;  1CJ1 A;  3VRQ A;  2ECD A;  4H1O A;  3KFJ A;  1AYB A;  1UUR A;  3VRP A;  2K79 B;  1K9A A;  3IN7 A;  2CIA A;  4P9Z A;  3VS6 A;  3OB2 B;  4DGX A;  5J3X A;  5IBM A;  1O45 A;  2EYY A;  2GE9 A;  2EL8 A;  3GXW A;  1QAD A;  1A1A A;  1JWO A;  1O4J A;  1FYR A;  1TZE E;  1BF5 A;  2DCR A; 
#chains in the Genus database with same CATH topology
 1BKL A;  1R1P A;  5EEL A;  4U17 A;  4A4B A;  1LCK A;  1O4P A;  3TKZ A;  3IN8 A;  4P9V A;  1NRV A;  3MXC A;  3VGO A;  2VIF A;  1XA6 A;  3BUN B;  4NWG A;  3T04 A;  1RJA A;  1AYA A;  1O42 A;  3OP0 A;  4F5A A;  1AB2 A;  1JU5 A;  1YVH A;  1BKM A;  2B3O A;  1SHD A;  1SHA A;  1KA6 A;  1O49 A;  3GQI B;  3VRR A;  1I3Z A;  1O4D A;  3HCK A;  2DM0 A;  1QG1 E;  2KK6 A;  1A1B A;  5EEQ A;  1O4N A;  2DX0 A;  3QWX X;  1AYC A;  2RSY A;  3S8O A;  3CWG A;  2IUG A;  3TL0 A;  1FBV A;  2IUI A;  1ZFP E;  3VS0 A;  3WA4 A;  1OO3 A;  1SHB A;  2CBL A;  2EO6 A;  1GRI A;  2OQ1 A;  5EHR A;  4K2R A;  5GJH A;  5AUL A;  5DC4 A;  2H46 E;  2DLZ A;  4U1P A;  4D8K A;  1SPR A;  4JGH A;  2DVJ A;  2C0T A;  4XZ0 A;  1M61 A;  1LKL A;  4ROJ A;  2KGY A;  4TZI A;  1IS0 A;  5I6V A;  1D1Z A;  1O4C A;  3OB1 B;  2OZO A;  3HIZ B;  1FHS A;  5DC9 A;  4GWF A;  2SHP A;  3VS2 A;  4F59 A;  2LCT A;  1SPS A;  1AD5 A;  1QCF A;  4EY0 A;  2MK2 A;  1BHF A;  5AXI A;  2LNX A;  3C7I A;  1CWE A;  4JEG A;  1HCS B;  4X6S A;  1O4O A;  1UUS A;  4OHE A;  2EYZ A;  2PLE A;  2LQW A;  2ABL A;  3BUX B;  3PSJ A;  5HKY A;  1PIC A;  1OPL A;  1A1E A;  5HKZ A;  1O4K A;  1O4R A;  1BLJ A;  3IMJ A;  3BUM B;  2EKX A;  1AOU F;  2CS0 A;  1P13 A;  2PNA A;  4F5B A;  1MW4 A;  2Y1M A;  3MXY A;  3S8L A;  1M27 A;  1LUM A;  4LUD A;  1YVL A;  1R1Q A;  3VS7 A;  2Y3A B;  1WQU A;  1O4H A;  2AUG A;  1O4Q A;  2YU7 A;  1O47 A;  2RVF A;  3EAZ A;  2ETZ A;  1O43 A;  1O41 A;  3VRN A;  4QSY A;  5CDW A;  1O4A A;  3UYO A;  3QWY A;  2PLD A;  1G83 A;  1OPK A;  2CI8 A;  1CSZ A;  1O44 A;  3PS5 A;  1X0N A;  3GXX A;  4NWF A;  3VS1 A;  5IBS A;  3VS4 A;  3EAC A;  5DF6 A;  1O46 A;  1LCJ A;  1X6C A;  3US4 A;  2CRH A;  1BFI A;  2KNO A;  1H9O A;  1A08 A;  4K45 A;  1HCT B;  1O4L A;  1JYR A;  4K11 A;  1LUK A;  1KC2 A;  1F2F A;  2LNW A;  1SKJ A;  1RPY A;  3N84 A;  2H5K A;  4FBN A;  1JYU A;  1A09 A;  1TCE A;  4GL9 E;  3PFV A;  3UF4 A;  2GSB A;  3OV1 A;  2C9W A;  2MQI A;  1RQQ C;  1O4B A;  1OO4 A;  4E93 A;  2EOB A;  4K44 A;  2AOA A;  1X27 A;  3VS3 A;  3NHN A;  3BKB A;  3VS5 A;  3HHM B;  3PQZ A;  4WWQ A;  4EIH A;  3CD3 A;  1Y57 A;  1CSY A;  3K2M A;  1R1S A;  1A81 A;  2MC1 A;  5KAZ A;  2QMS A;  2AOB A;  5HKW A;  2HDV A;  3N8M A;  2FO0 A;  3S9K A;  2BBU A;  2K7A B;  2HUW A;  2HDX A;  1BLK A;  3BUO B;  1NZV A;  2H8H A;  1O4I A;  4OHL A;  1LUN A;  5EG3 B;  1O4M A;  4E68 A;  4JE4 A;  3MAZ A;  1O4F A;  3CXL A;  3ZNI A;  1BM2 A;  1B47 A;  1BFJ A;  2SRC A;  1FBZ A;  4FL3 A;  5DC0 B;  2JYQ A;  5BO4 A;  3PJP A;  1MIL A;  2HMH A;  1LKK A;  1F1W A;  3LYV A;  2CR4 A;  2EO3 A;  2EYV A;  2DLY A;  2MRJ A;  1Y1U A;  2C0I A;  1LUI A;  3N7Y A;  3K2T A;  2MRK A;  3CBL A;  2L3T A;  3PLF B;  1BHH B;  2IUH A;  1JYQ A;  1O48 A;  2HCK A;  1BHH A;  2Y1N A;  5D0J A;  2L4K A;  3IMD A;  3VRY A;  4FL2 A;  1KA7 A;  4OHD A;  3VRZ A;  2PTK A;  2C0O A;  2YSX A;  1FMK A;  1D4T A;  4H34 A;  2CI9 A;  3OVE A;  4GPL B;  1FU5 A;  2ROR A;  2PNB A;  5GJI A;  1O4G A;  1NZL A;  4LUE A;  4M4Z A;  2RMX A;  2XP1 A;  3S8N A;  1O4E A;  2LQN A;  3M7F A;  1AOT F;  1D4W A;  1CWD L;  1A07 A;  1GHU A;  2FCI A;  1IJR A;  4A4C A;  3BUW B;  4XZ1 A;  1FU6 A;  1BMB A;  3VRO A;  1Z3K A;  2IZV A;  5EHP A;  2LRA A;  2L6K A;  2EU0 A;  4L1B B;  4DGP A;  4OHH A;  1A1C A;  3PSK A;  1BG1 A;  1AYD A;  1KSW A;  4OHI A;  1CJ1 A;  3VRQ A;  2ECD A;  4H1O A;  3KFJ A;  1AYB A;  1UUR A;  3VRP A;  2K79 B;  1K9A A;  3IN7 A;  2CIA A;  4P9Z A;  3VS6 A;  3OB2 B;  4DGX A;  5J3X A;  5IBM A;  1O45 A;  2EYY A;  2GE9 A;  2EL8 A;  3GXW A;  1QAD A;  1A1A A;  1JWO A;  1O4J A;  1FYR A;  1TZE E;  1BF5 A;  2DCR A; 
#chains in the Genus database with same CATH homology
 1BKL A;  1R1P A;  5EEL A;  4U17 A;  4A4B A;  1LCK A;  1O4P A;  3TKZ A;  3IN8 A;  4P9V A;  1NRV A;  3MXC A;  3VGO A;  2VIF A;  1XA6 A;  3BUN B;  4NWG A;  3T04 A;  1RJA A;  1AYA A;  1O42 A;  3OP0 A;  4F5A A;  1AB2 A;  1JU5 A;  1YVH A;  1BKM A;  2B3O A;  1SHD A;  1SHA A;  1KA6 A;  1O49 A;  3GQI B;  3VRR A;  1I3Z A;  1O4D A;  3HCK A;  2DM0 A;  1QG1 E;  2KK6 A;  1A1B A;  5EEQ A;  1O4N A;  2DX0 A;  3QWX X;  1AYC A;  2RSY A;  3S8O A;  3CWG A;  2IUG A;  3TL0 A;  1FBV A;  2IUI A;  1ZFP E;  3VS0 A;  3WA4 A;  1OO3 A;  1SHB A;  2CBL A;  2EO6 A;  1GRI A;  2OQ1 A;  5EHR A;  4K2R A;  5GJH A;  5AUL A;  5DC4 A;  2H46 E;  2DLZ A;  4U1P A;  4D8K A;  1SPR A;  4JGH A;  2DVJ A;  2C0T A;  4XZ0 A;  1M61 A;  1LKL A;  4ROJ A;  4TZI A;  1IS0 A;  5I6V A;  1D1Z A;  1O4C A;  3OB1 B;  2OZO A;  3HIZ B;  1FHS A;  5DC9 A;  4GWF A;  2SHP A;  3VS2 A;  4F59 A;  2LCT A;  1SPS A;  1AD5 A;  1QCF A;  4EY0 A;  2MK2 A;  1BHF A;  5AXI A;  2LNX A;  3C7I A;  1CWE A;  4JEG A;  1HCS B;  4X6S A;  1O4O A;  1UUS A;  4OHE A;  2EYZ A;  2PLE A;  2LQW A;  2ABL A;  3BUX B;  3PSJ A;  5HKY A;  1PIC A;  1OPL A;  1A1E A;  5HKZ A;  1O4K A;  1O4R A;  1BLJ A;  3IMJ A;  3BUM B;  2EKX A;  1AOU F;  2CS0 A;  1P13 A;  2PNA A;  4F5B A;  1MW4 A;  2Y1M A;  3MXY A;  3S8L A;  1M27 A;  1LUM A;  4LUD A;  1YVL A;  1R1Q A;  3VS7 A;  2Y3A B;  1WQU A;  1O4H A;  2AUG A;  1O4Q A;  2YU7 A;  1O47 A;  2RVF A;  3EAZ A;  2ETZ A;  1O43 A;  1O41 A;  3VRN A;  4QSY A;  5CDW A;  1O4A A;  3UYO A;  3QWY A;  2PLD A;  1G83 A;  1OPK A;  2CI8 A;  1CSZ A;  1O44 A;  3PS5 A;  1X0N A;  3GXX A;  4NWF A;  3VS1 A;  5IBS A;  3VS4 A;  3EAC A;  5DF6 A;  1O46 A;  1LCJ A;  1X6C A;  3US4 A;  2CRH A;  1BFI A;  2KNO A;  1H9O A;  1A08 A;  4K45 A;  1HCT B;  1O4L A;  1JYR A;  4K11 A;  1LUK A;  1KC2 A;  1F2F A;  2LNW A;  1SKJ A;  1RPY A;  3N84 A;  2H5K A;  4FBN A;  1JYU A;  1A09 A;  1TCE A;  4GL9 E;  3PFV A;  3UF4 A;  2GSB A;  3OV1 A;  2C9W A;  2MQI A;  1RQQ C;  1O4B A;  1OO4 A;  4E93 A;  2EOB A;  4K44 A;  2AOA A;  1X27 A;  3VS3 A;  3NHN A;  3BKB A;  3VS5 A;  3HHM B;  3PQZ A;  4WWQ A;  4EIH A;  3CD3 A;  1Y57 A;  1CSY A;  3K2M A;  1R1S A;  1A81 A;  2MC1 A;  5KAZ A;  2QMS A;  2AOB A;  5HKW A;  2HDV A;  3N8M A;  2FO0 A;  3S9K A;  2BBU A;  2K7A B;  2HUW A;  2HDX A;  1BLK A;  3BUO B;  1NZV A;  2H8H A;  1O4I A;  4OHL A;  1LUN A;  5EG3 B;  1O4M A;  4E68 A;  4JE4 A;  3MAZ A;  1O4F A;  3CXL A;  3ZNI A;  1BM2 A;  1B47 A;  1BFJ A;  2SRC A;  1FBZ A;  4FL3 A;  5DC0 B;  2JYQ A;  5BO4 A;  3PJP A;  1MIL A;  2HMH A;  1LKK A;  1F1W A;  2CR4 A;  2EO3 A;  2EYV A;  2DLY A;  2MRJ A;  1Y1U A;  2C0I A;  1LUI A;  3N7Y A;  2MRK A;  3CBL A;  2L3T A;  3PLF B;  1BHH B;  2IUH A;  1JYQ A;  1O48 A;  2HCK A;  1BHH A;  2Y1N A;  5D0J A;  2L4K A;  3IMD A;  3VRY A;  4FL2 A;  1KA7 A;  4OHD A;  3VRZ A;  2PTK A;  2C0O A;  2YSX A;  1FMK A;  1D4T A;  4H34 A;  2CI9 A;  3OVE A;  4GPL B;  1FU5 A;  2ROR A;  2PNB A;  5GJI A;  1O4G A;  1NZL A;  4LUE A;  4M4Z A;  2RMX A;  2XP1 A;  3S8N A;  1O4E A;  2LQN A;  3M7F A;  1AOT F;  1D4W A;  1CWD L;  1A07 A;  1GHU A;  2FCI A;  1IJR A;  4A4C A;  3BUW B;  4XZ1 A;  1FU6 A;  1BMB A;  3VRO A;  1Z3K A;  2IZV A;  5EHP A;  2L6K A;  2EU0 A;  4L1B B;  4DGP A;  4OHH A;  1A1C A;  3PSK A;  1BG1 A;  1AYD A;  1KSW A;  4OHI A;  1CJ1 A;  3VRQ A;  2ECD A;  4H1O A;  3KFJ A;  1AYB A;  1UUR A;  3VRP A;  2K79 B;  1K9A A;  3IN7 A;  2CIA A;  4P9Z A;  3VS6 A;  3OB2 B;  4DGX A;  5J3X A;  5IBM A;  1O45 A;  2EYY A;  2GE9 A;  2EL8 A;  3GXW A;  1QAD A;  1A1A A;  1JWO A;  1O4J A;  1FYR A;  1TZE E;  1BF5 A;  2DCR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...