2IUGA

Crystal structure of the pi3-kinase p85 n-terminal sh2 domain
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
110
structure length
110
Chain Sequence
b'NNMSLQNAEWYWGDISREEVNEKLRDTADGTFLVRDASTKMHGDYTLTLRKGGNNKLIKIFHRDGKYGFSDPLTFSSVVELINHYRNESLAQYNPKLDVKLLYPVSKYQQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PHOSPHATIDYLINOSITOL 3-KINASE REGULATORY ALPHA SUBUNIT
publication title Crystal Structure of the Pi 3-Kinase P85 Amino-Terminal Sh2 Domain and its Phosphopeptide Complexes
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 29
structure length 110
sequence length 110
ec nomenclature
pdb deposition date 2006-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00017 SH2 SH2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.505.10 Alpha Beta 2-Layer Sandwich SHC Adaptor Protein SH2 domain 2iugA00
1NZLA 1F1WA 1O4GA 1TZEE 2EYZA 2RMXA 2C0IA 1R1SA 3VS5A 4GL9E 1A1CA 5IBSA 4K2RA 3ZNIA 1O4CA 3IN7A 3S8OA 1O4QA 1RJAA 1BLKA 1HCTB 3PJPA 1BHHA 1LKLA 2MQIA 1BF5A 1O4RA 3M7FA 3BUNB 2YSXA 4NWGA 5DC9A 2ETZA 3T04A 1JYQA 3K2MA 1Y57A 1LCKA 1XA6A 3N8MA 2IZVA 3GXXA 1O4KA 1M27A 2HMHA 4X6SA 1O4EA 1O4MA 1A81A 2XP1A 1YVLA 4FBNA 3VRYA 1CWDL 3VRZA 1CSZA 2LNWA 3PSKA 2KK6A 3VGOA 4XZ1A 4GPLB 1BKLA 2FCIA 2CI9A 3OVEA 1AOTF 1QCFA 1AB2A 2L3TA 2DM0A 1Z3KA 4JE4A 2H8HA 4E93A 1O44A 1OPKA 1JYUA 4EY0A 3IMJA 1JYRA 4E68A 2HUWA 2AUGA 1AYDA 5HKZA 4P9VA 4XZ0A 3VS1A 1PICA 1UUSA 1KSWA 2C0TA 5DF6A 3CWGA 3HCKA 1NRVA 1O46A 2EU0A 3PFVA 2CIAA 2Y1MA 2L4KA 3OB1B 1K9AA 5EELA 3S8LA 2PLDA 3PSJA 5IBMA 2SHPA 4U1PA 5HKYA 1OO3A 1AYCA 1LKKA 1AOUF 1NZVA 1FBZA 2ABLA 3PQZA 1BM2A 5J3XA 1SKJA 1O4DA 1X6CA 4OHEA 4DGPA 2EO3A 3C7IA 2PNBA 5EEQA 5D0JA 3US4A 3CBLA 2K79B 2C0OA 2Y1NA 2CRHA 3TKZA 1O43A 1A1BA 1RQQC 2EL8A 1SPSA 3OV1A 4OHLA 2GSBA 3VRRA 2LNXA 3VS0A 4P9ZA 4K45A 2HDVA 3TL0A 4QSYA 4GWFA 2BBUA 2RORA 1TCEA 1KA7A 2IUHA 3BUWB 5KAZA 1CSYA 1FU5A 4F59A 3MXYA 4M4ZA 1CWEA 5BO4A 4LUEA 2JYQA 1D4TA 2H5KA 1SPRA 1GRIA 1FYRA 1LUIA 2QMSA 3UYOA 5I6VA 1P13A 2MK2A 2VIFA 1ZFPE 3QWXX 3OB2B 4A4CA 3MXCA 1CJ1A 1FMKA 2CS0A 1A09A 2LQWA 1O4PA 3VRQA 4H34A 1BG1A 4NWFA 3KFJA 1KA6A 4DGXA 2IUGA 4JEGA 4TZIA 1R1PA 4K44A 2MRKA 1M61A 1SHDA 4H1OA 1D4WA 4U17A 2DVJA 2DLYA 1O4LA 5EHRA 1F2FA 3BUMB 5DC0B 2DX0A 1B47A 2YU7A 3VRPA 2MRJA 2HCKA 1BLJA 1GHUA 4LUDA 2AOBA 4OHDA 4ROJA 3WA4A 3VS4A 2HDXA 3GXWA 3VS7A 1MILA 3BUOB 1A08A 1G83A 1FBVA 2PTKA 1SHAA 3S8NA 2EOBA 2LCTA 1BFJA 4K11A 1QADA 3VS3A 1BHFA 1QG1E 2Y3AB 1BMBA 1OO4A 1SHBA 1A1AA 2H46E 3EAZA 4OHIA 2EYVA 4F5BA 2C9WA 5AULA 3GQIB 1LCJA 4JGHA 5EG3B 1O4HA 1O41A 1Y1UA 2KNOA 3VRNA 3PLFB 1A07A 2CR4A 1R1QA 2DCRA 3BKBA 5AXIA 1O48A 1BFIA 3QWYA 1I3ZA 1O47A 4L1BB 3VROA 3UF4A 2PNAA 1UURA 4EIHA 1KC2A 1D1ZA 2DLZA 1O4IA 2EYYA 1H9OA 2RVFA 1X0NA 2OZOA 2EKXA 1HCSB 4WWQA 3S9KA 4A4BA 1O4OA 3OP0A 5GJHA 2CI8A 1FU6A 4F5AA 2FO0A 1LUKA 3BUXB 2RSYA 3VS6A 1O4NA 5HKWA 3HHMB 5DC4A 2EO6A 3VS2A 1FHSA 3MAZA 1LUNA 1AYBA 1BKMA 3CD3A 1YVHA 1LUMA 4FL3A 1O4BA 3HIZB 2ECDA 2LQNA 1IS0A 2PLEA 3IN8A 3NHNA 4FL2A 2MC1A 1JU5A 3IMDA 1O4AA 1OPLA 1WQUA 1IJRA 1BHHB 2OQ1A 5GJIA 2K7AB 3CXLA 1JWOA 1AD5A 3N7YA 5CDWA 1O49A 3N84A 2CBLA 4OHHA 1O42A 2B3OA 2AOAA 1O4JA 5EHPA 1O4FA 2GE9A 1O45A 3PS5A 2IUIA 1X27A 4D8KA 1RPYA 1MW4A 2SRCA 2L6KA 3EACA 1AYAA 1A1EA
chains in the Genus database with same CATH superfamily
1NZLA 1F1WA 1O4GA 1TZEE 2EYZA 2RMXA 2C0IA 1R1SA 3VS5A 4GL9E 1A1CA 5IBSA 4K2RA 3ZNIA 1O4CA 3IN7A 3S8OA 1O4QA 1RJAA 1BLKA 1HCTB 3PJPA 1BHHA 1LKLA 2MQIA 1BF5A 1O4RA 3M7FA 3BUNB 2YSXA 4NWGA 5DC9A 2ETZA 3T04A 1JYQA 3K2MA 1Y57A 1LCKA 1XA6A 3N8MA 2IZVA 2KGYA 3GXXA 1O4KA 1M27A 2HMHA 4X6SA 1O4EA 1O4MA 1A81A 2XP1A 1YVLA 4FBNA 3VRYA 1CWDL 3VRZA 1CSZA 2LNWA 3PSKA 2KK6A 3VGOA 3K2TA 4XZ1A 4GPLB 1BKLA 2FCIA 2CI9A 3OVEA 1AOTF 1QCFA 1AB2A 2L3TA 2DM0A 1Z3KA 4JE4A 2H8HA 4E93A 1O44A 1OPKA 1JYUA 4EY0A 3IMJA 1JYRA 4E68A 2HUWA 2AUGA 1AYDA 5HKZA 4P9VA 4XZ0A 3VS1A 1PICA 1UUSA 1KSWA 2C0TA 5DF6A 3CWGA 3HCKA 1NRVA 1O46A 2LRAA 2EU0A 3PFVA 2CIAA 2Y1MA 2L4KA 3OB1B 1K9AA 5EELA 3S8LA 2PLDA 3PSJA 5IBMA 2SHPA 4U1PA 5HKYA 1OO3A 1AYCA 1LKKA 1AOUF 1NZVA 1FBZA 2ABLA 3PQZA 3LYVA 1BM2A 5J3XA 1SKJA 1O4DA 1X6CA 4OHEA 4DGPA 2EO3A 3C7IA 2PNBA 5EEQA 5D0JA 3US4A 3CBLA 2K79B 2C0OA 2Y1NA 2CRHA 3TKZA 1O43A 1A1BA 1RQQC 2EL8A 1SPSA 3OV1A 4OHLA 2GSBA 3VRRA 2LNXA 3VS0A 4P9ZA 4K45A 2HDVA 3TL0A 4QSYA 4GWFA 2BBUA 2RORA 1TCEA 1KA7A 2IUHA 3BUWB 5KAZA 1CSYA 1FU5A 4F59A 3MXYA 4M4ZA 1CWEA 5BO4A 4LUEA 2JYQA 1D4TA 2H5KA 1SPRA 1GRIA 1FYRA 1LUIA 2QMSA 3UYOA 5I6VA 1P13A 2MK2A 2VIFA 1ZFPE 3QWXX 3OB2B 4A4CA 3MXCA 1CJ1A 1FMKA 2CS0A 1A09A 2LQWA 1O4PA 3VRQA 4H34A 1BG1A 4NWFA 3KFJA 1KA6A 4DGXA 2IUGA 4JEGA 4TZIA 1R1PA 4K44A 2MRKA 1M61A 1SHDA 4H1OA 1D4WA 4U17A 2DVJA 2DLYA 1O4LA 5EHRA 1F2FA 3BUMB 5DC0B 2DX0A 1B47A 2YU7A 3VRPA 2MRJA 2HCKA 1BLJA 1GHUA 4LUDA 2AOBA 4OHDA 4ROJA 3WA4A 3VS4A 2HDXA 3GXWA 3VS7A 1MILA 3BUOB 1A08A 1G83A 1FBVA 2PTKA 1SHAA 3S8NA 2EOBA 2LCTA 1BFJA 4K11A 1QADA 3VS3A 1BHFA 1QG1E 2Y3AB 1BMBA 1OO4A 1SHBA 1A1AA 2H46E 3EAZA 4OHIA 2EYVA 4F5BA 2C9WA 5AULA 3GQIB 1LCJA 4JGHA 5EG3B 1O4HA 1O41A 1Y1UA 2KNOA 3VRNA 3PLFB 1A07A 2CR4A 1R1QA 2DCRA 3BKBA 5AXIA 1O48A 1BFIA 3QWYA 1I3ZA 1O47A 4L1BB 3VROA 3UF4A 2PNAA 1UURA 4EIHA 1KC2A 1D1ZA 2DLZA 1O4IA 2EYYA 1H9OA 2RVFA 1X0NA 2OZOA 2EKXA 1HCSB 4WWQA 3S9KA 4A4BA 1O4OA 3OP0A 5GJHA 2CI8A 1FU6A 4F5AA 2FO0A 1LUKA 3BUXB 2RSYA 3VS6A 1O4NA 5HKWA 3HHMB 5DC4A 2EO6A 3VS2A 1FHSA 3MAZA 1LUNA 1AYBA 1BKMA 3CD3A 1YVHA 1LUMA 4FL3A 1O4BA 3HIZB 2ECDA 2LQNA 1IS0A 2PLEA 3IN8A 3NHNA 4FL2A 2MC1A 1JU5A 3IMDA 1O4AA 1OPLA 1WQUA 1IJRA 1BHHB 2OQ1A 5GJIA 2K7AB 3CXLA 1JWOA 1AD5A 3N7YA 5CDWA 1O49A 3N84A 2CBLA 4OHHA 1O42A 2B3OA 2AOAA 1O4JA 5EHPA 1O4FA 2GE9A 1O45A 3PS5A 2IUIA 1X27A 4D8KA 1RPYA 1MW4A 2SRCA 2L6KA 3EACA 1AYAA 1A1EA
chains in the Genus database with same CATH topology
1NZLA 1F1WA 1O4GA 1TZEE 2EYZA 2RMXA 2C0IA 1R1SA 3VS5A 4GL9E 1A1CA 5IBSA 4K2RA 3ZNIA 1O4CA 3IN7A 3S8OA 1O4QA 1RJAA 1BLKA 1HCTB 3PJPA 1BHHA 1LKLA 2MQIA 1BF5A 1O4RA 3M7FA 3BUNB 2YSXA 4NWGA 5DC9A 2ETZA 3T04A 1JYQA 3K2MA 1Y57A 1LCKA 1XA6A 3N8MA 2IZVA 3GXXA 1O4KA 1M27A 2HMHA 4X6SA 1O4EA 1O4MA 1A81A 2XP1A 1YVLA 4FBNA 3VRYA 1CWDL 3VRZA 1CSZA 2LNWA 3PSKA 2KK6A 3VGOA 4XZ1A 4GPLB 1BKLA 2FCIA 2CI9A 3OVEA 1AOTF 1QCFA 1AB2A 2L3TA 2DM0A 1Z3KA 4JE4A 2H8HA 4E93A 1O44A 1OPKA 1JYUA 4EY0A 3IMJA 1JYRA 4E68A 2HUWA 2AUGA 1AYDA 5HKZA 4P9VA 4XZ0A 3VS1A 1PICA 1UUSA 1KSWA 2C0TA 5DF6A 3CWGA 3HCKA 1NRVA 1O46A 2EU0A 3PFVA 2CIAA 2Y1MA 2L4KA 3OB1B 1K9AA 5EELA 3S8LA 2PLDA 3PSJA 5IBMA 2SHPA 4U1PA 5HKYA 1OO3A 1AYCA 1LKKA 1AOUF 1NZVA 1FBZA 2ABLA 3PQZA 1BM2A 5J3XA 1SKJA 1O4DA 1X6CA 4OHEA 4DGPA 2EO3A 3C7IA 2PNBA 5EEQA 5D0JA 3US4A 3CBLA 2K79B 2C0OA 2Y1NA 2CRHA 3TKZA 1O43A 1A1BA 1RQQC 2EL8A 1SPSA 3OV1A 4OHLA 2GSBA 3VRRA 2LNXA 3VS0A 4P9ZA 4K45A 2HDVA 3TL0A 4QSYA 4GWFA 2BBUA 2RORA 1TCEA 1KA7A 2IUHA 3BUWB 5KAZA 1CSYA 1FU5A 4F59A 3MXYA 4M4ZA 1CWEA 5BO4A 4LUEA 2JYQA 1D4TA 2H5KA 1SPRA 1GRIA 1FYRA 1LUIA 2QMSA 3UYOA 5I6VA 1P13A 2MK2A 2VIFA 1ZFPE 3QWXX 3OB2B 4A4CA 3MXCA 1CJ1A 1FMKA 2CS0A 1A09A 2LQWA 1O4PA 3VRQA 4H34A 1BG1A 4NWFA 3KFJA 1KA6A 4DGXA 2IUGA 4JEGA 4TZIA 1R1PA 4K44A 2MRKA 1M61A 1SHDA 4H1OA 1D4WA 4U17A 2DVJA 2DLYA 1O4LA 5EHRA 1F2FA 3BUMB 5DC0B 2DX0A 1B47A 2YU7A 3VRPA 2MRJA 2HCKA 1BLJA 1GHUA 4LUDA 2AOBA 4OHDA 4ROJA 3WA4A 3VS4A 2HDXA 3GXWA 3VS7A 1MILA 3BUOB 1A08A 1G83A 1FBVA 2PTKA 1SHAA 3S8NA 2EOBA 2LCTA 1BFJA 4K11A 1QADA 3VS3A 1BHFA 1QG1E 2Y3AB 1BMBA 1OO4A 1SHBA 1A1AA 2H46E 3EAZA 4OHIA 2EYVA 4F5BA 2C9WA 5AULA 3GQIB 1LCJA 4JGHA 5EG3B 1O4HA 1O41A 1Y1UA 2KNOA 3VRNA 3PLFB 1A07A 2CR4A 1R1QA 2DCRA 3BKBA 5AXIA 1O48A 1BFIA 3QWYA 1I3ZA 1O47A 4L1BB 3VROA 3UF4A 2PNAA 1UURA 4EIHA 1KC2A 1D1ZA 2DLZA 1O4IA 2EYYA 1H9OA 2RVFA 1X0NA 2OZOA 2EKXA 1HCSB 4WWQA 3S9KA 4A4BA 1O4OA 3OP0A 5GJHA 2CI8A 1FU6A 4F5AA 2FO0A 1LUKA 3BUXB 2RSYA 3VS6A 1O4NA 5HKWA 3HHMB 5DC4A 2EO6A 3VS2A 1FHSA 3MAZA 1LUNA 1AYBA 1BKMA 3CD3A 1YVHA 1LUMA 4FL3A 1O4BA 3HIZB 2ECDA 2LQNA 1IS0A 2PLEA 3IN8A 3NHNA 4FL2A 2MC1A 1JU5A 3IMDA 1O4AA 1OPLA 1WQUA 1IJRA 1BHHB 2OQ1A 5GJIA 2K7AB 3CXLA 1JWOA 1AD5A 3N7YA 5CDWA 1O49A 3N84A 2CBLA 4OHHA 1O42A 2B3OA 2AOAA 1O4JA 5EHPA 1O4FA 2GE9A 1O45A 3PS5A 2IUIA 1X27A 4D8KA 1RPYA 1MW4A 2SRCA 2L6KA 3EACA 1AYAA 1A1EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NZL A;  1F1W A;  1O4G A;  1TZE E;  2EYZ A;  2RMX A;  2C0I A;  1R1S A;  3VS5 A;  4GL9 E;  1A1C A;  5IBS A;  4K2R A;  3ZNI A;  1O4C A;  3IN7 A;  3S8O A;  1O4Q A;  1RJA A;  1BLK A;  1HCT B;  3PJP A;  1BHH A;  1LKL A;  2MQI A;  1BF5 A;  1O4R A;  3M7F A;  3BUN B;  2YSX A;  4NWG A;  5DC9 A;  2ETZ A;  3T04 A;  1JYQ A;  3K2M A;  1Y57 A;  1LCK A;  1XA6 A;  3N8M A;  2IZV A;  3GXX A;  1O4K A;  1M27 A;  2HMH A;  4X6S A;  1O4E A;  1O4M A;  1A81 A;  2XP1 A;  1YVL A;  4FBN A;  3VRY A;  1CWD L;  3VRZ A;  1CSZ A;  2LNW A;  3PSK A;  2KK6 A;  3VGO A;  4XZ1 A;  4GPL B;  1BKL A;  2FCI A;  2CI9 A;  3OVE A;  1AOT F;  1QCF A;  1AB2 A;  2L3T A;  2DM0 A;  1Z3K A;  4JE4 A;  2H8H A;  4E93 A;  1O44 A;  1OPK A;  1JYU A;  4EY0 A;  3IMJ A;  1JYR A;  4E68 A;  2HUW A;  2AUG A;  1AYD A;  5HKZ A;  4P9V A;  4XZ0 A;  3VS1 A;  1PIC A;  1UUS A;  1KSW A;  2C0T A;  5DF6 A;  3CWG A;  3HCK A;  1NRV A;  1O46 A;  2EU0 A;  3PFV A;  2CIA A;  2Y1M A;  2L4K A;  3OB1 B;  1K9A A;  5EEL A;  3S8L A;  2PLD A;  3PSJ A;  5IBM A;  2SHP A;  4U1P A;  5HKY A;  1OO3 A;  1AYC A;  1LKK A;  1AOU F;  1NZV A;  1FBZ A;  2ABL A;  3PQZ A;  1BM2 A;  5J3X A;  1SKJ A;  1O4D A;  1X6C A;  4OHE A;  4DGP A;  2EO3 A;  3C7I A;  2PNB A;  5EEQ A;  5D0J A;  3US4 A;  3CBL A;  2K79 B;  2C0O A;  2Y1N A;  2CRH A;  3TKZ A;  1O43 A;  1A1B A;  1RQQ C;  2EL8 A;  1SPS A;  3OV1 A;  4OHL A;  2GSB A;  3VRR A;  2LNX A;  3VS0 A;  4P9Z A;  4K45 A;  2HDV A;  3TL0 A;  4QSY A;  4GWF A;  2BBU A;  2ROR A;  1TCE A;  1KA7 A;  2IUH A;  3BUW B;  5KAZ A;  1CSY A;  1FU5 A;  4F59 A;  3MXY A;  4M4Z A;  1CWE A;  5BO4 A;  4LUE A;  2JYQ A;  1D4T A;  2H5K A;  1SPR A;  1GRI A;  1FYR A;  1LUI A;  2QMS A;  3UYO A;  5I6V A;  1P13 A;  2MK2 A;  2VIF A;  1ZFP E;  3QWX X;  3OB2 B;  4A4C A;  3MXC A;  1CJ1 A;  1FMK A;  2CS0 A;  1A09 A;  2LQW A;  1O4P A;  3VRQ A;  4H34 A;  1BG1 A;  4NWF A;  3KFJ A;  1KA6 A;  4DGX A;  2IUG A;  4JEG A;  4TZI A;  1R1P A;  4K44 A;  2MRK A;  1M61 A;  1SHD A;  4H1O A;  1D4W A;  4U17 A;  2DVJ A;  2DLY A;  1O4L A;  5EHR A;  1F2F A;  3BUM B;  5DC0 B;  2DX0 A;  1B47 A;  2YU7 A;  3VRP A;  2MRJ A;  2HCK A;  1BLJ A;  1GHU A;  4LUD A;  2AOB A;  4OHD A;  4ROJ A;  3WA4 A;  3VS4 A;  2HDX A;  3GXW A;  3VS7 A;  1MIL A;  3BUO B;  1A08 A;  1G83 A;  1FBV A;  2PTK A;  1SHA A;  3S8N A;  2EOB A;  2LCT A;  1BFJ A;  4K11 A;  1QAD A;  3VS3 A;  1BHF A;  1QG1 E;  2Y3A B;  1BMB A;  1OO4 A;  1SHB A;  1A1A A;  2H46 E;  3EAZ A;  4OHI A;  2EYV A;  4F5B A;  2C9W A;  5AUL A;  3GQI B;  1LCJ A;  4JGH A;  5EG3 B;  1O4H A;  1O41 A;  1Y1U A;  2KNO A;  3VRN A;  3PLF B;  1A07 A;  2CR4 A;  1R1Q A;  2DCR A;  3BKB A;  5AXI A;  1O48 A;  1BFI A;  3QWY A;  1I3Z A;  1O47 A;  4L1B B;  3VRO A;  3UF4 A;  2PNA A;  1UUR A;  4EIH A;  1KC2 A;  1D1Z A;  2DLZ A;  1O4I A;  2EYY A;  1H9O A;  2RVF A;  1X0N A;  2OZO A;  2EKX A;  1HCS B;  4WWQ A;  3S9K A;  4A4B A;  1O4O A;  3OP0 A;  5GJH A;  2CI8 A;  1FU6 A;  4F5A A;  2FO0 A;  1LUK A;  3BUX B;  2RSY A;  3VS6 A;  1O4N A;  5HKW A;  3HHM B;  5DC4 A;  2EO6 A;  3VS2 A;  1FHS A;  3MAZ A;  1LUN A;  1AYB A;  1BKM A;  3CD3 A;  1YVH A;  1LUM A;  4FL3 A;  1O4B A;  3HIZ B;  2ECD A;  2LQN A;  1IS0 A;  2PLE A;  3IN8 A;  3NHN A;  4FL2 A;  2MC1 A;  1JU5 A;  3IMD A;  1O4A A;  1OPL A;  1WQU A;  1IJR A;  1BHH B;  2OQ1 A;  5GJI A;  2K7A B;  3CXL A;  1JWO A;  1AD5 A;  3N7Y A;  5CDW A;  1O49 A;  3N84 A;  2CBL A;  4OHH A;  1O42 A;  2B3O A;  2AOA A;  1O4J A;  5EHP A;  1O4F A;  2GE9 A;  1O45 A;  3PS5 A;  2IUI A;  1X27 A;  4D8K A;  1RPY A;  1MW4 A;  2SRC A;  2L6K A;  3EAC A;  1AYA A;  1A1E A; 
#chains in the Genus database with same CATH topology
 1NZL A;  1F1W A;  1O4G A;  1TZE E;  2EYZ A;  2RMX A;  2C0I A;  1R1S A;  3VS5 A;  4GL9 E;  1A1C A;  5IBS A;  4K2R A;  3ZNI A;  1O4C A;  3IN7 A;  3S8O A;  1O4Q A;  1RJA A;  1BLK A;  1HCT B;  3PJP A;  1BHH A;  1LKL A;  2MQI A;  1BF5 A;  1O4R A;  3M7F A;  3BUN B;  2YSX A;  4NWG A;  5DC9 A;  2ETZ A;  3T04 A;  1JYQ A;  3K2M A;  1Y57 A;  1LCK A;  1XA6 A;  3N8M A;  2IZV A;  2KGY A;  3GXX A;  1O4K A;  1M27 A;  2HMH A;  4X6S A;  1O4E A;  1O4M A;  1A81 A;  2XP1 A;  1YVL A;  4FBN A;  3VRY A;  1CWD L;  3VRZ A;  1CSZ A;  2LNW A;  3PSK A;  2KK6 A;  3VGO A;  3K2T A;  4XZ1 A;  4GPL B;  1BKL A;  2FCI A;  2CI9 A;  3OVE A;  1AOT F;  1QCF A;  1AB2 A;  2L3T A;  2DM0 A;  1Z3K A;  4JE4 A;  2H8H A;  4E93 A;  1O44 A;  1OPK A;  1JYU A;  4EY0 A;  3IMJ A;  1JYR A;  4E68 A;  2HUW A;  2AUG A;  1AYD A;  5HKZ A;  4P9V A;  4XZ0 A;  3VS1 A;  1PIC A;  1UUS A;  1KSW A;  2C0T A;  5DF6 A;  3CWG A;  3HCK A;  1NRV A;  1O46 A;  2LRA A;  2EU0 A;  3PFV A;  2CIA A;  2Y1M A;  2L4K A;  3OB1 B;  1K9A A;  5EEL A;  3S8L A;  2PLD A;  3PSJ A;  5IBM A;  2SHP A;  4U1P A;  5HKY A;  1OO3 A;  1AYC A;  1LKK A;  1AOU F;  1NZV A;  1FBZ A;  2ABL A;  3PQZ A;  3LYV A;  1BM2 A;  5J3X A;  1SKJ A;  1O4D A;  1X6C A;  4OHE A;  4DGP A;  2EO3 A;  3C7I A;  2PNB A;  5EEQ A;  5D0J A;  3US4 A;  3CBL A;  2K79 B;  2C0O A;  2Y1N A;  2CRH A;  3TKZ A;  1O43 A;  1A1B A;  1RQQ C;  2EL8 A;  1SPS A;  3OV1 A;  4OHL A;  2GSB A;  3VRR A;  2LNX A;  3VS0 A;  4P9Z A;  4K45 A;  2HDV A;  3TL0 A;  4QSY A;  4GWF A;  2BBU A;  2ROR A;  1TCE A;  1KA7 A;  2IUH A;  3BUW B;  5KAZ A;  1CSY A;  1FU5 A;  4F59 A;  3MXY A;  4M4Z A;  1CWE A;  5BO4 A;  4LUE A;  2JYQ A;  1D4T A;  2H5K A;  1SPR A;  1GRI A;  1FYR A;  1LUI A;  2QMS A;  3UYO A;  5I6V A;  1P13 A;  2MK2 A;  2VIF A;  1ZFP E;  3QWX X;  3OB2 B;  4A4C A;  3MXC A;  1CJ1 A;  1FMK A;  2CS0 A;  1A09 A;  2LQW A;  1O4P A;  3VRQ A;  4H34 A;  1BG1 A;  4NWF A;  3KFJ A;  1KA6 A;  4DGX A;  2IUG A;  4JEG A;  4TZI A;  1R1P A;  4K44 A;  2MRK A;  1M61 A;  1SHD A;  4H1O A;  1D4W A;  4U17 A;  2DVJ A;  2DLY A;  1O4L A;  5EHR A;  1F2F A;  3BUM B;  5DC0 B;  2DX0 A;  1B47 A;  2YU7 A;  3VRP A;  2MRJ A;  2HCK A;  1BLJ A;  1GHU A;  4LUD A;  2AOB A;  4OHD A;  4ROJ A;  3WA4 A;  3VS4 A;  2HDX A;  3GXW A;  3VS7 A;  1MIL A;  3BUO B;  1A08 A;  1G83 A;  1FBV A;  2PTK A;  1SHA A;  3S8N A;  2EOB A;  2LCT A;  1BFJ A;  4K11 A;  1QAD A;  3VS3 A;  1BHF A;  1QG1 E;  2Y3A B;  1BMB A;  1OO4 A;  1SHB A;  1A1A A;  2H46 E;  3EAZ A;  4OHI A;  2EYV A;  4F5B A;  2C9W A;  5AUL A;  3GQI B;  1LCJ A;  4JGH A;  5EG3 B;  1O4H A;  1O41 A;  1Y1U A;  2KNO A;  3VRN A;  3PLF B;  1A07 A;  2CR4 A;  1R1Q A;  2DCR A;  3BKB A;  5AXI A;  1O48 A;  1BFI A;  3QWY A;  1I3Z A;  1O47 A;  4L1B B;  3VRO A;  3UF4 A;  2PNA A;  1UUR A;  4EIH A;  1KC2 A;  1D1Z A;  2DLZ A;  1O4I A;  2EYY A;  1H9O A;  2RVF A;  1X0N A;  2OZO A;  2EKX A;  1HCS B;  4WWQ A;  3S9K A;  4A4B A;  1O4O A;  3OP0 A;  5GJH A;  2CI8 A;  1FU6 A;  4F5A A;  2FO0 A;  1LUK A;  3BUX B;  2RSY A;  3VS6 A;  1O4N A;  5HKW A;  3HHM B;  5DC4 A;  2EO6 A;  3VS2 A;  1FHS A;  3MAZ A;  1LUN A;  1AYB A;  1BKM A;  3CD3 A;  1YVH A;  1LUM A;  4FL3 A;  1O4B A;  3HIZ B;  2ECD A;  2LQN A;  1IS0 A;  2PLE A;  3IN8 A;  3NHN A;  4FL2 A;  2MC1 A;  1JU5 A;  3IMD A;  1O4A A;  1OPL A;  1WQU A;  1IJR A;  1BHH B;  2OQ1 A;  5GJI A;  2K7A B;  3CXL A;  1JWO A;  1AD5 A;  3N7Y A;  5CDW A;  1O49 A;  3N84 A;  2CBL A;  4OHH A;  1O42 A;  2B3O A;  2AOA A;  1O4J A;  5EHP A;  1O4F A;  2GE9 A;  1O45 A;  3PS5 A;  2IUI A;  1X27 A;  4D8K A;  1RPY A;  1MW4 A;  2SRC A;  2L6K A;  3EAC A;  1AYA A;  1A1E A; 
#chains in the Genus database with same CATH homology
 1NZL A;  1F1W A;  1O4G A;  1TZE E;  2EYZ A;  2RMX A;  2C0I A;  1R1S A;  3VS5 A;  4GL9 E;  1A1C A;  5IBS A;  4K2R A;  3ZNI A;  1O4C A;  3IN7 A;  3S8O A;  1O4Q A;  1RJA A;  1BLK A;  1HCT B;  3PJP A;  1BHH A;  1LKL A;  2MQI A;  1BF5 A;  1O4R A;  3M7F A;  3BUN B;  2YSX A;  4NWG A;  5DC9 A;  2ETZ A;  3T04 A;  1JYQ A;  3K2M A;  1Y57 A;  1LCK A;  1XA6 A;  3N8M A;  2IZV A;  3GXX A;  1O4K A;  1M27 A;  2HMH A;  4X6S A;  1O4E A;  1O4M A;  1A81 A;  2XP1 A;  1YVL A;  4FBN A;  3VRY A;  1CWD L;  3VRZ A;  1CSZ A;  2LNW A;  3PSK A;  2KK6 A;  3VGO A;  4XZ1 A;  4GPL B;  1BKL A;  2FCI A;  2CI9 A;  3OVE A;  1AOT F;  1QCF A;  1AB2 A;  2L3T A;  2DM0 A;  1Z3K A;  4JE4 A;  2H8H A;  4E93 A;  1O44 A;  1OPK A;  1JYU A;  4EY0 A;  3IMJ A;  1JYR A;  4E68 A;  2HUW A;  2AUG A;  1AYD A;  5HKZ A;  4P9V A;  4XZ0 A;  3VS1 A;  1PIC A;  1UUS A;  1KSW A;  2C0T A;  5DF6 A;  3CWG A;  3HCK A;  1NRV A;  1O46 A;  2EU0 A;  3PFV A;  2CIA A;  2Y1M A;  2L4K A;  3OB1 B;  1K9A A;  5EEL A;  3S8L A;  2PLD A;  3PSJ A;  5IBM A;  2SHP A;  4U1P A;  5HKY A;  1OO3 A;  1AYC A;  1LKK A;  1AOU F;  1NZV A;  1FBZ A;  2ABL A;  3PQZ A;  1BM2 A;  5J3X A;  1SKJ A;  1O4D A;  1X6C A;  4OHE A;  4DGP A;  2EO3 A;  3C7I A;  2PNB A;  5EEQ A;  5D0J A;  3US4 A;  3CBL A;  2K79 B;  2C0O A;  2Y1N A;  2CRH A;  3TKZ A;  1O43 A;  1A1B A;  1RQQ C;  2EL8 A;  1SPS A;  3OV1 A;  4OHL A;  2GSB A;  3VRR A;  2LNX A;  3VS0 A;  4P9Z A;  4K45 A;  2HDV A;  3TL0 A;  4QSY A;  4GWF A;  2BBU A;  2ROR A;  1TCE A;  1KA7 A;  2IUH A;  3BUW B;  5KAZ A;  1CSY A;  1FU5 A;  4F59 A;  3MXY A;  4M4Z A;  1CWE A;  5BO4 A;  4LUE A;  2JYQ A;  1D4T A;  2H5K A;  1SPR A;  1GRI A;  1FYR A;  1LUI A;  2QMS A;  3UYO A;  5I6V A;  1P13 A;  2MK2 A;  2VIF A;  1ZFP E;  3QWX X;  3OB2 B;  4A4C A;  3MXC A;  1CJ1 A;  1FMK A;  2CS0 A;  1A09 A;  2LQW A;  1O4P A;  3VRQ A;  4H34 A;  1BG1 A;  4NWF A;  3KFJ A;  1KA6 A;  4DGX A;  2IUG A;  4JEG A;  4TZI A;  1R1P A;  4K44 A;  2MRK A;  1M61 A;  1SHD A;  4H1O A;  1D4W A;  4U17 A;  2DVJ A;  2DLY A;  1O4L A;  5EHR A;  1F2F A;  3BUM B;  5DC0 B;  2DX0 A;  1B47 A;  2YU7 A;  3VRP A;  2MRJ A;  2HCK A;  1BLJ A;  1GHU A;  4LUD A;  2AOB A;  4OHD A;  4ROJ A;  3WA4 A;  3VS4 A;  2HDX A;  3GXW A;  3VS7 A;  1MIL A;  3BUO B;  1A08 A;  1G83 A;  1FBV A;  2PTK A;  1SHA A;  3S8N A;  2EOB A;  2LCT A;  1BFJ A;  4K11 A;  1QAD A;  3VS3 A;  1BHF A;  1QG1 E;  2Y3A B;  1BMB A;  1OO4 A;  1SHB A;  1A1A A;  2H46 E;  3EAZ A;  4OHI A;  2EYV A;  4F5B A;  2C9W A;  5AUL A;  3GQI B;  1LCJ A;  4JGH A;  5EG3 B;  1O4H A;  1O41 A;  1Y1U A;  2KNO A;  3VRN A;  3PLF B;  1A07 A;  2CR4 A;  1R1Q A;  2DCR A;  3BKB A;  5AXI A;  1O48 A;  1BFI A;  3QWY A;  1I3Z A;  1O47 A;  4L1B B;  3VRO A;  3UF4 A;  2PNA A;  1UUR A;  4EIH A;  1KC2 A;  1D1Z A;  2DLZ A;  1O4I A;  2EYY A;  1H9O A;  2RVF A;  1X0N A;  2OZO A;  2EKX A;  1HCS B;  4WWQ A;  3S9K A;  4A4B A;  1O4O A;  3OP0 A;  5GJH A;  2CI8 A;  1FU6 A;  4F5A A;  2FO0 A;  1LUK A;  3BUX B;  2RSY A;  3VS6 A;  1O4N A;  5HKW A;  3HHM B;  5DC4 A;  2EO6 A;  3VS2 A;  1FHS A;  3MAZ A;  1LUN A;  1AYB A;  1BKM A;  3CD3 A;  1YVH A;  1LUM A;  4FL3 A;  1O4B A;  3HIZ B;  2ECD A;  2LQN A;  1IS0 A;  2PLE A;  3IN8 A;  3NHN A;  4FL2 A;  2MC1 A;  1JU5 A;  3IMD A;  1O4A A;  1OPL A;  1WQU A;  1IJR A;  1BHH B;  2OQ1 A;  5GJI A;  2K7A B;  3CXL A;  1JWO A;  1AD5 A;  3N7Y A;  5CDW A;  1O49 A;  3N84 A;  2CBL A;  4OHH A;  1O42 A;  2B3O A;  2AOA A;  1O4J A;  5EHP A;  1O4F A;  2GE9 A;  1O45 A;  3PS5 A;  2IUI A;  1X27 A;  4D8K A;  1RPY A;  1MW4 A;  2SRC A;  2L6K A;  3EAC A;  1AYA A;  1A1E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...