1AOTF

Nmr structure of the fyn sh2 domain complexed with a phosphotyrosyl peptide, minimized average structure
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
106
structure length
106
Chain Sequence
b'SIQAEEWYFGKLGRKDAERQLLSFGNPRGTFLIRESETTKGAYSLSIRDWDDMKGDHVKHYKIRKLDNGGYYITTRAQFETLQQLVQHYSERAAGLSSRLVVPSHK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FYN PROTEIN-TYROSINE KINASE
publication title The SH2 domain from the tyrosine kinase Fyn in complex with a phosphotyrosyl peptide reveals insights into domain stability and binding specificity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Complex (proto-oncogene/early protein)
total genus 12
structure length 106
sequence length 106
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 1997-07-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF00017 SH2 SH2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.505.10 Alpha Beta 2-Layer Sandwich SHC Adaptor Protein SH2 domain 1aotF00
1SHDA 1X6CA 4JEGA 4DGPA 1LCJA 2L4KA 5DC9A 4FL3A 5DC4A 1D4WA 3S8NA 3PLFB 2C0OA 1SPSA 2RMXA 2IUHA 3GQIB 2JYQA 1HCSB 1BG1A 3MXYA 2DLZA 1RPYA 2OZOA 3VRYA 2PLEA 1O4HA 3VS1A 3GXWA 2RSYA 2LQNA 3CBLA 2MRJA 3OP0A 4EY0A 1O45A 1H9OA 2EO6A 3CWGA 3VS4A 1OO3A 5DC0B 3WA4A 1O4JA 1P13A 1AD5A 1FU5A 2KK6A 5CDWA 1CWDL 4OHHA 1CJ1A 4X6SA 5GJIA 3TKZA 1BF5A 1JYRA 1PICA 1TZEE 1A81A 4F5AA 3C7IA 1O4KA 1A08A 1M27A 1AYAA 2CS0A 1QCFA 1LKLA 3HCKA 5KAZA 1JU5A 4JE4A 2MC1A 1LUMA 2Y1MA 5AULA 4XZ0A 2GSBA 1O48A 2C0TA 5AXIA 1A1EA 2EU0A 4FL2A 2HDVA 1X0NA 2RVFA 1OPLA 2DVJA 2DLYA 4ROJA 1WQUA 2AUGA 3OB2B 4D8KA 2EYZA 1O44A 3UF4A 3IN8A 1BM2A 4OHIA 1LKKA 1BHHB 1AOUF 2HMHA 1D4TA 4A4CA 1JWOA 2C9WA 1O4PA 4H1OA 1I3ZA 1BLJA 1LUKA 1KSWA 2ABLA 1AYCA 3IN7A 1O49A 3VS2A 1RJAA 2EOBA 3VS5A 1BHFA 3US4A 4K2RA 2KNOA 2EYVA 1SHAA 3BUOB 2CBLA 2PNBA 2H5KA 3VS7A 1BFIA 5D0JA 1BLKA 3S8OA 4F59A 4QSYA 1JYQA 1MW4A 1O4EA 1QG1E 1UURA 1YVHA 1UUSA 1KC2A 1LCKA 3HIZB 1O47A 3IMDA 4GWFA 2EYYA 3M7FA 5HKWA 2FO0A 3VRPA 4L1BB 1SPRA 1KA7A 3PFVA 1SKJA 3S8LA 3VS0A 1BKLA 3T04A 2LQWA 3VRQA 2MRKA 1HCTB 3PQZA 4U1PA 4NWFA 3ZNIA 2L6KA 5EG3B 1BFJA 2PNAA 1O4RA 1NZLA 2XP1A 1A09A 3QWXX 3VROA 1SHBA 1O41A 2L3TA 1A1CA 3NHNA 3N7YA 2LNXA 2OQ1A 2VIFA 3GXXA 1Y1UA 4K45A 4K44A 2IUIA 3K2MA 3HHMB 4P9VA 1MILA 2H46E 3QWYA 3VGOA 4GPLB 1AYBA 2LNWA 2LCTA 1OPKA 5EHRA 3VRZA 1F1WA 1XA6A 3BUMB 1O4IA 1O4FA 1FU6A 1LUIA 1O4LA 1R1SA 1QADA 3CD3A 2RORA 4E93A 2CRHA 1BHHA 1O4OA 1F2FA 1FBZA 2YSXA 5IBSA 4NWGA 3CXLA 4TZIA 2QMSA 1LUNA 2DCRA 2BBUA 1JYUA 1G83A 2AOAA 3OV1A 4K11A 2C0IA 5DF6A 2ETZA 4OHLA 1A1AA 1O4MA 4LUEA 2SRCA 4FBNA 1FHSA 2AOBA 1X27A 2ECDA 1OO4A 2DM0A 1NZVA 2IUGA 5J3XA 1KA6A 4A4BA 1R1PA 3N84A 3VS3A 1O4AA 2EKXA 5I6VA 2EO3A 2Y3AB 1FMKA 4XZ1A 4E68A 4F5BA 2EL8A 3MXCA 2SHPA 4H34A 2CIAA 1ZFPE 1GHUA 5BO4A 2IZVA 5EELA 1O4DA 3MAZA 5IBMA 3PSKA 5GJHA 3VRRA 3BUWB 2GE9A 2CI8A 3EAZA 1D1ZA 2B3OA 3OVEA 1O4BA 4JGHA 3VS6A 1O4NA 4WWQA 1GRIA 2DX0A 1AOTF 2Y1NA 3PS5A 5EEQA 2CI9A 1FYRA 3KFJA 1IS0A 3BUXB 5HKYA 3S9KA 4P9ZA 4M4ZA 1FBVA 4OHDA 4EIHA 1RQQC 3OB1B 2YU7A 1O4GA 2HUWA 1R1QA 1O4CA 1Z3KA 1A1BA 3BUNB 2PLDA 5EHPA 3IMJA 1CSYA 1IJRA 3EACA 2HDXA 2PTKA 3PJPA 3BKBA 4OHEA 4U17A 4DGXA 3TL0A 2K79B 1A07A 1BMBA 3VRNA 2HCKA 3PSJA 3N8MA 1TCEA 1O42A 2CR4A 2H8HA 1AYDA 1B47A 1CSZA 4LUDA 2MK2A 1Y57A 1NRVA 5HKZA 4GL9E 1BKMA 1CWEA 1M61A 1YVLA 3UYOA 2K7AB 1AB2A 1O46A 2FCIA 1K9AA 1O43A 1O4QA 2MQIA
chains in the Genus database with same CATH superfamily
1SHDA 1X6CA 4JEGA 4DGPA 1LCJA 2L4KA 5DC9A 4FL3A 5DC4A 1D4WA 3S8NA 3PLFB 2C0OA 1SPSA 2RMXA 2IUHA 3GQIB 2JYQA 1HCSB 1BG1A 3MXYA 2DLZA 1RPYA 2OZOA 3VRYA 2PLEA 1O4HA 3VS1A 3GXWA 2RSYA 2LQNA 3CBLA 2MRJA 3OP0A 4EY0A 1O45A 1H9OA 2EO6A 3CWGA 3VS4A 1OO3A 5DC0B 3WA4A 1O4JA 1P13A 1AD5A 1FU5A 2KK6A 5CDWA 1CWDL 4OHHA 1CJ1A 4X6SA 5GJIA 3TKZA 1BF5A 1JYRA 1PICA 1TZEE 1A81A 4F5AA 3C7IA 1O4KA 1A08A 1M27A 1AYAA 2CS0A 1QCFA 1LKLA 3HCKA 5KAZA 1JU5A 4JE4A 2MC1A 1LUMA 2Y1MA 5AULA 4XZ0A 2GSBA 1O48A 2C0TA 5AXIA 1A1EA 2EU0A 4FL2A 2HDVA 1X0NA 2RVFA 1OPLA 2DVJA 2DLYA 4ROJA 1WQUA 2AUGA 3OB2B 4D8KA 2EYZA 1O44A 3UF4A 3IN8A 1BM2A 4OHIA 1LKKA 1BHHB 1AOUF 2HMHA 1D4TA 4A4CA 1JWOA 2C9WA 1O4PA 4H1OA 1I3ZA 1BLJA 1LUKA 1KSWA 2ABLA 1AYCA 3IN7A 1O49A 3VS2A 1RJAA 2EOBA 3VS5A 1BHFA 3US4A 4K2RA 2KNOA 2EYVA 1SHAA 3BUOB 2CBLA 2PNBA 2H5KA 3VS7A 1BFIA 5D0JA 1BLKA 3S8OA 4F59A 4QSYA 1JYQA 1MW4A 1O4EA 1QG1E 1UURA 1YVHA 1UUSA 1KC2A 1LCKA 3HIZB 1O47A 3IMDA 4GWFA 2EYYA 3M7FA 5HKWA 2FO0A 3VRPA 4L1BB 1SPRA 1KA7A 3PFVA 1SKJA 3S8LA 3VS0A 1BKLA 3T04A 2LQWA 3VRQA 2MRKA 1HCTB 3PQZA 4U1PA 4NWFA 3ZNIA 2L6KA 5EG3B 1BFJA 2PNAA 1O4RA 1NZLA 2XP1A 1A09A 3QWXX 3VROA 1SHBA 1O41A 2L3TA 1A1CA 3NHNA 3N7YA 2LNXA 2OQ1A 2VIFA 3GXXA 1Y1UA 4K45A 4K44A 3LYVA 2IUIA 3K2MA 3HHMB 4P9VA 1MILA 2H46E 3QWYA 3VGOA 4GPLB 1AYBA 2LNWA 2LRAA 2LCTA 1OPKA 5EHRA 3VRZA 1F1WA 1XA6A 3BUMB 1O4IA 1O4FA 1FU6A 1LUIA 1O4LA 1R1SA 1QADA 3CD3A 2RORA 4E93A 2CRHA 1BHHA 1O4OA 1F2FA 1FBZA 2YSXA 5IBSA 4NWGA 3CXLA 4TZIA 2QMSA 1LUNA 2DCRA 2BBUA 1JYUA 1G83A 2AOAA 3OV1A 4K11A 2C0IA 5DF6A 2ETZA 4OHLA 1A1AA 1O4MA 4LUEA 2SRCA 4FBNA 1FHSA 2AOBA 1X27A 2ECDA 1OO4A 2DM0A 1NZVA 2IUGA 5J3XA 1KA6A 4A4BA 1R1PA 3N84A 3VS3A 1O4AA 2EKXA 5I6VA 2EO3A 2Y3AB 1FMKA 4XZ1A 4E68A 4F5BA 2EL8A 3MXCA 2SHPA 4H34A 2CIAA 1ZFPE 1GHUA 5BO4A 2IZVA 5EELA 1O4DA 3MAZA 5IBMA 3PSKA 5GJHA 3VRRA 3BUWB 2GE9A 2CI8A 3EAZA 1D1ZA 2B3OA 3OVEA 1O4BA 4JGHA 3VS6A 1O4NA 4WWQA 1GRIA 2DX0A 1AOTF 3K2TA 2Y1NA 3PS5A 5EEQA 2CI9A 1FYRA 3KFJA 1IS0A 3BUXB 5HKYA 3S9KA 4P9ZA 4M4ZA 1FBVA 4OHDA 4EIHA 1RQQC 3OB1B 2YU7A 1O4GA 2HUWA 1R1QA 1O4CA 1Z3KA 1A1BA 3BUNB 2PLDA 2KGYA 5EHPA 3IMJA 1CSYA 1IJRA 3EACA 2HDXA 2PTKA 3PJPA 3BKBA 4OHEA 4U17A 4DGXA 3TL0A 2K79B 1A07A 1BMBA 3VRNA 2HCKA 3PSJA 3N8MA 1TCEA 1O42A 2CR4A 2H8HA 1AYDA 1B47A 1CSZA 4LUDA 2MK2A 1Y57A 1NRVA 5HKZA 4GL9E 1BKMA 1CWEA 1M61A 1YVLA 3UYOA 2K7AB 1AB2A 1O46A 2FCIA 1K9AA 1O43A 1O4QA 2MQIA
chains in the Genus database with same CATH topology
1SHDA 1X6CA 4JEGA 4DGPA 1LCJA 2L4KA 5DC9A 4FL3A 5DC4A 1D4WA 3S8NA 3PLFB 2C0OA 1SPSA 2RMXA 2IUHA 3GQIB 2JYQA 1HCSB 1BG1A 3MXYA 2DLZA 1RPYA 2OZOA 3VRYA 2PLEA 1O4HA 3VS1A 3GXWA 2RSYA 2LQNA 3CBLA 2MRJA 3OP0A 4EY0A 1O45A 1H9OA 2EO6A 3CWGA 3VS4A 1OO3A 5DC0B 3WA4A 1O4JA 1P13A 1AD5A 1FU5A 2KK6A 5CDWA 1CWDL 4OHHA 1CJ1A 4X6SA 5GJIA 3TKZA 1BF5A 1JYRA 1PICA 1TZEE 1A81A 4F5AA 3C7IA 1O4KA 1A08A 1M27A 1AYAA 2CS0A 1QCFA 1LKLA 3HCKA 5KAZA 1JU5A 4JE4A 2MC1A 1LUMA 2Y1MA 5AULA 4XZ0A 2GSBA 1O48A 2C0TA 5AXIA 1A1EA 2EU0A 4FL2A 2HDVA 1X0NA 2RVFA 1OPLA 2DVJA 2DLYA 4ROJA 1WQUA 2AUGA 3OB2B 4D8KA 2EYZA 1O44A 3UF4A 3IN8A 1BM2A 4OHIA 1LKKA 1BHHB 1AOUF 2HMHA 1D4TA 4A4CA 1JWOA 2C9WA 1O4PA 4H1OA 1I3ZA 1BLJA 1LUKA 1KSWA 2ABLA 1AYCA 3IN7A 1O49A 3VS2A 1RJAA 2EOBA 3VS5A 1BHFA 3US4A 4K2RA 2KNOA 2EYVA 1SHAA 3BUOB 2CBLA 2PNBA 2H5KA 3VS7A 1BFIA 5D0JA 1BLKA 3S8OA 4F59A 4QSYA 1JYQA 1MW4A 1O4EA 1QG1E 1UURA 1YVHA 1UUSA 1KC2A 1LCKA 3HIZB 1O47A 3IMDA 4GWFA 2EYYA 3M7FA 5HKWA 2FO0A 3VRPA 4L1BB 1SPRA 1KA7A 3PFVA 1SKJA 3S8LA 3VS0A 1BKLA 3T04A 2LQWA 3VRQA 2MRKA 1HCTB 3PQZA 4U1PA 4NWFA 3ZNIA 2L6KA 5EG3B 1BFJA 2PNAA 1O4RA 1NZLA 2XP1A 1A09A 3QWXX 3VROA 1SHBA 1O41A 2L3TA 1A1CA 3NHNA 3N7YA 2LNXA 2OQ1A 2VIFA 3GXXA 1Y1UA 4K45A 4K44A 2IUIA 3K2MA 3HHMB 4P9VA 1MILA 2H46E 3QWYA 3VGOA 4GPLB 1AYBA 2LNWA 2LCTA 1OPKA 5EHRA 3VRZA 1F1WA 1XA6A 3BUMB 1O4IA 1O4FA 1FU6A 1LUIA 1O4LA 1R1SA 1QADA 3CD3A 2RORA 4E93A 2CRHA 1BHHA 1O4OA 1F2FA 1FBZA 2YSXA 5IBSA 4NWGA 3CXLA 4TZIA 2QMSA 1LUNA 2DCRA 2BBUA 1JYUA 1G83A 2AOAA 3OV1A 4K11A 2C0IA 5DF6A 2ETZA 4OHLA 1A1AA 1O4MA 4LUEA 2SRCA 4FBNA 1FHSA 2AOBA 1X27A 2ECDA 1OO4A 2DM0A 1NZVA 2IUGA 5J3XA 1KA6A 4A4BA 1R1PA 3N84A 3VS3A 1O4AA 2EKXA 5I6VA 2EO3A 2Y3AB 1FMKA 4XZ1A 4E68A 4F5BA 2EL8A 3MXCA 2SHPA 4H34A 2CIAA 1ZFPE 1GHUA 5BO4A 2IZVA 5EELA 1O4DA 3MAZA 5IBMA 3PSKA 5GJHA 3VRRA 3BUWB 2GE9A 2CI8A 3EAZA 1D1ZA 2B3OA 3OVEA 1O4BA 4JGHA 3VS6A 1O4NA 4WWQA 1GRIA 2DX0A 1AOTF 2Y1NA 3PS5A 5EEQA 2CI9A 1FYRA 3KFJA 1IS0A 3BUXB 5HKYA 3S9KA 4P9ZA 4M4ZA 1FBVA 4OHDA 4EIHA 1RQQC 3OB1B 2YU7A 1O4GA 2HUWA 1R1QA 1O4CA 1Z3KA 1A1BA 3BUNB 2PLDA 5EHPA 3IMJA 1CSYA 1IJRA 3EACA 2HDXA 2PTKA 3PJPA 3BKBA 4OHEA 4U17A 4DGXA 3TL0A 2K79B 1A07A 1BMBA 3VRNA 2HCKA 3PSJA 3N8MA 1TCEA 1O42A 2CR4A 2H8HA 1AYDA 1B47A 1CSZA 4LUDA 2MK2A 1Y57A 1NRVA 5HKZA 4GL9E 1BKMA 1CWEA 1M61A 1YVLA 3UYOA 2K7AB 1AB2A 1O46A 2FCIA 1K9AA 1O43A 1O4QA 2MQIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SHD A;  1X6C A;  4JEG A;  4DGP A;  1LCJ A;  2L4K A;  5DC9 A;  4FL3 A;  5DC4 A;  1D4W A;  3S8N A;  3PLF B;  2C0O A;  1SPS A;  2RMX A;  2IUH A;  3GQI B;  2JYQ A;  1HCS B;  1BG1 A;  3MXY A;  2DLZ A;  1RPY A;  2OZO A;  3VRY A;  2PLE A;  1O4H A;  3VS1 A;  3GXW A;  2RSY A;  2LQN A;  3CBL A;  2MRJ A;  3OP0 A;  4EY0 A;  1O45 A;  1H9O A;  2EO6 A;  3CWG A;  3VS4 A;  1OO3 A;  5DC0 B;  3WA4 A;  1O4J A;  1P13 A;  1AD5 A;  1FU5 A;  2KK6 A;  5CDW A;  1CWD L;  4OHH A;  1CJ1 A;  4X6S A;  5GJI A;  3TKZ A;  1BF5 A;  1JYR A;  1PIC A;  1TZE E;  1A81 A;  4F5A A;  3C7I A;  1O4K A;  1A08 A;  1M27 A;  1AYA A;  2CS0 A;  1QCF A;  1LKL A;  3HCK A;  5KAZ A;  1JU5 A;  4JE4 A;  2MC1 A;  1LUM A;  2Y1M A;  5AUL A;  4XZ0 A;  2GSB A;  1O48 A;  2C0T A;  5AXI A;  1A1E A;  2EU0 A;  4FL2 A;  2HDV A;  1X0N A;  2RVF A;  1OPL A;  2DVJ A;  2DLY A;  4ROJ A;  1WQU A;  2AUG A;  3OB2 B;  4D8K A;  2EYZ A;  1O44 A;  3UF4 A;  3IN8 A;  1BM2 A;  4OHI A;  1LKK A;  1BHH B;  1AOU F;  2HMH A;  1D4T A;  4A4C A;  1JWO A;  2C9W A;  1O4P A;  4H1O A;  1I3Z A;  1BLJ A;  1LUK A;  1KSW A;  2ABL A;  1AYC A;  3IN7 A;  1O49 A;  3VS2 A;  1RJA A;  2EOB A;  3VS5 A;  1BHF A;  3US4 A;  4K2R A;  2KNO A;  2EYV A;  1SHA A;  3BUO B;  2CBL A;  2PNB A;  2H5K A;  3VS7 A;  1BFI A;  5D0J A;  1BLK A;  3S8O A;  4F59 A;  4QSY A;  1JYQ A;  1MW4 A;  1O4E A;  1QG1 E;  1UUR A;  1YVH A;  1UUS A;  1KC2 A;  1LCK A;  3HIZ B;  1O47 A;  3IMD A;  4GWF A;  2EYY A;  3M7F A;  5HKW A;  2FO0 A;  3VRP A;  4L1B B;  1SPR A;  1KA7 A;  3PFV A;  1SKJ A;  3S8L A;  3VS0 A;  1BKL A;  3T04 A;  2LQW A;  3VRQ A;  2MRK A;  1HCT B;  3PQZ A;  4U1P A;  4NWF A;  3ZNI A;  2L6K A;  5EG3 B;  1BFJ A;  2PNA A;  1O4R A;  1NZL A;  2XP1 A;  1A09 A;  3QWX X;  3VRO A;  1SHB A;  1O41 A;  2L3T A;  1A1C A;  3NHN A;  3N7Y A;  2LNX A;  2OQ1 A;  2VIF A;  3GXX A;  1Y1U A;  4K45 A;  4K44 A;  2IUI A;  3K2M A;  3HHM B;  4P9V A;  1MIL A;  2H46 E;  3QWY A;  3VGO A;  4GPL B;  1AYB A;  2LNW A;  2LCT A;  1OPK A;  5EHR A;  3VRZ A;  1F1W A;  1XA6 A;  3BUM B;  1O4I A;  1O4F A;  1FU6 A;  1LUI A;  1O4L A;  1R1S A;  1QAD A;  3CD3 A;  2ROR A;  4E93 A;  2CRH A;  1BHH A;  1O4O A;  1F2F A;  1FBZ A;  2YSX A;  5IBS A;  4NWG A;  3CXL A;  4TZI A;  2QMS A;  1LUN A;  2DCR A;  2BBU A;  1JYU A;  1G83 A;  2AOA A;  3OV1 A;  4K11 A;  2C0I A;  5DF6 A;  2ETZ A;  4OHL A;  1A1A A;  1O4M A;  4LUE A;  2SRC A;  4FBN A;  1FHS A;  2AOB A;  1X27 A;  2ECD A;  1OO4 A;  2DM0 A;  1NZV A;  2IUG A;  5J3X A;  1KA6 A;  4A4B A;  1R1P A;  3N84 A;  3VS3 A;  1O4A A;  2EKX A;  5I6V A;  2EO3 A;  2Y3A B;  1FMK A;  4XZ1 A;  4E68 A;  4F5B A;  2EL8 A;  3MXC A;  2SHP A;  4H34 A;  2CIA A;  1ZFP E;  1GHU A;  5BO4 A;  2IZV A;  5EEL A;  1O4D A;  3MAZ A;  5IBM A;  3PSK A;  5GJH A;  3VRR A;  3BUW B;  2GE9 A;  2CI8 A;  3EAZ A;  1D1Z A;  2B3O A;  3OVE A;  1O4B A;  4JGH A;  3VS6 A;  1O4N A;  4WWQ A;  1GRI A;  2DX0 A;  1AOT F;  2Y1N A;  3PS5 A;  5EEQ A;  2CI9 A;  1FYR A;  3KFJ A;  1IS0 A;  3BUX B;  5HKY A;  3S9K A;  4P9Z A;  4M4Z A;  1FBV A;  4OHD A;  4EIH A;  1RQQ C;  3OB1 B;  2YU7 A;  1O4G A;  2HUW A;  1R1Q A;  1O4C A;  1Z3K A;  1A1B A;  3BUN B;  2PLD A;  5EHP A;  3IMJ A;  1CSY A;  1IJR A;  3EAC A;  2HDX A;  2PTK A;  3PJP A;  3BKB A;  4OHE A;  4U17 A;  4DGX A;  3TL0 A;  2K79 B;  1A07 A;  1BMB A;  3VRN A;  2HCK A;  3PSJ A;  3N8M A;  1TCE A;  1O42 A;  2CR4 A;  2H8H A;  1AYD A;  1B47 A;  1CSZ A;  4LUD A;  2MK2 A;  1Y57 A;  1NRV A;  5HKZ A;  4GL9 E;  1BKM A;  1CWE A;  1M61 A;  1YVL A;  3UYO A;  2K7A B;  1AB2 A;  1O46 A;  2FCI A;  1K9A A;  1O43 A;  1O4Q A;  2MQI A; 
#chains in the Genus database with same CATH topology
 1SHD A;  1X6C A;  4JEG A;  4DGP A;  1LCJ A;  2L4K A;  5DC9 A;  4FL3 A;  5DC4 A;  1D4W A;  3S8N A;  3PLF B;  2C0O A;  1SPS A;  2RMX A;  2IUH A;  3GQI B;  2JYQ A;  1HCS B;  1BG1 A;  3MXY A;  2DLZ A;  1RPY A;  2OZO A;  3VRY A;  2PLE A;  1O4H A;  3VS1 A;  3GXW A;  2RSY A;  2LQN A;  3CBL A;  2MRJ A;  3OP0 A;  4EY0 A;  1O45 A;  1H9O A;  2EO6 A;  3CWG A;  3VS4 A;  1OO3 A;  5DC0 B;  3WA4 A;  1O4J A;  1P13 A;  1AD5 A;  1FU5 A;  2KK6 A;  5CDW A;  1CWD L;  4OHH A;  1CJ1 A;  4X6S A;  5GJI A;  3TKZ A;  1BF5 A;  1JYR A;  1PIC A;  1TZE E;  1A81 A;  4F5A A;  3C7I A;  1O4K A;  1A08 A;  1M27 A;  1AYA A;  2CS0 A;  1QCF A;  1LKL A;  3HCK A;  5KAZ A;  1JU5 A;  4JE4 A;  2MC1 A;  1LUM A;  2Y1M A;  5AUL A;  4XZ0 A;  2GSB A;  1O48 A;  2C0T A;  5AXI A;  1A1E A;  2EU0 A;  4FL2 A;  2HDV A;  1X0N A;  2RVF A;  1OPL A;  2DVJ A;  2DLY A;  4ROJ A;  1WQU A;  2AUG A;  3OB2 B;  4D8K A;  2EYZ A;  1O44 A;  3UF4 A;  3IN8 A;  1BM2 A;  4OHI A;  1LKK A;  1BHH B;  1AOU F;  2HMH A;  1D4T A;  4A4C A;  1JWO A;  2C9W A;  1O4P A;  4H1O A;  1I3Z A;  1BLJ A;  1LUK A;  1KSW A;  2ABL A;  1AYC A;  3IN7 A;  1O49 A;  3VS2 A;  1RJA A;  2EOB A;  3VS5 A;  1BHF A;  3US4 A;  4K2R A;  2KNO A;  2EYV A;  1SHA A;  3BUO B;  2CBL A;  2PNB A;  2H5K A;  3VS7 A;  1BFI A;  5D0J A;  1BLK A;  3S8O A;  4F59 A;  4QSY A;  1JYQ A;  1MW4 A;  1O4E A;  1QG1 E;  1UUR A;  1YVH A;  1UUS A;  1KC2 A;  1LCK A;  3HIZ B;  1O47 A;  3IMD A;  4GWF A;  2EYY A;  3M7F A;  5HKW A;  2FO0 A;  3VRP A;  4L1B B;  1SPR A;  1KA7 A;  3PFV A;  1SKJ A;  3S8L A;  3VS0 A;  1BKL A;  3T04 A;  2LQW A;  3VRQ A;  2MRK A;  1HCT B;  3PQZ A;  4U1P A;  4NWF A;  3ZNI A;  2L6K A;  5EG3 B;  1BFJ A;  2PNA A;  1O4R A;  1NZL A;  2XP1 A;  1A09 A;  3QWX X;  3VRO A;  1SHB A;  1O41 A;  2L3T A;  1A1C A;  3NHN A;  3N7Y A;  2LNX A;  2OQ1 A;  2VIF A;  3GXX A;  1Y1U A;  4K45 A;  4K44 A;  3LYV A;  2IUI A;  3K2M A;  3HHM B;  4P9V A;  1MIL A;  2H46 E;  3QWY A;  3VGO A;  4GPL B;  1AYB A;  2LNW A;  2LRA A;  2LCT A;  1OPK A;  5EHR A;  3VRZ A;  1F1W A;  1XA6 A;  3BUM B;  1O4I A;  1O4F A;  1FU6 A;  1LUI A;  1O4L A;  1R1S A;  1QAD A;  3CD3 A;  2ROR A;  4E93 A;  2CRH A;  1BHH A;  1O4O A;  1F2F A;  1FBZ A;  2YSX A;  5IBS A;  4NWG A;  3CXL A;  4TZI A;  2QMS A;  1LUN A;  2DCR A;  2BBU A;  1JYU A;  1G83 A;  2AOA A;  3OV1 A;  4K11 A;  2C0I A;  5DF6 A;  2ETZ A;  4OHL A;  1A1A A;  1O4M A;  4LUE A;  2SRC A;  4FBN A;  1FHS A;  2AOB A;  1X27 A;  2ECD A;  1OO4 A;  2DM0 A;  1NZV A;  2IUG A;  5J3X A;  1KA6 A;  4A4B A;  1R1P A;  3N84 A;  3VS3 A;  1O4A A;  2EKX A;  5I6V A;  2EO3 A;  2Y3A B;  1FMK A;  4XZ1 A;  4E68 A;  4F5B A;  2EL8 A;  3MXC A;  2SHP A;  4H34 A;  2CIA A;  1ZFP E;  1GHU A;  5BO4 A;  2IZV A;  5EEL A;  1O4D A;  3MAZ A;  5IBM A;  3PSK A;  5GJH A;  3VRR A;  3BUW B;  2GE9 A;  2CI8 A;  3EAZ A;  1D1Z A;  2B3O A;  3OVE A;  1O4B A;  4JGH A;  3VS6 A;  1O4N A;  4WWQ A;  1GRI A;  2DX0 A;  1AOT F;  3K2T A;  2Y1N A;  3PS5 A;  5EEQ A;  2CI9 A;  1FYR A;  3KFJ A;  1IS0 A;  3BUX B;  5HKY A;  3S9K A;  4P9Z A;  4M4Z A;  1FBV A;  4OHD A;  4EIH A;  1RQQ C;  3OB1 B;  2YU7 A;  1O4G A;  2HUW A;  1R1Q A;  1O4C A;  1Z3K A;  1A1B A;  3BUN B;  2PLD A;  2KGY A;  5EHP A;  3IMJ A;  1CSY A;  1IJR A;  3EAC A;  2HDX A;  2PTK A;  3PJP A;  3BKB A;  4OHE A;  4U17 A;  4DGX A;  3TL0 A;  2K79 B;  1A07 A;  1BMB A;  3VRN A;  2HCK A;  3PSJ A;  3N8M A;  1TCE A;  1O42 A;  2CR4 A;  2H8H A;  1AYD A;  1B47 A;  1CSZ A;  4LUD A;  2MK2 A;  1Y57 A;  1NRV A;  5HKZ A;  4GL9 E;  1BKM A;  1CWE A;  1M61 A;  1YVL A;  3UYO A;  2K7A B;  1AB2 A;  1O46 A;  2FCI A;  1K9A A;  1O43 A;  1O4Q A;  2MQI A; 
#chains in the Genus database with same CATH homology
 1SHD A;  1X6C A;  4JEG A;  4DGP A;  1LCJ A;  2L4K A;  5DC9 A;  4FL3 A;  5DC4 A;  1D4W A;  3S8N A;  3PLF B;  2C0O A;  1SPS A;  2RMX A;  2IUH A;  3GQI B;  2JYQ A;  1HCS B;  1BG1 A;  3MXY A;  2DLZ A;  1RPY A;  2OZO A;  3VRY A;  2PLE A;  1O4H A;  3VS1 A;  3GXW A;  2RSY A;  2LQN A;  3CBL A;  2MRJ A;  3OP0 A;  4EY0 A;  1O45 A;  1H9O A;  2EO6 A;  3CWG A;  3VS4 A;  1OO3 A;  5DC0 B;  3WA4 A;  1O4J A;  1P13 A;  1AD5 A;  1FU5 A;  2KK6 A;  5CDW A;  1CWD L;  4OHH A;  1CJ1 A;  4X6S A;  5GJI A;  3TKZ A;  1BF5 A;  1JYR A;  1PIC A;  1TZE E;  1A81 A;  4F5A A;  3C7I A;  1O4K A;  1A08 A;  1M27 A;  1AYA A;  2CS0 A;  1QCF A;  1LKL A;  3HCK A;  5KAZ A;  1JU5 A;  4JE4 A;  2MC1 A;  1LUM A;  2Y1M A;  5AUL A;  4XZ0 A;  2GSB A;  1O48 A;  2C0T A;  5AXI A;  1A1E A;  2EU0 A;  4FL2 A;  2HDV A;  1X0N A;  2RVF A;  1OPL A;  2DVJ A;  2DLY A;  4ROJ A;  1WQU A;  2AUG A;  3OB2 B;  4D8K A;  2EYZ A;  1O44 A;  3UF4 A;  3IN8 A;  1BM2 A;  4OHI A;  1LKK A;  1BHH B;  1AOU F;  2HMH A;  1D4T A;  4A4C A;  1JWO A;  2C9W A;  1O4P A;  4H1O A;  1I3Z A;  1BLJ A;  1LUK A;  1KSW A;  2ABL A;  1AYC A;  3IN7 A;  1O49 A;  3VS2 A;  1RJA A;  2EOB A;  3VS5 A;  1BHF A;  3US4 A;  4K2R A;  2KNO A;  2EYV A;  1SHA A;  3BUO B;  2CBL A;  2PNB A;  2H5K A;  3VS7 A;  1BFI A;  5D0J A;  1BLK A;  3S8O A;  4F59 A;  4QSY A;  1JYQ A;  1MW4 A;  1O4E A;  1QG1 E;  1UUR A;  1YVH A;  1UUS A;  1KC2 A;  1LCK A;  3HIZ B;  1O47 A;  3IMD A;  4GWF A;  2EYY A;  3M7F A;  5HKW A;  2FO0 A;  3VRP A;  4L1B B;  1SPR A;  1KA7 A;  3PFV A;  1SKJ A;  3S8L A;  3VS0 A;  1BKL A;  3T04 A;  2LQW A;  3VRQ A;  2MRK A;  1HCT B;  3PQZ A;  4U1P A;  4NWF A;  3ZNI A;  2L6K A;  5EG3 B;  1BFJ A;  2PNA A;  1O4R A;  1NZL A;  2XP1 A;  1A09 A;  3QWX X;  3VRO A;  1SHB A;  1O41 A;  2L3T A;  1A1C A;  3NHN A;  3N7Y A;  2LNX A;  2OQ1 A;  2VIF A;  3GXX A;  1Y1U A;  4K45 A;  4K44 A;  2IUI A;  3K2M A;  3HHM B;  4P9V A;  1MIL A;  2H46 E;  3QWY A;  3VGO A;  4GPL B;  1AYB A;  2LNW A;  2LCT A;  1OPK A;  5EHR A;  3VRZ A;  1F1W A;  1XA6 A;  3BUM B;  1O4I A;  1O4F A;  1FU6 A;  1LUI A;  1O4L A;  1R1S A;  1QAD A;  3CD3 A;  2ROR A;  4E93 A;  2CRH A;  1BHH A;  1O4O A;  1F2F A;  1FBZ A;  2YSX A;  5IBS A;  4NWG A;  3CXL A;  4TZI A;  2QMS A;  1LUN A;  2DCR A;  2BBU A;  1JYU A;  1G83 A;  2AOA A;  3OV1 A;  4K11 A;  2C0I A;  5DF6 A;  2ETZ A;  4OHL A;  1A1A A;  1O4M A;  4LUE A;  2SRC A;  4FBN A;  1FHS A;  2AOB A;  1X27 A;  2ECD A;  1OO4 A;  2DM0 A;  1NZV A;  2IUG A;  5J3X A;  1KA6 A;  4A4B A;  1R1P A;  3N84 A;  3VS3 A;  1O4A A;  2EKX A;  5I6V A;  2EO3 A;  2Y3A B;  1FMK A;  4XZ1 A;  4E68 A;  4F5B A;  2EL8 A;  3MXC A;  2SHP A;  4H34 A;  2CIA A;  1ZFP E;  1GHU A;  5BO4 A;  2IZV A;  5EEL A;  1O4D A;  3MAZ A;  5IBM A;  3PSK A;  5GJH A;  3VRR A;  3BUW B;  2GE9 A;  2CI8 A;  3EAZ A;  1D1Z A;  2B3O A;  3OVE A;  1O4B A;  4JGH A;  3VS6 A;  1O4N A;  4WWQ A;  1GRI A;  2DX0 A;  1AOT F;  2Y1N A;  3PS5 A;  5EEQ A;  2CI9 A;  1FYR A;  3KFJ A;  1IS0 A;  3BUX B;  5HKY A;  3S9K A;  4P9Z A;  4M4Z A;  1FBV A;  4OHD A;  4EIH A;  1RQQ C;  3OB1 B;  2YU7 A;  1O4G A;  2HUW A;  1R1Q A;  1O4C A;  1Z3K A;  1A1B A;  3BUN B;  2PLD A;  5EHP A;  3IMJ A;  1CSY A;  1IJR A;  3EAC A;  2HDX A;  2PTK A;  3PJP A;  3BKB A;  4OHE A;  4U17 A;  4DGX A;  3TL0 A;  2K79 B;  1A07 A;  1BMB A;  3VRN A;  2HCK A;  3PSJ A;  3N8M A;  1TCE A;  1O42 A;  2CR4 A;  2H8H A;  1AYD A;  1B47 A;  1CSZ A;  4LUD A;  2MK2 A;  1Y57 A;  1NRV A;  5HKZ A;  4GL9 E;  1BKM A;  1CWE A;  1M61 A;  1YVL A;  3UYO A;  2K7A B;  1AB2 A;  1O46 A;  2FCI A;  1K9A A;  1O43 A;  1O4Q A;  2MQI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...