2HDXA

Crystal structure of the src homology-2 domain of sh2-b in complex with jak2 ptyr813 phosphopeptide
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
108
structure length
108
Chain Sequence
b'QPLSGYPWFHGMLSRLKAAQLVLEGGTGSHGVFLVRQSETRRGECVLTFNFQGKAKHLRLSLNAAGQCRVQHLHFQSIFDMLEHFRVHPIPLESGGSSDVVLVSYVPS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords SH2-B PH domain containing signaling mediator 1 gamma isofor
publication title Structural Basis for Phosphotyrosine Recognition by the Src Homology-2 Domains of the Adapter Proteins SH2-B and APS.
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein
total genus 28
structure length 108
sequence length 108
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2006-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00017 SH2 SH2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.505.10 Alpha Beta 2-Layer Sandwich SHC Adaptor Protein SH2 domain 2hdxA00
2CBLA 5DF6A 2DCRA 5GJHA 1A81A 3VS3A 2ETZA 1LCKA 5EEQA 2C0OA 2IUHA 1SHAA 1KC2A 4OHDA 4EY0A 4JE4A 1A1CA 1R1PA 1LCJA 1O47A 2XP1A 1O4LA 1D1ZA 1NZVA 2LQNA 4E93A 1CJ1A 3VS4A 2C0IA 2EKXA 1IS0A 1R1SA 1FU6A 4F5BA 1BHHB 3GXWA 3IN7A 4K45A 4F59A 3BUOB 2AUGA 2EYZA 1FBVA 3CWGA 1BKMA 1O45A 1BHHA 4D8KA 4EIHA 5KAZA 1TZEE 3BUXB 2L6KA 3PLFB 4DGXA 1O43A 3HCKA 1SHBA 2LNWA 2B3OA 2HCKA 2DLYA 2EYVA 2CI9A 3EACA 5HKWA 3VROA 4U1PA 1O4CA 2EO6A 4OHLA 1AB2A 1HCSB 3N84A 1O4JA 1G83A 3PSJA 3T04A 1CSYA 1FMKA 2SHPA 4OHIA 3KFJA 3VS5A 1O4QA 3OV1A 4XZ0A 3OB2B 3PJPA 1BFJA 4A4CA 3PSKA 3QWXX 2FCIA 1A07A 2IUGA 1LKLA 3BUWB 4U17A 1YVLA 1WQUA 1KSWA 1BKLA 2Y3AB 3TKZA 3K2MA 3VRYA 4OHEA 1OO4A 3CD3A 2EL8A 2GE9A 2K7AB 4NWFA 4P9ZA 5AULA 5DC0B 1O4EA 3VS0A 3GQIB 4QSYA 1F1WA 4OHHA 3CBLA 5DC9A 3PFVA 5AXIA 2DM0A 2IUIA 4WWQA 3QWYA 2OZOA 2PTKA 1BMBA 2AOAA 3OP0A 1IJRA 2HMHA 5CDWA 2YU7A 1BF5A 2HUWA 1OO3A 4X6SA 2SRCA 3BUMB 3VRZA 1JWOA 3IN8A 2EO3A 4M4ZA 1AOUF 2HDVA 2YSXA 3IMJA 2H46E 1LUKA 1O4MA 4ROJA 3WA4A 3NHNA 2K79B 2KK6A 3N7YA 5HKZA 4GPLB 2MRJA 2KNOA 1A08A 5J3XA 2ABLA 2Y1NA 1FBZA 1O42A 1Z3KA 2MQIA 2EYYA 1AOTF 3VS1A 1CWEA 2C9WA 1UURA 2OQ1A 2EOBA 5DC4A 1QCFA 5EELA 4JGHA 4FBNA 3VS6A 1CWDL 1FU5A 1JYQA 2PNAA 5IBSA 1GRIA 3HHMB 2MRKA 3M7FA 3MXCA 4K2RA 1A09A 1RQQC 1AYDA 1K9AA 2JYQA 2QMSA 1BHFA 3PQZA 2L3TA 5EG3B 2FO0A 3BUNB 2ECDA 1O46A 2L4KA 3S8LA 1LUNA 5GJIA 1BLJA 1AYCA 4LUEA 3VRPA 2EU0A 1OPKA 1O4GA 2CIAA 1A1EA 2LNXA 2PLDA 3S8OA 3VS2A 3PS5A 3C7IA 1HCTB 2GSBA 1O4KA 2LQWA 4H34A 2DLZA 1M61A 1FYRA 3UYOA 1LUMA 5EHRA 2CI8A 1D4WA 1NZLA 1BM2A 1LKKA 1X0NA 5IBMA 1O4AA 2RORA 2RSYA 3IMDA 3N8MA 1P13A 1JYRA 4XZ1A 3VRRA 2DVJA 1BFIA 1B47A 2CR4A 1UUSA 1O41A 2RVFA 4LUDA 1SPRA 4H1OA 1SPSA 4NWGA 1QG1E 1O4BA 3US4A 3OVEA 3VS7A 4GWFA 1F2FA 1OPLA 4FL3A 4F5AA 3VGOA 3VRQA 2Y1MA 4DGPA 1CSZA 1SKJA 2MC1A 3BKBA 3CXLA 1RPYA 3TL0A 3OB1B 1JYUA 1BLKA 3MAZA 5EHPA 1JU5A 1TCEA 1AD5A 1R1QA 3VRNA 4L1BB 1PICA 4E68A 3EAZA 1KA6A 3HIZB 2AOBA 1FHSA 5I6VA 2PNBA 4JEGA 1M27A 1GHUA 1O4IA 3UF4A 2C0TA 5BO4A 2MK2A 1MILA 2H8HA 2LCTA 2DX0A 2HDXA 4K44A 1O4NA 1SHDA 1BG1A 3MXYA 1O4PA 1I3ZA 1Y1UA 1XA6A 1A1BA 1Y57A 5D0JA 2CRHA 1O4DA 4TZIA 1KA7A 1O48A 1QADA 1YVHA 4K11A 1O4RA 1X6CA 1D4TA 1O4OA 4GL9E 2RMXA 2VIFA 1RJAA 3ZNIA 4P9VA 2IZVA 5HKYA 1ZFPE 1A1AA 2H5KA 1LUIA 4FL2A 1O4FA 2CS0A 1AYAA 3S8NA 1X27A 2PLEA 1O49A 2BBUA 3S9KA 3GXXA 1MW4A 1O44A 4A4BA 1AYBA 1NRVA 1H9OA 1O4HA
chains in the Genus database with same CATH superfamily
2CBLA 5DF6A 2DCRA 5GJHA 1A81A 3VS3A 2ETZA 1LCKA 5EEQA 2C0OA 2IUHA 1SHAA 1KC2A 4OHDA 4EY0A 4JE4A 1A1CA 1R1PA 1LCJA 1O47A 2XP1A 1O4LA 1D1ZA 1NZVA 2LQNA 4E93A 1CJ1A 3VS4A 2C0IA 2EKXA 1IS0A 1R1SA 1FU6A 4F5BA 1BHHB 3GXWA 3IN7A 4K45A 4F59A 3BUOB 2AUGA 2EYZA 1FBVA 3CWGA 1BKMA 1O45A 1BHHA 4D8KA 4EIHA 5KAZA 1TZEE 3BUXB 2L6KA 3PLFB 4DGXA 1O43A 3HCKA 1SHBA 2LNWA 2B3OA 2HCKA 2DLYA 2EYVA 2CI9A 3EACA 5HKWA 3VROA 4U1PA 1O4CA 2EO6A 4OHLA 1AB2A 1HCSB 3N84A 1O4JA 1G83A 3PSJA 3T04A 1CSYA 1FMKA 2SHPA 4OHIA 3KFJA 3VS5A 1O4QA 3OV1A 4XZ0A 3OB2B 3PJPA 1BFJA 4A4CA 3PSKA 3QWXX 2FCIA 1A07A 2IUGA 1LKLA 3BUWB 4U17A 1YVLA 1WQUA 1KSWA 1BKLA 2Y3AB 3TKZA 3K2MA 3VRYA 4OHEA 1OO4A 3CD3A 2EL8A 2GE9A 2K7AB 4NWFA 4P9ZA 5AULA 5DC0B 1O4EA 3VS0A 3GQIB 4QSYA 1F1WA 4OHHA 3CBLA 5DC9A 3PFVA 5AXIA 2DM0A 2IUIA 4WWQA 3QWYA 2OZOA 2PTKA 1BMBA 2AOAA 3OP0A 1IJRA 2HMHA 5CDWA 2YU7A 1BF5A 2HUWA 1OO3A 4X6SA 2SRCA 3BUMB 3VRZA 1JWOA 3IN8A 2EO3A 4M4ZA 1AOUF 2HDVA 2YSXA 3IMJA 2H46E 1LUKA 1O4MA 4ROJA 3WA4A 3NHNA 2K79B 2KK6A 3N7YA 5HKZA 4GPLB 2MRJA 2KNOA 1A08A 5J3XA 2ABLA 2Y1NA 1FBZA 1O42A 1Z3KA 2MQIA 2EYYA 1AOTF 3VS1A 1CWEA 2C9WA 1UURA 2OQ1A 2EOBA 1QCFA 5DC4A 5EELA 4JGHA 4FBNA 3VS6A 1CWDL 1FU5A 1JYQA 2PNAA 5IBSA 1GRIA 3HHMB 2MRKA 3M7FA 3MXCA 4K2RA 2LRAA 1A09A 1RQQC 1AYDA 1K9AA 2JYQA 2QMSA 1BHFA 3PQZA 2L3TA 3K2TA 5EG3B 2FO0A 3BUNB 2ECDA 1O46A 2L4KA 3S8LA 1LUNA 5GJIA 1BLJA 1AYCA 4LUEA 3VRPA 2EU0A 1OPKA 1O4GA 2CIAA 1A1EA 2LNXA 2PLDA 3S8OA 3VS2A 3PS5A 3C7IA 1HCTB 2GSBA 1O4KA 2LQWA 4H34A 2DLZA 1M61A 1FYRA 3UYOA 1LUMA 5EHRA 2CI8A 1D4WA 1NZLA 1BM2A 1LKKA 1X0NA 5IBMA 1O4AA 2RORA 2RSYA 3IMDA 3N8MA 1P13A 1JYRA 2KGYA 4XZ1A 3VRRA 2DVJA 1BFIA 1B47A 2CR4A 1UUSA 1O41A 2RVFA 4LUDA 1SPRA 4H1OA 1SPSA 4NWGA 1QG1E 1O4BA 3US4A 3OVEA 3VS7A 4GWFA 1F2FA 1OPLA 4FL3A 4F5AA 3VGOA 3VRQA 2Y1MA 4DGPA 1CSZA 1SKJA 2MC1A 3BKBA 3CXLA 1RPYA 3TL0A 3OB1B 1JYUA 1BLKA 3MAZA 5EHPA 1JU5A 1TCEA 1AD5A 1R1QA 3VRNA 4L1BB 1PICA 4E68A 3EAZA 1KA6A 3HIZB 2AOBA 1FHSA 5I6VA 2PNBA 4JEGA 1M27A 1GHUA 1O4IA 3UF4A 2C0TA 5BO4A 2MK2A 1MILA 3LYVA 2H8HA 2LCTA 2DX0A 2HDXA 4K44A 1O4NA 1SHDA 1BG1A 3MXYA 1O4PA 1I3ZA 1Y1UA 1XA6A 1A1BA 1Y57A 5D0JA 2CRHA 1O4DA 4TZIA 1KA7A 1O48A 1QADA 1YVHA 4K11A 1O4RA 1X6CA 1D4TA 1O4OA 4GL9E 2RMXA 2VIFA 1RJAA 3ZNIA 4P9VA 2IZVA 5HKYA 1ZFPE 1A1AA 2H5KA 1LUIA 4FL2A 1O4FA 2CS0A 1AYAA 3S8NA 1X27A 2PLEA 1O49A 2BBUA 3S9KA 3GXXA 1MW4A 1O44A 4A4BA 1AYBA 1NRVA 1H9OA 1O4HA
chains in the Genus database with same CATH topology
2CBLA 5DF6A 2DCRA 5GJHA 1A81A 3VS3A 2ETZA 1LCKA 5EEQA 2C0OA 2IUHA 1SHAA 1KC2A 4OHDA 4EY0A 4JE4A 1A1CA 1R1PA 1LCJA 1O47A 2XP1A 1O4LA 1D1ZA 1NZVA 2LQNA 4E93A 1CJ1A 3VS4A 2C0IA 2EKXA 1IS0A 1R1SA 1FU6A 4F5BA 1BHHB 3GXWA 3IN7A 4K45A 4F59A 3BUOB 2AUGA 2EYZA 1FBVA 3CWGA 1BKMA 1O45A 1BHHA 4D8KA 4EIHA 5KAZA 1TZEE 3BUXB 2L6KA 3PLFB 4DGXA 1O43A 3HCKA 1SHBA 2LNWA 2B3OA 2HCKA 2DLYA 2EYVA 2CI9A 3EACA 5HKWA 3VROA 4U1PA 1O4CA 2EO6A 4OHLA 1AB2A 1HCSB 3N84A 1O4JA 1G83A 3PSJA 3T04A 1CSYA 1FMKA 2SHPA 4OHIA 3KFJA 3VS5A 1O4QA 3OV1A 4XZ0A 3OB2B 3PJPA 1BFJA 4A4CA 3PSKA 3QWXX 2FCIA 1A07A 2IUGA 1LKLA 3BUWB 4U17A 1YVLA 1WQUA 1KSWA 1BKLA 2Y3AB 3TKZA 3K2MA 3VRYA 4OHEA 1OO4A 3CD3A 2EL8A 2GE9A 2K7AB 4NWFA 4P9ZA 5AULA 5DC0B 1O4EA 3VS0A 3GQIB 4QSYA 1F1WA 4OHHA 3CBLA 5DC9A 3PFVA 5AXIA 2DM0A 2IUIA 4WWQA 3QWYA 2OZOA 2PTKA 1BMBA 2AOAA 3OP0A 1IJRA 2HMHA 5CDWA 2YU7A 1BF5A 2HUWA 1OO3A 4X6SA 2SRCA 3BUMB 3VRZA 1JWOA 3IN8A 2EO3A 4M4ZA 1AOUF 2HDVA 2YSXA 3IMJA 2H46E 1LUKA 1O4MA 4ROJA 3WA4A 3NHNA 2K79B 2KK6A 3N7YA 5HKZA 4GPLB 2MRJA 2KNOA 1A08A 5J3XA 2ABLA 2Y1NA 1FBZA 1O42A 1Z3KA 2MQIA 2EYYA 1AOTF 3VS1A 1CWEA 2C9WA 1UURA 2OQ1A 2EOBA 5DC4A 1QCFA 5EELA 4JGHA 4FBNA 3VS6A 1CWDL 1FU5A 1JYQA 2PNAA 5IBSA 1GRIA 3HHMB 2MRKA 3M7FA 3MXCA 4K2RA 1A09A 1RQQC 1AYDA 1K9AA 2JYQA 2QMSA 1BHFA 3PQZA 2L3TA 5EG3B 2FO0A 3BUNB 2ECDA 1O46A 2L4KA 3S8LA 1LUNA 5GJIA 1BLJA 1AYCA 4LUEA 3VRPA 2EU0A 1OPKA 1O4GA 2CIAA 1A1EA 2LNXA 2PLDA 3S8OA 3VS2A 3PS5A 3C7IA 1HCTB 2GSBA 1O4KA 2LQWA 4H34A 2DLZA 1M61A 1FYRA 3UYOA 1LUMA 5EHRA 2CI8A 1D4WA 1NZLA 1BM2A 1LKKA 1X0NA 5IBMA 1O4AA 2RORA 2RSYA 3IMDA 3N8MA 1P13A 1JYRA 4XZ1A 3VRRA 2DVJA 1BFIA 1B47A 2CR4A 1UUSA 1O41A 2RVFA 4LUDA 1SPRA 4H1OA 1SPSA 4NWGA 1QG1E 1O4BA 3US4A 3OVEA 3VS7A 4GWFA 1F2FA 1OPLA 4FL3A 4F5AA 3VGOA 3VRQA 2Y1MA 4DGPA 1CSZA 1SKJA 2MC1A 3BKBA 3CXLA 1RPYA 3TL0A 3OB1B 1JYUA 1BLKA 3MAZA 5EHPA 1JU5A 1TCEA 1AD5A 1R1QA 3VRNA 4L1BB 1PICA 4E68A 3EAZA 1KA6A 3HIZB 2AOBA 1FHSA 5I6VA 2PNBA 4JEGA 1M27A 1GHUA 1O4IA 3UF4A 2C0TA 5BO4A 2MK2A 1MILA 2H8HA 2LCTA 2DX0A 2HDXA 4K44A 1O4NA 1SHDA 1BG1A 3MXYA 1O4PA 1I3ZA 1Y1UA 1XA6A 1A1BA 1Y57A 5D0JA 2CRHA 1O4DA 4TZIA 1KA7A 1O48A 1QADA 1YVHA 4K11A 1O4RA 1X6CA 1D4TA 1O4OA 4GL9E 2RMXA 2VIFA 1RJAA 3ZNIA 4P9VA 2IZVA 5HKYA 1ZFPE 1A1AA 2H5KA 1LUIA 4FL2A 1O4FA 2CS0A 1AYAA 3S8NA 1X27A 2PLEA 1O49A 2BBUA 3S9KA 3GXXA 1MW4A 1O44A 4A4BA 1AYBA 1NRVA 1H9OA 1O4HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CBL A;  5DF6 A;  2DCR A;  5GJH A;  1A81 A;  3VS3 A;  2ETZ A;  1LCK A;  5EEQ A;  2C0O A;  2IUH A;  1SHA A;  1KC2 A;  4OHD A;  4EY0 A;  4JE4 A;  1A1C A;  1R1P A;  1LCJ A;  1O47 A;  2XP1 A;  1O4L A;  1D1Z A;  1NZV A;  2LQN A;  4E93 A;  1CJ1 A;  3VS4 A;  2C0I A;  2EKX A;  1IS0 A;  1R1S A;  1FU6 A;  4F5B A;  1BHH B;  3GXW A;  3IN7 A;  4K45 A;  4F59 A;  3BUO B;  2AUG A;  2EYZ A;  1FBV A;  3CWG A;  1BKM A;  1O45 A;  1BHH A;  4D8K A;  4EIH A;  5KAZ A;  1TZE E;  3BUX B;  2L6K A;  3PLF B;  4DGX A;  1O43 A;  3HCK A;  1SHB A;  2LNW A;  2B3O A;  2HCK A;  2DLY A;  2EYV A;  2CI9 A;  3EAC A;  5HKW A;  3VRO A;  4U1P A;  1O4C A;  2EO6 A;  4OHL A;  1AB2 A;  1HCS B;  3N84 A;  1O4J A;  1G83 A;  3PSJ A;  3T04 A;  1CSY A;  1FMK A;  2SHP A;  4OHI A;  3KFJ A;  3VS5 A;  1O4Q A;  3OV1 A;  4XZ0 A;  3OB2 B;  3PJP A;  1BFJ A;  4A4C A;  3PSK A;  3QWX X;  2FCI A;  1A07 A;  2IUG A;  1LKL A;  3BUW B;  4U17 A;  1YVL A;  1WQU A;  1KSW A;  1BKL A;  2Y3A B;  3TKZ A;  3K2M A;  3VRY A;  4OHE A;  1OO4 A;  3CD3 A;  2EL8 A;  2GE9 A;  2K7A B;  4NWF A;  4P9Z A;  5AUL A;  5DC0 B;  1O4E A;  3VS0 A;  3GQI B;  4QSY A;  1F1W A;  4OHH A;  3CBL A;  5DC9 A;  3PFV A;  5AXI A;  2DM0 A;  2IUI A;  4WWQ A;  3QWY A;  2OZO A;  2PTK A;  1BMB A;  2AOA A;  3OP0 A;  1IJR A;  2HMH A;  5CDW A;  2YU7 A;  1BF5 A;  2HUW A;  1OO3 A;  4X6S A;  2SRC A;  3BUM B;  3VRZ A;  1JWO A;  3IN8 A;  2EO3 A;  4M4Z A;  1AOU F;  2HDV A;  2YSX A;  3IMJ A;  2H46 E;  1LUK A;  1O4M A;  4ROJ A;  3WA4 A;  3NHN A;  2K79 B;  2KK6 A;  3N7Y A;  5HKZ A;  4GPL B;  2MRJ A;  2KNO A;  1A08 A;  5J3X A;  2ABL A;  2Y1N A;  1FBZ A;  1O42 A;  1Z3K A;  2MQI A;  2EYY A;  1AOT F;  3VS1 A;  1CWE A;  2C9W A;  1UUR A;  2OQ1 A;  2EOB A;  5DC4 A;  1QCF A;  5EEL A;  4JGH A;  4FBN A;  3VS6 A;  1CWD L;  1FU5 A;  1JYQ A;  2PNA A;  5IBS A;  1GRI A;  3HHM B;  2MRK A;  3M7F A;  3MXC A;  4K2R A;  1A09 A;  1RQQ C;  1AYD A;  1K9A A;  2JYQ A;  2QMS A;  1BHF A;  3PQZ A;  2L3T A;  5EG3 B;  2FO0 A;  3BUN B;  2ECD A;  1O46 A;  2L4K A;  3S8L A;  1LUN A;  5GJI A;  1BLJ A;  1AYC A;  4LUE A;  3VRP A;  2EU0 A;  1OPK A;  1O4G A;  2CIA A;  1A1E A;  2LNX A;  2PLD A;  3S8O A;  3VS2 A;  3PS5 A;  3C7I A;  1HCT B;  2GSB A;  1O4K A;  2LQW A;  4H34 A;  2DLZ A;  1M61 A;  1FYR A;  3UYO A;  1LUM A;  5EHR A;  2CI8 A;  1D4W A;  1NZL A;  1BM2 A;  1LKK A;  1X0N A;  5IBM A;  1O4A A;  2ROR A;  2RSY A;  3IMD A;  3N8M A;  1P13 A;  1JYR A;  4XZ1 A;  3VRR A;  2DVJ A;  1BFI A;  1B47 A;  2CR4 A;  1UUS A;  1O41 A;  2RVF A;  4LUD A;  1SPR A;  4H1O A;  1SPS A;  4NWG A;  1QG1 E;  1O4B A;  3US4 A;  3OVE A;  3VS7 A;  4GWF A;  1F2F A;  1OPL A;  4FL3 A;  4F5A A;  3VGO A;  3VRQ A;  2Y1M A;  4DGP A;  1CSZ A;  1SKJ A;  2MC1 A;  3BKB A;  3CXL A;  1RPY A;  3TL0 A;  3OB1 B;  1JYU A;  1BLK A;  3MAZ A;  5EHP A;  1JU5 A;  1TCE A;  1AD5 A;  1R1Q A;  3VRN A;  4L1B B;  1PIC A;  4E68 A;  3EAZ A;  1KA6 A;  3HIZ B;  2AOB A;  1FHS A;  5I6V A;  2PNB A;  4JEG A;  1M27 A;  1GHU A;  1O4I A;  3UF4 A;  2C0T A;  5BO4 A;  2MK2 A;  1MIL A;  2H8H A;  2LCT A;  2DX0 A;  2HDX A;  4K44 A;  1O4N A;  1SHD A;  1BG1 A;  3MXY A;  1O4P A;  1I3Z A;  1Y1U A;  1XA6 A;  1A1B A;  1Y57 A;  5D0J A;  2CRH A;  1O4D A;  4TZI A;  1KA7 A;  1O48 A;  1QAD A;  1YVH A;  4K11 A;  1O4R A;  1X6C A;  1D4T A;  1O4O A;  4GL9 E;  2RMX A;  2VIF A;  1RJA A;  3ZNI A;  4P9V A;  2IZV A;  5HKY A;  1ZFP E;  1A1A A;  2H5K A;  1LUI A;  4FL2 A;  1O4F A;  2CS0 A;  1AYA A;  3S8N A;  1X27 A;  2PLE A;  1O49 A;  2BBU A;  3S9K A;  3GXX A;  1MW4 A;  1O44 A;  4A4B A;  1AYB A;  1NRV A;  1H9O A;  1O4H A; 
#chains in the Genus database with same CATH topology
 2CBL A;  5DF6 A;  2DCR A;  5GJH A;  1A81 A;  3VS3 A;  2ETZ A;  1LCK A;  5EEQ A;  2C0O A;  2IUH A;  1SHA A;  1KC2 A;  4OHD A;  4EY0 A;  4JE4 A;  1A1C A;  1R1P A;  1LCJ A;  1O47 A;  2XP1 A;  1O4L A;  1D1Z A;  1NZV A;  2LQN A;  4E93 A;  1CJ1 A;  3VS4 A;  2C0I A;  2EKX A;  1IS0 A;  1R1S A;  1FU6 A;  4F5B A;  1BHH B;  3GXW A;  3IN7 A;  4K45 A;  4F59 A;  3BUO B;  2AUG A;  2EYZ A;  1FBV A;  3CWG A;  1BKM A;  1O45 A;  1BHH A;  4D8K A;  4EIH A;  5KAZ A;  1TZE E;  3BUX B;  2L6K A;  3PLF B;  4DGX A;  1O43 A;  3HCK A;  1SHB A;  2LNW A;  2B3O A;  2HCK A;  2DLY A;  2EYV A;  2CI9 A;  3EAC A;  5HKW A;  3VRO A;  4U1P A;  1O4C A;  2EO6 A;  4OHL A;  1AB2 A;  1HCS B;  3N84 A;  1O4J A;  1G83 A;  3PSJ A;  3T04 A;  1CSY A;  1FMK A;  2SHP A;  4OHI A;  3KFJ A;  3VS5 A;  1O4Q A;  3OV1 A;  4XZ0 A;  3OB2 B;  3PJP A;  1BFJ A;  4A4C A;  3PSK A;  3QWX X;  2FCI A;  1A07 A;  2IUG A;  1LKL A;  3BUW B;  4U17 A;  1YVL A;  1WQU A;  1KSW A;  1BKL A;  2Y3A B;  3TKZ A;  3K2M A;  3VRY A;  4OHE A;  1OO4 A;  3CD3 A;  2EL8 A;  2GE9 A;  2K7A B;  4NWF A;  4P9Z A;  5AUL A;  5DC0 B;  1O4E A;  3VS0 A;  3GQI B;  4QSY A;  1F1W A;  4OHH A;  3CBL A;  5DC9 A;  3PFV A;  5AXI A;  2DM0 A;  2IUI A;  4WWQ A;  3QWY A;  2OZO A;  2PTK A;  1BMB A;  2AOA A;  3OP0 A;  1IJR A;  2HMH A;  5CDW A;  2YU7 A;  1BF5 A;  2HUW A;  1OO3 A;  4X6S A;  2SRC A;  3BUM B;  3VRZ A;  1JWO A;  3IN8 A;  2EO3 A;  4M4Z A;  1AOU F;  2HDV A;  2YSX A;  3IMJ A;  2H46 E;  1LUK A;  1O4M A;  4ROJ A;  3WA4 A;  3NHN A;  2K79 B;  2KK6 A;  3N7Y A;  5HKZ A;  4GPL B;  2MRJ A;  2KNO A;  1A08 A;  5J3X A;  2ABL A;  2Y1N A;  1FBZ A;  1O42 A;  1Z3K A;  2MQI A;  2EYY A;  1AOT F;  3VS1 A;  1CWE A;  2C9W A;  1UUR A;  2OQ1 A;  2EOB A;  1QCF A;  5DC4 A;  5EEL A;  4JGH A;  4FBN A;  3VS6 A;  1CWD L;  1FU5 A;  1JYQ A;  2PNA A;  5IBS A;  1GRI A;  3HHM B;  2MRK A;  3M7F A;  3MXC A;  4K2R A;  2LRA A;  1A09 A;  1RQQ C;  1AYD A;  1K9A A;  2JYQ A;  2QMS A;  1BHF A;  3PQZ A;  2L3T A;  3K2T A;  5EG3 B;  2FO0 A;  3BUN B;  2ECD A;  1O46 A;  2L4K A;  3S8L A;  1LUN A;  5GJI A;  1BLJ A;  1AYC A;  4LUE A;  3VRP A;  2EU0 A;  1OPK A;  1O4G A;  2CIA A;  1A1E A;  2LNX A;  2PLD A;  3S8O A;  3VS2 A;  3PS5 A;  3C7I A;  1HCT B;  2GSB A;  1O4K A;  2LQW A;  4H34 A;  2DLZ A;  1M61 A;  1FYR A;  3UYO A;  1LUM A;  5EHR A;  2CI8 A;  1D4W A;  1NZL A;  1BM2 A;  1LKK A;  1X0N A;  5IBM A;  1O4A A;  2ROR A;  2RSY A;  3IMD A;  3N8M A;  1P13 A;  1JYR A;  2KGY A;  4XZ1 A;  3VRR A;  2DVJ A;  1BFI A;  1B47 A;  2CR4 A;  1UUS A;  1O41 A;  2RVF A;  4LUD A;  1SPR A;  4H1O A;  1SPS A;  4NWG A;  1QG1 E;  1O4B A;  3US4 A;  3OVE A;  3VS7 A;  4GWF A;  1F2F A;  1OPL A;  4FL3 A;  4F5A A;  3VGO A;  3VRQ A;  2Y1M A;  4DGP A;  1CSZ A;  1SKJ A;  2MC1 A;  3BKB A;  3CXL A;  1RPY A;  3TL0 A;  3OB1 B;  1JYU A;  1BLK A;  3MAZ A;  5EHP A;  1JU5 A;  1TCE A;  1AD5 A;  1R1Q A;  3VRN A;  4L1B B;  1PIC A;  4E68 A;  3EAZ A;  1KA6 A;  3HIZ B;  2AOB A;  1FHS A;  5I6V A;  2PNB A;  4JEG A;  1M27 A;  1GHU A;  1O4I A;  3UF4 A;  2C0T A;  5BO4 A;  2MK2 A;  1MIL A;  3LYV A;  2H8H A;  2LCT A;  2DX0 A;  2HDX A;  4K44 A;  1O4N A;  1SHD A;  1BG1 A;  3MXY A;  1O4P A;  1I3Z A;  1Y1U A;  1XA6 A;  1A1B A;  1Y57 A;  5D0J A;  2CRH A;  1O4D A;  4TZI A;  1KA7 A;  1O48 A;  1QAD A;  1YVH A;  4K11 A;  1O4R A;  1X6C A;  1D4T A;  1O4O A;  4GL9 E;  2RMX A;  2VIF A;  1RJA A;  3ZNI A;  4P9V A;  2IZV A;  5HKY A;  1ZFP E;  1A1A A;  2H5K A;  1LUI A;  4FL2 A;  1O4F A;  2CS0 A;  1AYA A;  3S8N A;  1X27 A;  2PLE A;  1O49 A;  2BBU A;  3S9K A;  3GXX A;  1MW4 A;  1O44 A;  4A4B A;  1AYB A;  1NRV A;  1H9O A;  1O4H A; 
#chains in the Genus database with same CATH homology
 2CBL A;  5DF6 A;  2DCR A;  5GJH A;  1A81 A;  3VS3 A;  2ETZ A;  1LCK A;  5EEQ A;  2C0O A;  2IUH A;  1SHA A;  1KC2 A;  4OHD A;  4EY0 A;  4JE4 A;  1A1C A;  1R1P A;  1LCJ A;  1O47 A;  2XP1 A;  1O4L A;  1D1Z A;  1NZV A;  2LQN A;  4E93 A;  1CJ1 A;  3VS4 A;  2C0I A;  2EKX A;  1IS0 A;  1R1S A;  1FU6 A;  4F5B A;  1BHH B;  3GXW A;  3IN7 A;  4K45 A;  4F59 A;  3BUO B;  2AUG A;  2EYZ A;  1FBV A;  3CWG A;  1BKM A;  1O45 A;  1BHH A;  4D8K A;  4EIH A;  5KAZ A;  1TZE E;  3BUX B;  2L6K A;  3PLF B;  4DGX A;  1O43 A;  3HCK A;  1SHB A;  2LNW A;  2B3O A;  2HCK A;  2DLY A;  2EYV A;  2CI9 A;  3EAC A;  5HKW A;  3VRO A;  4U1P A;  1O4C A;  2EO6 A;  4OHL A;  1AB2 A;  1HCS B;  3N84 A;  1O4J A;  1G83 A;  3PSJ A;  3T04 A;  1CSY A;  1FMK A;  2SHP A;  4OHI A;  3KFJ A;  3VS5 A;  1O4Q A;  3OV1 A;  4XZ0 A;  3OB2 B;  3PJP A;  1BFJ A;  4A4C A;  3PSK A;  3QWX X;  2FCI A;  1A07 A;  2IUG A;  1LKL A;  3BUW B;  4U17 A;  1YVL A;  1WQU A;  1KSW A;  1BKL A;  2Y3A B;  3TKZ A;  3K2M A;  3VRY A;  4OHE A;  1OO4 A;  3CD3 A;  2EL8 A;  2GE9 A;  2K7A B;  4NWF A;  4P9Z A;  5AUL A;  5DC0 B;  1O4E A;  3VS0 A;  3GQI B;  4QSY A;  1F1W A;  4OHH A;  3CBL A;  5DC9 A;  3PFV A;  5AXI A;  2DM0 A;  2IUI A;  4WWQ A;  3QWY A;  2OZO A;  2PTK A;  1BMB A;  2AOA A;  3OP0 A;  1IJR A;  2HMH A;  5CDW A;  2YU7 A;  1BF5 A;  2HUW A;  1OO3 A;  4X6S A;  2SRC A;  3BUM B;  3VRZ A;  1JWO A;  3IN8 A;  2EO3 A;  4M4Z A;  1AOU F;  2HDV A;  2YSX A;  3IMJ A;  2H46 E;  1LUK A;  1O4M A;  4ROJ A;  3WA4 A;  3NHN A;  2K79 B;  2KK6 A;  3N7Y A;  5HKZ A;  4GPL B;  2MRJ A;  2KNO A;  1A08 A;  5J3X A;  2ABL A;  2Y1N A;  1FBZ A;  1O42 A;  1Z3K A;  2MQI A;  2EYY A;  1AOT F;  3VS1 A;  1CWE A;  2C9W A;  1UUR A;  2OQ1 A;  2EOB A;  5DC4 A;  1QCF A;  5EEL A;  4JGH A;  4FBN A;  3VS6 A;  1CWD L;  1FU5 A;  1JYQ A;  2PNA A;  5IBS A;  1GRI A;  3HHM B;  2MRK A;  3M7F A;  3MXC A;  4K2R A;  1A09 A;  1RQQ C;  1AYD A;  1K9A A;  2JYQ A;  2QMS A;  1BHF A;  3PQZ A;  2L3T A;  5EG3 B;  2FO0 A;  3BUN B;  2ECD A;  1O46 A;  2L4K A;  3S8L A;  1LUN A;  5GJI A;  1BLJ A;  1AYC A;  4LUE A;  3VRP A;  2EU0 A;  1OPK A;  1O4G A;  2CIA A;  1A1E A;  2LNX A;  2PLD A;  3S8O A;  3VS2 A;  3PS5 A;  3C7I A;  1HCT B;  2GSB A;  1O4K A;  2LQW A;  4H34 A;  2DLZ A;  1M61 A;  1FYR A;  3UYO A;  1LUM A;  5EHR A;  2CI8 A;  1D4W A;  1NZL A;  1BM2 A;  1LKK A;  1X0N A;  5IBM A;  1O4A A;  2ROR A;  2RSY A;  3IMD A;  3N8M A;  1P13 A;  1JYR A;  4XZ1 A;  3VRR A;  2DVJ A;  1BFI A;  1B47 A;  2CR4 A;  1UUS A;  1O41 A;  2RVF A;  4LUD A;  1SPR A;  4H1O A;  1SPS A;  4NWG A;  1QG1 E;  1O4B A;  3US4 A;  3OVE A;  3VS7 A;  4GWF A;  1F2F A;  1OPL A;  4FL3 A;  4F5A A;  3VGO A;  3VRQ A;  2Y1M A;  4DGP A;  1CSZ A;  1SKJ A;  2MC1 A;  3BKB A;  3CXL A;  1RPY A;  3TL0 A;  3OB1 B;  1JYU A;  1BLK A;  3MAZ A;  5EHP A;  1JU5 A;  1TCE A;  1AD5 A;  1R1Q A;  3VRN A;  4L1B B;  1PIC A;  4E68 A;  3EAZ A;  1KA6 A;  3HIZ B;  2AOB A;  1FHS A;  5I6V A;  2PNB A;  4JEG A;  1M27 A;  1GHU A;  1O4I A;  3UF4 A;  2C0T A;  5BO4 A;  2MK2 A;  1MIL A;  2H8H A;  2LCT A;  2DX0 A;  2HDX A;  4K44 A;  1O4N A;  1SHD A;  1BG1 A;  3MXY A;  1O4P A;  1I3Z A;  1Y1U A;  1XA6 A;  1A1B A;  1Y57 A;  5D0J A;  2CRH A;  1O4D A;  4TZI A;  1KA7 A;  1O48 A;  1QAD A;  1YVH A;  4K11 A;  1O4R A;  1X6C A;  1D4T A;  1O4O A;  4GL9 E;  2RMX A;  2VIF A;  1RJA A;  3ZNI A;  4P9V A;  2IZV A;  5HKY A;  1ZFP E;  1A1A A;  2H5K A;  1LUI A;  4FL2 A;  1O4F A;  2CS0 A;  1AYA A;  3S8N A;  1X27 A;  2PLE A;  1O49 A;  2BBU A;  3S9K A;  3GXX A;  1MW4 A;  1O44 A;  4A4B A;  1AYB A;  1NRV A;  1H9O A;  1O4H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...