3WA4A

Grb2 sh2 domain/cd28-derived peptide complex
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
96
structure length
96
Chain Sequence
PEFWFFGKIPRAKAEEMLSKQRHDGAFLIRESESAPGDFSLSVKFGNDVQHFKVLRDGAGKYFLWVVKFNSLNELVDYHRSTSVSRNQQIFLRDIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Growth factor receptor-bound protein 2
publication title High Resolution Crystal Structure of the Grb2 SH2 Domain with a Phosphopeptide Derived from CD28
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 24
structure length 96
sequence length 96
ec nomenclature
pdb deposition date 2013-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00017 SH2 SH2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.505.10 Alpha Beta 2-Layer Sandwich SHC Adaptor Protein SH2 domain 3wa4A00
1BM2A 2DCRA 3N7YA 3VS7A 3BKBA 1LCKA 1CJ1A 1O4DA 2PTKA 1O47A 1AYBA 3BUMB 3N8MA 2LNWA 1O4NA 1R1QA 1SPSA 5D0JA 3S8OA 2FCIA 3HIZB 3K2MA 1BHFA 2CI9A 4F5AA 2BBUA 2PNAA 4XZ1A 1TZEE 2QMSA 1LUNA 2XP1A 5DF6A 5IBSA 2ETZA 4EY0A 1F2FA 1IJRA 1F1WA 1YVHA 3VRYA 3VS4A 1O4CA 1Z3KA 2LQNA 1MILA 2EU0A 5DC0B 1O4QA 1CSZA 3PS5A 1O4BA 3GXXA 2PNBA 3TKZA 2IUIA 1Y1UA 3MXCA 5I6VA 2AOAA 2MRJA 2PLDA 3VRPA 1GRIA 2C0TA 4K44A 1FMKA 1O48A 2L6KA 2KK6A 4U1PA 4EIHA 2OQ1A 1NZVA 1BF5A 1HCSB 3PSKA 1BKMA 2H8HA 5HKWA 3NHNA 1QG1E 5EELA 1BFIA 4E93A 4D8KA 1NZLA 2HDVA 1KSWA 1O4EA 2YU7A 3CWGA 2DX0A 4OHIA 1OO4A 2MRKA 1O4KA 3VS6A 3T04A 3N84A 3VS3A 2YSXA 3BUWB 2MK2A 1A81A 3VS2A 1O4HA 2RORA 5HKZA 4A4BA 3VRRA 5DC9A 4ROJA 1BKLA 1D4WA 1JWOA 2RMXA 5GJHA 1A07A 3S8LA 3ZNIA 1JU5A 2FO0A 1X0NA 1AYDA 2EO6A 1O42A 1FYRA 3OVEA 1A1EA 1ZFPE 2MQIA 2C0OA 1O4FA 2AUGA 1UURA 2KNOA 3PLFB 5EHPA 3BUXB 1KC2A 4LUEA 1O4PA 1KA7A 1IS0A 1MW4A 4JGHA 3VS5A 1LKLA 3OV1A 1G83A 3EACA 1FU5A 2LNXA 4GPLB 1D1ZA 2IUGA 3EAZA 3VROA 1O4IA 2LCTA 3CBLA 4P9ZA 2IZVA 5AULA 4DGPA 4P9VA 1BHHB 2RVFA 1CSYA 4QSYA 1BLKA 3IN8A 3PFVA 4H1OA 1FHSA 1AOUF 1OPLA 3PSJA 2EYYA 2CI8A 4E68A 1P13A 2OZOA 2ABLA 3KFJA 2SHPA 1XA6A 2HDXA 3TL0A 1TCEA 2C0IA 3MAZA 4FBNA 3IMJA 1O4MA 3VRZA 2IUHA 1GHUA 1CWDL 1LCJA 4OHDA 1X6CA 2C9WA 4K45A 1WQUA 3HCKA 3PQZA 1M61A 1UUSA 3OB2B 2JYQA 1AD5A 1SHBA 2EO3A 1BG1A 4DGXA 2MC1A 2EL8A 2SRCA 3IMDA 1BLJA 2CBLA 3HHMB 2H46E 1SHDA 3CD3A 3CXLA 4XZ0A 5GJIA 1O49A 4GL9E 1A1CA 1AOTF 4WWQA 3UYOA 3PJPA 1O44A 2AOBA 5IBMA 1LUKA 1O41A 4K11A 3OB1B 3VGOA 2HUWA 3M7FA 3S9KA 1RPYA 3VRQA 2Y3AB 1K9AA 1H9OA 2L4KA 1LKKA 1BFJA 2CS0A 1O4RA 1A08A 1BHHA 5J3XA 2CRHA 2EYVA 1O4GA 3BUOB 1R1PA 1I3ZA 2EYZA 5BO4A 1HCTB 4OHHA 2K7AB 1O4JA 2K79B 1X27A 4X6SA 4A4CA 2DLYA 1SKJA 1O46A 2DM0A 4GWFA 1RQQC 4TZIA 2DLZA 4FL2A 2B3OA 1SHAA 3WA4A 3UF4A 2CR4A 1SPRA 3MXYA 1O43A 2HMHA 4OHEA 5EG3B 2CIAA 1O4AA 1LUMA 1OO3A 3OP0A 2PLEA 4U17A 1CWEA 1QADA 3GQIB 5HKYA 2GSBA 3C7IA 2EOBA 2L3TA 2Y1NA 1O45A 1Y57A 1D4TA 2GE9A 4LUDA 3VS0A 1FU6A 1JYUA 3GXWA 1M27A 4K2RA 1R1SA 3QWYA 4NWFA 1BMBA 4L1BB 1JYRA 1A1BA 3VS1A 1PICA 1AYAA 2EKXA 1KA6A 1AB2A 4JEGA 4NWGA 2HCKA 3US4A 4OHLA 1RJAA 5AXIA 3IN7A 2LQWA 3BUNB 5DC4A 2VIFA 1B47A 1O4LA 1LUIA 1YVLA 1NRVA 1JYQA 3S8NA 1O4OA 2ECDA 4M4ZA 1FBZA 4F5BA 1A09A 1AYCA 2H5KA 2DVJA 5EEQA 4F59A 1A1AA 1FBVA 3VRNA 4FL3A 5KAZA 4JE4A 2Y1MA 5EHRA 4H34A 1QCFA 5CDWA 1OPKA 3QWXX 2RSYA
chains in the Genus database with same CATH superfamily
1BM2A 2DCRA 3N7YA 3VS7A 3BKBA 1LCKA 1CJ1A 1O4DA 2PTKA 1O47A 1AYBA 3BUMB 2KGYA 3N8MA 2LNWA 1O4NA 1R1QA 1SPSA 5D0JA 3S8OA 2FCIA 3HIZB 3K2MA 1BHFA 2CI9A 4F5AA 2BBUA 2PNAA 4XZ1A 1TZEE 2QMSA 1LUNA 2XP1A 5DF6A 5IBSA 2ETZA 4EY0A 1F2FA 1IJRA 1F1WA 1YVHA 3VRYA 3VS4A 1O4CA 1Z3KA 2LQNA 1MILA 2EU0A 5DC0B 1O4QA 1CSZA 3PS5A 1O4BA 3GXXA 2PNBA 3TKZA 2IUIA 1Y1UA 3MXCA 5I6VA 2AOAA 2MRJA 2PLDA 3VRPA 1GRIA 2C0TA 4K44A 1FMKA 1O48A 2L6KA 2KK6A 4U1PA 4EIHA 2OQ1A 1NZVA 1BF5A 1HCSB 3PSKA 1BKMA 2H8HA 5HKWA 3NHNA 1QG1E 5EELA 1BFIA 4E93A 4D8KA 1NZLA 2HDVA 1KSWA 1O4EA 2YU7A 3CWGA 2DX0A 4OHIA 1OO4A 2MRKA 1O4KA 3VS6A 3T04A 3N84A 3VS3A 2YSXA 3BUWB 2MK2A 1A81A 3VS2A 1O4HA 2RORA 5HKZA 4A4BA 3VRRA 5DC9A 4ROJA 1BKLA 1D4WA 1JWOA 2RMXA 5GJHA 1A07A 3S8LA 3ZNIA 1JU5A 2FO0A 1X0NA 1AYDA 2EO6A 1O42A 1FYRA 3OVEA 1A1EA 1ZFPE 2MQIA 2C0OA 1O4FA 2AUGA 1UURA 2KNOA 3PLFB 5EHPA 3BUXB 1KC2A 4LUEA 1O4PA 1KA7A 1IS0A 1MW4A 4JGHA 3VS5A 1LKLA 3OV1A 1G83A 3EACA 1FU5A 2LNXA 4GPLB 1D1ZA 2IUGA 3EAZA 3VROA 1O4IA 2LCTA 3CBLA 4P9ZA 2IZVA 5AULA 4DGPA 4P9VA 1BHHB 2RVFA 1CSYA 4QSYA 1BLKA 3IN8A 3PFVA 4H1OA 1FHSA 1AOUF 1OPLA 3PSJA 2EYYA 2CI8A 4E68A 1P13A 2OZOA 2ABLA 3KFJA 2SHPA 1XA6A 2HDXA 3TL0A 1TCEA 2C0IA 3MAZA 4FBNA 3IMJA 3K2TA 1O4MA 3VRZA 2IUHA 1GHUA 1CWDL 1LCJA 4OHDA 1X6CA 2C9WA 4K45A 1WQUA 3HCKA 3PQZA 1M61A 1UUSA 3OB2B 2JYQA 1AD5A 1SHBA 2EO3A 1BG1A 4DGXA 2MC1A 2EL8A 2SRCA 3IMDA 1BLJA 2CBLA 3HHMB 2H46E 1SHDA 3CD3A 3CXLA 4XZ0A 5GJIA 1O49A 4GL9E 1A1CA 1AOTF 4WWQA 3UYOA 3PJPA 1O44A 2AOBA 5IBMA 1LUKA 1O41A 4K11A 3OB1B 3VGOA 2HUWA 3M7FA 3S9KA 1RPYA 3VRQA 2Y3AB 1K9AA 1H9OA 2L4KA 1LKKA 1BFJA 2CS0A 1O4RA 1A08A 1BHHA 5J3XA 2CRHA 2EYVA 2LRAA 1O4GA 3BUOB 1R1PA 1I3ZA 2EYZA 5BO4A 1HCTB 4OHHA 2K7AB 1O4JA 2K79B 1X27A 4X6SA 4A4CA 2DLYA 1SKJA 1O46A 2DM0A 4GWFA 1RQQC 4TZIA 2DLZA 4FL2A 2B3OA 1SHAA 3WA4A 3UF4A 2CR4A 1SPRA 3MXYA 1O43A 2HMHA 4OHEA 5EG3B 2CIAA 1O4AA 1LUMA 1OO3A 3OP0A 2PLEA 4U17A 1CWEA 1QADA 3GQIB 5HKYA 2GSBA 3C7IA 2EOBA 2L3TA 2Y1NA 1O45A 1Y57A 1D4TA 2GE9A 4LUDA 3VS0A 1FU6A 1JYUA 3GXWA 1M27A 3LYVA 4K2RA 1R1SA 3QWYA 4NWFA 1BMBA 4L1BB 1JYRA 1A1BA 3VS1A 1PICA 1AYAA 2EKXA 1KA6A 1AB2A 4JEGA 4NWGA 2HCKA 3US4A 4OHLA 1RJAA 5AXIA 3IN7A 2LQWA 3BUNB 2VIFA 5DC4A 1B47A 1O4LA 1LUIA 1YVLA 1NRVA 1JYQA 3S8NA 1O4OA 2ECDA 4M4ZA 1FBZA 4F5BA 1A09A 1AYCA 2H5KA 2DVJA 5EEQA 4F59A 1A1AA 1FBVA 3VRNA 4FL3A 5KAZA 4JE4A 2Y1MA 5EHRA 4H34A 1QCFA 5CDWA 1OPKA 3QWXX 2RSYA
chains in the Genus database with same CATH topology
1BM2A 2DCRA 3N7YA 3VS7A 3BKBA 1LCKA 1CJ1A 1O4DA 2PTKA 1O47A 1AYBA 3BUMB 3N8MA 2LNWA 1O4NA 1R1QA 1SPSA 5D0JA 3S8OA 2FCIA 3HIZB 3K2MA 1BHFA 2CI9A 4F5AA 2BBUA 2PNAA 4XZ1A 1TZEE 2QMSA 1LUNA 2XP1A 5DF6A 5IBSA 2ETZA 4EY0A 1F2FA 1IJRA 1F1WA 1YVHA 3VRYA 3VS4A 1O4CA 1Z3KA 2LQNA 1MILA 2EU0A 5DC0B 1O4QA 1CSZA 3PS5A 1O4BA 3GXXA 2PNBA 3TKZA 2IUIA 1Y1UA 3MXCA 5I6VA 2AOAA 2MRJA 2PLDA 3VRPA 1GRIA 2C0TA 4K44A 1FMKA 1O48A 2L6KA 2KK6A 4U1PA 4EIHA 2OQ1A 1NZVA 1BF5A 1HCSB 3PSKA 1BKMA 2H8HA 5HKWA 3NHNA 1QG1E 5EELA 1BFIA 4E93A 4D8KA 1NZLA 2HDVA 1KSWA 1O4EA 2YU7A 3CWGA 2DX0A 4OHIA 1OO4A 2MRKA 1O4KA 3VS6A 3T04A 3N84A 3VS3A 2YSXA 3BUWB 2MK2A 1A81A 3VS2A 1O4HA 2RORA 5HKZA 4A4BA 3VRRA 5DC9A 4ROJA 1BKLA 1D4WA 1JWOA 2RMXA 5GJHA 1A07A 3S8LA 3ZNIA 1JU5A 2FO0A 1X0NA 1AYDA 2EO6A 1O42A 1FYRA 3OVEA 1A1EA 1ZFPE 2MQIA 2C0OA 1O4FA 2AUGA 1UURA 2KNOA 3PLFB 5EHPA 3BUXB 1KC2A 4LUEA 1O4PA 1KA7A 1IS0A 1MW4A 4JGHA 3VS5A 1LKLA 3OV1A 1G83A 3EACA 1FU5A 2LNXA 4GPLB 1D1ZA 2IUGA 3EAZA 3VROA 1O4IA 2LCTA 3CBLA 4P9ZA 2IZVA 5AULA 4DGPA 4P9VA 1BHHB 2RVFA 1CSYA 4QSYA 1BLKA 3IN8A 3PFVA 4H1OA 1FHSA 1AOUF 1OPLA 3PSJA 2EYYA 2CI8A 4E68A 1P13A 2OZOA 2ABLA 3KFJA 2SHPA 1XA6A 2HDXA 3TL0A 1TCEA 2C0IA 3MAZA 4FBNA 3IMJA 1O4MA 3VRZA 2IUHA 1GHUA 1CWDL 1LCJA 4OHDA 1X6CA 2C9WA 4K45A 1WQUA 3HCKA 3PQZA 1M61A 1UUSA 3OB2B 2JYQA 1AD5A 1SHBA 2EO3A 1BG1A 4DGXA 2MC1A 2EL8A 2SRCA 3IMDA 1BLJA 2CBLA 3HHMB 2H46E 1SHDA 3CD3A 3CXLA 4XZ0A 5GJIA 1O49A 4GL9E 1A1CA 1AOTF 4WWQA 3UYOA 3PJPA 1O44A 2AOBA 5IBMA 1LUKA 1O41A 4K11A 3OB1B 3VGOA 2HUWA 3M7FA 3S9KA 1RPYA 3VRQA 2Y3AB 1K9AA 1H9OA 2L4KA 1LKKA 1BFJA 2CS0A 1O4RA 1A08A 1BHHA 5J3XA 2CRHA 2EYVA 1O4GA 3BUOB 1R1PA 1I3ZA 2EYZA 5BO4A 1HCTB 4OHHA 2K7AB 1O4JA 2K79B 1X27A 4X6SA 4A4CA 2DLYA 1SKJA 1O46A 2DM0A 4GWFA 1RQQC 4TZIA 2DLZA 4FL2A 2B3OA 1SHAA 3WA4A 3UF4A 2CR4A 1SPRA 3MXYA 1O43A 2HMHA 4OHEA 5EG3B 2CIAA 1O4AA 1LUMA 1OO3A 3OP0A 2PLEA 4U17A 1CWEA 1QADA 3GQIB 5HKYA 2GSBA 3C7IA 2EOBA 2L3TA 2Y1NA 1O45A 1Y57A 1D4TA 2GE9A 4LUDA 3VS0A 1FU6A 1JYUA 3GXWA 1M27A 4K2RA 1R1SA 3QWYA 4NWFA 1BMBA 4L1BB 1JYRA 1A1BA 3VS1A 1PICA 1AYAA 2EKXA 1KA6A 1AB2A 4JEGA 4NWGA 2HCKA 3US4A 4OHLA 1RJAA 5AXIA 3IN7A 2LQWA 3BUNB 5DC4A 2VIFA 1B47A 1O4LA 1LUIA 1YVLA 1NRVA 1JYQA 3S8NA 1O4OA 2ECDA 4M4ZA 1FBZA 4F5BA 1A09A 1AYCA 2H5KA 2DVJA 5EEQA 4F59A 1A1AA 1FBVA 3VRNA 4FL3A 5KAZA 4JE4A 2Y1MA 5EHRA 4H34A 1QCFA 5CDWA 1OPKA 3QWXX 2RSYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BM2 A;  2DCR A;  3N7Y A;  3VS7 A;  3BKB A;  1LCK A;  1CJ1 A;  1O4D A;  2PTK A;  1O47 A;  1AYB A;  3BUM B;  3N8M A;  2LNW A;  1O4N A;  1R1Q A;  1SPS A;  5D0J A;  3S8O A;  2FCI A;  3HIZ B;  3K2M A;  1BHF A;  2CI9 A;  4F5A A;  2BBU A;  2PNA A;  4XZ1 A;  1TZE E;  2QMS A;  1LUN A;  2XP1 A;  5DF6 A;  5IBS A;  2ETZ A;  4EY0 A;  1F2F A;  1IJR A;  1F1W A;  1YVH A;  3VRY A;  3VS4 A;  1O4C A;  1Z3K A;  2LQN A;  1MIL A;  2EU0 A;  5DC0 B;  1O4Q A;  1CSZ A;  3PS5 A;  1O4B A;  3GXX A;  2PNB A;  3TKZ A;  2IUI A;  1Y1U A;  3MXC A;  5I6V A;  2AOA A;  2MRJ A;  2PLD A;  3VRP A;  1GRI A;  2C0T A;  4K44 A;  1FMK A;  1O48 A;  2L6K A;  2KK6 A;  4U1P A;  4EIH A;  2OQ1 A;  1NZV A;  1BF5 A;  1HCS B;  3PSK A;  1BKM A;  2H8H A;  5HKW A;  3NHN A;  1QG1 E;  5EEL A;  1BFI A;  4E93 A;  4D8K A;  1NZL A;  2HDV A;  1KSW A;  1O4E A;  2YU7 A;  3CWG A;  2DX0 A;  4OHI A;  1OO4 A;  2MRK A;  1O4K A;  3VS6 A;  3T04 A;  3N84 A;  3VS3 A;  2YSX A;  3BUW B;  2MK2 A;  1A81 A;  3VS2 A;  1O4H A;  2ROR A;  5HKZ A;  4A4B A;  3VRR A;  5DC9 A;  4ROJ A;  1BKL A;  1D4W A;  1JWO A;  2RMX A;  5GJH A;  1A07 A;  3S8L A;  3ZNI A;  1JU5 A;  2FO0 A;  1X0N A;  1AYD A;  2EO6 A;  1O42 A;  1FYR A;  3OVE A;  1A1E A;  1ZFP E;  2MQI A;  2C0O A;  1O4F A;  2AUG A;  1UUR A;  2KNO A;  3PLF B;  5EHP A;  3BUX B;  1KC2 A;  4LUE A;  1O4P A;  1KA7 A;  1IS0 A;  1MW4 A;  4JGH A;  3VS5 A;  1LKL A;  3OV1 A;  1G83 A;  3EAC A;  1FU5 A;  2LNX A;  4GPL B;  1D1Z A;  2IUG A;  3EAZ A;  3VRO A;  1O4I A;  2LCT A;  3CBL A;  4P9Z A;  2IZV A;  5AUL A;  4DGP A;  4P9V A;  1BHH B;  2RVF A;  1CSY A;  4QSY A;  1BLK A;  3IN8 A;  3PFV A;  4H1O A;  1FHS A;  1AOU F;  1OPL A;  3PSJ A;  2EYY A;  2CI8 A;  4E68 A;  1P13 A;  2OZO A;  2ABL A;  3KFJ A;  2SHP A;  1XA6 A;  2HDX A;  3TL0 A;  1TCE A;  2C0I A;  3MAZ A;  4FBN A;  3IMJ A;  1O4M A;  3VRZ A;  2IUH A;  1GHU A;  1CWD L;  1LCJ A;  4OHD A;  1X6C A;  2C9W A;  4K45 A;  1WQU A;  3HCK A;  3PQZ A;  1M61 A;  1UUS A;  3OB2 B;  2JYQ A;  1AD5 A;  1SHB A;  2EO3 A;  1BG1 A;  4DGX A;  2MC1 A;  2EL8 A;  2SRC A;  3IMD A;  1BLJ A;  2CBL A;  3HHM B;  2H46 E;  1SHD A;  3CD3 A;  3CXL A;  4XZ0 A;  5GJI A;  1O49 A;  4GL9 E;  1A1C A;  1AOT F;  4WWQ A;  3UYO A;  3PJP A;  1O44 A;  2AOB A;  5IBM A;  1LUK A;  1O41 A;  4K11 A;  3OB1 B;  3VGO A;  2HUW A;  3M7F A;  3S9K A;  1RPY A;  3VRQ A;  2Y3A B;  1K9A A;  1H9O A;  2L4K A;  1LKK A;  1BFJ A;  2CS0 A;  1O4R A;  1A08 A;  1BHH A;  5J3X A;  2CRH A;  2EYV A;  1O4G A;  3BUO B;  1R1P A;  1I3Z A;  2EYZ A;  5BO4 A;  1HCT B;  4OHH A;  2K7A B;  1O4J A;  2K79 B;  1X27 A;  4X6S A;  4A4C A;  2DLY A;  1SKJ A;  1O46 A;  2DM0 A;  4GWF A;  1RQQ C;  4TZI A;  2DLZ A;  4FL2 A;  2B3O A;  1SHA A;  3WA4 A;  3UF4 A;  2CR4 A;  1SPR A;  3MXY A;  1O43 A;  2HMH A;  4OHE A;  5EG3 B;  2CIA A;  1O4A A;  1LUM A;  1OO3 A;  3OP0 A;  2PLE A;  4U17 A;  1CWE A;  1QAD A;  3GQI B;  5HKY A;  2GSB A;  3C7I A;  2EOB A;  2L3T A;  2Y1N A;  1O45 A;  1Y57 A;  1D4T A;  2GE9 A;  4LUD A;  3VS0 A;  1FU6 A;  1JYU A;  3GXW A;  1M27 A;  4K2R A;  1R1S A;  3QWY A;  4NWF A;  1BMB A;  4L1B B;  1JYR A;  1A1B A;  3VS1 A;  1PIC A;  1AYA A;  2EKX A;  1KA6 A;  1AB2 A;  4JEG A;  4NWG A;  2HCK A;  3US4 A;  4OHL A;  1RJA A;  5AXI A;  3IN7 A;  2LQW A;  3BUN B;  5DC4 A;  2VIF A;  1B47 A;  1O4L A;  1LUI A;  1YVL A;  1NRV A;  1JYQ A;  3S8N A;  1O4O A;  2ECD A;  4M4Z A;  1FBZ A;  4F5B A;  1A09 A;  1AYC A;  2H5K A;  2DVJ A;  5EEQ A;  4F59 A;  1A1A A;  1FBV A;  3VRN A;  4FL3 A;  5KAZ A;  4JE4 A;  2Y1M A;  5EHR A;  4H34 A;  1QCF A;  5CDW A;  1OPK A;  3QWX X;  2RSY A; 
#chains in the Genus database with same CATH topology
 1BM2 A;  2DCR A;  3N7Y A;  3VS7 A;  3BKB A;  1LCK A;  1CJ1 A;  1O4D A;  2PTK A;  1O47 A;  1AYB A;  3BUM B;  2KGY A;  3N8M A;  2LNW A;  1O4N A;  1R1Q A;  1SPS A;  5D0J A;  3S8O A;  2FCI A;  3HIZ B;  3K2M A;  1BHF A;  2CI9 A;  4F5A A;  2BBU A;  2PNA A;  4XZ1 A;  1TZE E;  2QMS A;  1LUN A;  2XP1 A;  5DF6 A;  5IBS A;  2ETZ A;  4EY0 A;  1F2F A;  1IJR A;  1F1W A;  1YVH A;  3VRY A;  3VS4 A;  1O4C A;  1Z3K A;  2LQN A;  1MIL A;  2EU0 A;  5DC0 B;  1O4Q A;  1CSZ A;  3PS5 A;  1O4B A;  3GXX A;  2PNB A;  3TKZ A;  2IUI A;  1Y1U A;  3MXC A;  5I6V A;  2AOA A;  2MRJ A;  2PLD A;  3VRP A;  1GRI A;  2C0T A;  4K44 A;  1FMK A;  1O48 A;  2L6K A;  2KK6 A;  4U1P A;  4EIH A;  2OQ1 A;  1NZV A;  1BF5 A;  1HCS B;  3PSK A;  1BKM A;  2H8H A;  5HKW A;  3NHN A;  1QG1 E;  5EEL A;  1BFI A;  4E93 A;  4D8K A;  1NZL A;  2HDV A;  1KSW A;  1O4E A;  2YU7 A;  3CWG A;  2DX0 A;  4OHI A;  1OO4 A;  2MRK A;  1O4K A;  3VS6 A;  3T04 A;  3N84 A;  3VS3 A;  2YSX A;  3BUW B;  2MK2 A;  1A81 A;  3VS2 A;  1O4H A;  2ROR A;  5HKZ A;  4A4B A;  3VRR A;  5DC9 A;  4ROJ A;  1BKL A;  1D4W A;  1JWO A;  2RMX A;  5GJH A;  1A07 A;  3S8L A;  3ZNI A;  1JU5 A;  2FO0 A;  1X0N A;  1AYD A;  2EO6 A;  1O42 A;  1FYR A;  3OVE A;  1A1E A;  1ZFP E;  2MQI A;  2C0O A;  1O4F A;  2AUG A;  1UUR A;  2KNO A;  3PLF B;  5EHP A;  3BUX B;  1KC2 A;  4LUE A;  1O4P A;  1KA7 A;  1IS0 A;  1MW4 A;  4JGH A;  3VS5 A;  1LKL A;  3OV1 A;  1G83 A;  3EAC A;  1FU5 A;  2LNX A;  4GPL B;  1D1Z A;  2IUG A;  3EAZ A;  3VRO A;  1O4I A;  2LCT A;  3CBL A;  4P9Z A;  2IZV A;  5AUL A;  4DGP A;  4P9V A;  1BHH B;  2RVF A;  1CSY A;  4QSY A;  1BLK A;  3IN8 A;  3PFV A;  4H1O A;  1FHS A;  1AOU F;  1OPL A;  3PSJ A;  2EYY A;  2CI8 A;  4E68 A;  1P13 A;  2OZO A;  2ABL A;  3KFJ A;  2SHP A;  1XA6 A;  2HDX A;  3TL0 A;  1TCE A;  2C0I A;  3MAZ A;  4FBN A;  3IMJ A;  3K2T A;  1O4M A;  3VRZ A;  2IUH A;  1GHU A;  1CWD L;  1LCJ A;  4OHD A;  1X6C A;  2C9W A;  4K45 A;  1WQU A;  3HCK A;  3PQZ A;  1M61 A;  1UUS A;  3OB2 B;  2JYQ A;  1AD5 A;  1SHB A;  2EO3 A;  1BG1 A;  4DGX A;  2MC1 A;  2EL8 A;  2SRC A;  3IMD A;  1BLJ A;  2CBL A;  3HHM B;  2H46 E;  1SHD A;  3CD3 A;  3CXL A;  4XZ0 A;  5GJI A;  1O49 A;  4GL9 E;  1A1C A;  1AOT F;  4WWQ A;  3UYO A;  3PJP A;  1O44 A;  2AOB A;  5IBM A;  1LUK A;  1O41 A;  4K11 A;  3OB1 B;  3VGO A;  2HUW A;  3M7F A;  3S9K A;  1RPY A;  3VRQ A;  2Y3A B;  1K9A A;  1H9O A;  2L4K A;  1LKK A;  1BFJ A;  2CS0 A;  1O4R A;  1A08 A;  1BHH A;  5J3X A;  2CRH A;  2EYV A;  2LRA A;  1O4G A;  3BUO B;  1R1P A;  1I3Z A;  2EYZ A;  5BO4 A;  1HCT B;  4OHH A;  2K7A B;  1O4J A;  2K79 B;  1X27 A;  4X6S A;  4A4C A;  2DLY A;  1SKJ A;  1O46 A;  2DM0 A;  4GWF A;  1RQQ C;  4TZI A;  2DLZ A;  4FL2 A;  2B3O A;  1SHA A;  3WA4 A;  3UF4 A;  2CR4 A;  1SPR A;  3MXY A;  1O43 A;  2HMH A;  4OHE A;  5EG3 B;  2CIA A;  1O4A A;  1LUM A;  1OO3 A;  3OP0 A;  2PLE A;  4U17 A;  1CWE A;  1QAD A;  3GQI B;  5HKY A;  2GSB A;  3C7I A;  2EOB A;  2L3T A;  2Y1N A;  1O45 A;  1Y57 A;  1D4T A;  2GE9 A;  4LUD A;  3VS0 A;  1FU6 A;  1JYU A;  3GXW A;  1M27 A;  3LYV A;  4K2R A;  1R1S A;  3QWY A;  4NWF A;  1BMB A;  4L1B B;  1JYR A;  1A1B A;  3VS1 A;  1PIC A;  1AYA A;  2EKX A;  1KA6 A;  1AB2 A;  4JEG A;  4NWG A;  2HCK A;  3US4 A;  4OHL A;  1RJA A;  5AXI A;  3IN7 A;  2LQW A;  3BUN B;  2VIF A;  5DC4 A;  1B47 A;  1O4L A;  1LUI A;  1YVL A;  1NRV A;  1JYQ A;  3S8N A;  1O4O A;  2ECD A;  4M4Z A;  1FBZ A;  4F5B A;  1A09 A;  1AYC A;  2H5K A;  2DVJ A;  5EEQ A;  4F59 A;  1A1A A;  1FBV A;  3VRN A;  4FL3 A;  5KAZ A;  4JE4 A;  2Y1M A;  5EHR A;  4H34 A;  1QCF A;  5CDW A;  1OPK A;  3QWX X;  2RSY A; 
#chains in the Genus database with same CATH homology
 1BM2 A;  2DCR A;  3N7Y A;  3VS7 A;  3BKB A;  1LCK A;  1CJ1 A;  1O4D A;  2PTK A;  1O47 A;  1AYB A;  3BUM B;  3N8M A;  2LNW A;  1O4N A;  1R1Q A;  1SPS A;  5D0J A;  3S8O A;  2FCI A;  3HIZ B;  3K2M A;  1BHF A;  2CI9 A;  4F5A A;  2BBU A;  2PNA A;  4XZ1 A;  1TZE E;  2QMS A;  1LUN A;  2XP1 A;  5DF6 A;  5IBS A;  2ETZ A;  4EY0 A;  1F2F A;  1IJR A;  1F1W A;  1YVH A;  3VRY A;  3VS4 A;  1O4C A;  1Z3K A;  2LQN A;  1MIL A;  2EU0 A;  5DC0 B;  1O4Q A;  1CSZ A;  3PS5 A;  1O4B A;  3GXX A;  2PNB A;  3TKZ A;  2IUI A;  1Y1U A;  3MXC A;  5I6V A;  2AOA A;  2MRJ A;  2PLD A;  3VRP A;  1GRI A;  2C0T A;  4K44 A;  1FMK A;  1O48 A;  2L6K A;  2KK6 A;  4U1P A;  4EIH A;  2OQ1 A;  1NZV A;  1BF5 A;  1HCS B;  3PSK A;  1BKM A;  2H8H A;  5HKW A;  3NHN A;  1QG1 E;  5EEL A;  1BFI A;  4E93 A;  4D8K A;  1NZL A;  2HDV A;  1KSW A;  1O4E A;  2YU7 A;  3CWG A;  2DX0 A;  4OHI A;  1OO4 A;  2MRK A;  1O4K A;  3VS6 A;  3T04 A;  3N84 A;  3VS3 A;  2YSX A;  3BUW B;  2MK2 A;  1A81 A;  3VS2 A;  1O4H A;  2ROR A;  5HKZ A;  4A4B A;  3VRR A;  5DC9 A;  4ROJ A;  1BKL A;  1D4W A;  1JWO A;  2RMX A;  5GJH A;  1A07 A;  3S8L A;  3ZNI A;  1JU5 A;  2FO0 A;  1X0N A;  1AYD A;  2EO6 A;  1O42 A;  1FYR A;  3OVE A;  1A1E A;  1ZFP E;  2MQI A;  2C0O A;  1O4F A;  2AUG A;  1UUR A;  2KNO A;  3PLF B;  5EHP A;  3BUX B;  1KC2 A;  4LUE A;  1O4P A;  1KA7 A;  1IS0 A;  1MW4 A;  4JGH A;  3VS5 A;  1LKL A;  3OV1 A;  1G83 A;  3EAC A;  1FU5 A;  2LNX A;  4GPL B;  1D1Z A;  2IUG A;  3EAZ A;  3VRO A;  1O4I A;  2LCT A;  3CBL A;  4P9Z A;  2IZV A;  5AUL A;  4DGP A;  4P9V A;  1BHH B;  2RVF A;  1CSY A;  4QSY A;  1BLK A;  3IN8 A;  3PFV A;  4H1O A;  1FHS A;  1AOU F;  1OPL A;  3PSJ A;  2EYY A;  2CI8 A;  4E68 A;  1P13 A;  2OZO A;  2ABL A;  3KFJ A;  2SHP A;  1XA6 A;  2HDX A;  3TL0 A;  1TCE A;  2C0I A;  3MAZ A;  4FBN A;  3IMJ A;  1O4M A;  3VRZ A;  2IUH A;  1GHU A;  1CWD L;  1LCJ A;  4OHD A;  1X6C A;  2C9W A;  4K45 A;  1WQU A;  3HCK A;  3PQZ A;  1M61 A;  1UUS A;  3OB2 B;  2JYQ A;  1AD5 A;  1SHB A;  2EO3 A;  1BG1 A;  4DGX A;  2MC1 A;  2EL8 A;  2SRC A;  3IMD A;  1BLJ A;  2CBL A;  3HHM B;  2H46 E;  1SHD A;  3CD3 A;  3CXL A;  4XZ0 A;  5GJI A;  1O49 A;  4GL9 E;  1A1C A;  1AOT F;  4WWQ A;  3UYO A;  3PJP A;  1O44 A;  2AOB A;  5IBM A;  1LUK A;  1O41 A;  4K11 A;  3OB1 B;  3VGO A;  2HUW A;  3M7F A;  3S9K A;  1RPY A;  3VRQ A;  2Y3A B;  1K9A A;  1H9O A;  2L4K A;  1LKK A;  1BFJ A;  2CS0 A;  1O4R A;  1A08 A;  1BHH A;  5J3X A;  2CRH A;  2EYV A;  1O4G A;  3BUO B;  1R1P A;  1I3Z A;  2EYZ A;  5BO4 A;  1HCT B;  4OHH A;  2K7A B;  1O4J A;  2K79 B;  1X27 A;  4X6S A;  4A4C A;  2DLY A;  1SKJ A;  1O46 A;  2DM0 A;  4GWF A;  1RQQ C;  4TZI A;  2DLZ A;  4FL2 A;  2B3O A;  1SHA A;  3WA4 A;  3UF4 A;  2CR4 A;  1SPR A;  3MXY A;  1O43 A;  2HMH A;  4OHE A;  5EG3 B;  2CIA A;  1O4A A;  1LUM A;  1OO3 A;  3OP0 A;  2PLE A;  4U17 A;  1CWE A;  1QAD A;  3GQI B;  5HKY A;  2GSB A;  3C7I A;  2EOB A;  2L3T A;  2Y1N A;  1O45 A;  1Y57 A;  1D4T A;  2GE9 A;  4LUD A;  3VS0 A;  1FU6 A;  1JYU A;  3GXW A;  1M27 A;  4K2R A;  1R1S A;  3QWY A;  4NWF A;  1BMB A;  4L1B B;  1JYR A;  1A1B A;  3VS1 A;  1PIC A;  1AYA A;  2EKX A;  1KA6 A;  1AB2 A;  4JEG A;  4NWG A;  2HCK A;  3US4 A;  4OHL A;  1RJA A;  5AXI A;  3IN7 A;  2LQW A;  3BUN B;  5DC4 A;  2VIF A;  1B47 A;  1O4L A;  1LUI A;  1YVL A;  1NRV A;  1JYQ A;  3S8N A;  1O4O A;  2ECD A;  4M4Z A;  1FBZ A;  4F5B A;  1A09 A;  1AYC A;  2H5K A;  2DVJ A;  5EEQ A;  4F59 A;  1A1A A;  1FBV A;  3VRN A;  4FL3 A;  5KAZ A;  4JE4 A;  2Y1M A;  5EHR A;  4H34 A;  1QCF A;  5CDW A;  1OPK A;  3QWX X;  2RSY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...