2IUHA

Crystal structure of the pi3-kinase p85 n-terminal sh2 domain in complex with c-kit phosphotyrosyl peptide
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
115
structure length
115
Chain Sequence
NMSLQNAEWYWGDISREEVNEKLRDTADGTFLVRDASTKMHGDYTLTLRKGGNNKLIKIFHRDGKYGFSDPLTFSSVVELINHYRNESLAQYNPKLDVKLLYPVSKYQQDQVVKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords PHOSPHATIDYLINOSITOL 3-KINASE REGULATORY ALPHA SUBUNIT
publication title Crystal Structure of the Pi 3-Kinase P85 Amino-Terminal Sh2 Domain and its Phosphopeptide Complexes
pubmed doi rcsb
source organism Homo sapiens
total genus 32
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2006-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00017 SH2 SH2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.505.10 Alpha Beta 2-Layer Sandwich SHC Adaptor Protein SH2 domain 2iuhA00
1A1AA 3VRZA 4JEGA 1BKMA 4LUDA 4U17A 5AXIA 4QSYA 1X27A 4DGXA 1M61A 2RMXA 2LQNA 2CI8A 1KA7A 2C0OA 4FL3A 1A07A 4U1PA 1GHUA 1R1SA 2CBLA 2L6KA 2PLEA 3QWXX 2K79B 1O44A 2MK2A 2IUHA 2PNAA 1QG1E 1O4NA 3BUNB 1FHSA 2BBUA 1JYQA 1LUMA 1XA6A 1K9AA 1OO4A 2GE9A 3VS7A 2ECDA 5HKYA 1BHHA 3QWYA 1BFIA 1A09A 2C0TA 1O4QA 2YSXA 4L1BB 2MQIA 3BUXB 2HUWA 4JGHA 1D4TA 1LCJA 1D4WA 3PSKA 1UURA 1CJ1A 5HKZA 3K2MA 1JU5A 1O47A 3OB1B 1CWEA 5HKWA 5GJIA 3NHNA 2CR4A 1O42A 3MXCA 3PQZA 2EU0A 3VS6A 1X0NA 1FBZA 3BUOB 4H34A 4OHIA 5DF6A 4P9ZA 3IN7A 2OZOA 1O4PA 4GPLB 1O4KA 1SHDA 1B47A 2Y3AB 1RQQC 5D0JA 4TZIA 5GJHA 1MILA 1O49A 1JWOA 2DX0A 2H46E 5EEQA 2L4KA 1MW4A 2YU7A 4XZ1A 2AUGA 3IMDA 4E93A 1O4FA 4EIHA 3M7FA 1BF5A 1FYRA 1O4JA 4K45A 1IJRA 1F2FA 3PS5A 1PICA 2PLDA 1I3ZA 1IS0A 2B3OA 1A1BA 1A1CA 1Z3KA 4NWGA 1R1QA 3TL0A 2KNOA 3GQIB 4WWQA 2MRJA 2EO3A 2AOAA 2OQ1A 5DC4A 1KA6A 2C9WA 1SPSA 4A4BA 1A81A 4OHDA 4OHEA 2DLZA 2ABLA 4GWFA 3N8MA 1O4IA 5DC9A 3CBLA 3OP0A 2KK6A 4LUEA 1TCEA 1O43A 2EL8A 2H5KA 1SKJA 1BLJA 1FU5A 2JYQA 4K2RA 3PFVA 2IUGA 1YVLA 1FBVA 1A1EA 1HCSB 1AOUF 3VS2A 1FMKA 3PLFB 1LUNA 2SRCA 2H8HA 3VROA 1O4MA 3EACA 3VS5A 3VS3A 2IUIA 3US4A 4M4ZA 3CD3A 1A08A 5DC0B 5EG3B 5EHRA 1LUIA 2HMHA 3OV1A 5AULA 2VIFA 1CSZA 2LNXA 1SPRA 2LCTA 2CRHA 1F1WA 4EY0A 3MXYA 4ROJA 1O4GA 4K11A 1AOTF 1O48A 1GRIA 3S9KA 1BHHB 4X6SA 1O4EA 4F5AA 2MC1A 3S8NA 2LQWA 1BM2A 1FU6A 5I6VA 4K44A 3IN8A 2RORA 3VGOA 4OHHA 2HDXA 3WA4A 2EYZA 1LKLA 2PNBA 2HCKA 1BG1A 4OHLA 1G83A 1Y57A 1LUKA 1O4AA 2SHPA 3VRQA 2EOBA 1AYAA 2EYVA 1O45A 3CWGA 2Y1MA 3TKZA 1O4BA 1LCKA 3CXLA 3HIZB 3C7IA 3N7YA 4DGPA 4GL9E 1O4CA 2IZVA 2FO0A 2DVJA 1NRVA 2L3TA 1NZLA 2K7AB 1H9OA 2ETZA 1JYRA 2PTKA 3GXWA 2MRKA 1YVHA 3VS4A 1ZFPE 1OPKA 1RJAA 5EELA 1M27A 3VRNA 1CWDL 4XZ0A 3PJPA 2RSYA 3OVEA 3VS0A 1BKLA 4F5BA 2CI9A 3VRRA 1AD5A 1OO3A 1SHAA 1O41A 2GSBA 3UYOA 5KAZA 2CIAA 1BMBA 1NZVA 2DCRA 3S8LA 1O4RA 2FCIA 2CS0A 1KC2A 3HCKA 1O4DA 1JYUA 3BUWB 5CDWA 3UF4A 4A4CA 4NWFA 3VRPA 3BKBA 2QMSA 2RVFA 2EO6A 5IBSA 1CSYA 2DM0A 3HHMB 1UUSA 1R1PA 1AB2A 4H1OA 4E68A 3EAZA 1KSWA 4P9VA 3PSJA 4JE4A 4F59A 1TZEE 2AOBA 4FBNA 3KFJA 1BLKA 3VRYA 3IMJA 3GXXA 1O46A 1AYCA 1X6CA 3T04A 3MAZA 5J3XA 2EKXA 1QCFA 1AYBA 3BUMB 1RPYA 2DLYA 5EHPA 2C0IA 3OB2B 4D8KA 1O4LA 3S8OA 1O4HA 5BO4A 1HCTB 3VS1A 1D1ZA 2LNWA 1SHBA 3N84A 1WQUA 1BFJA 1BHFA 1AYDA 1Y1UA 2EYYA 1QADA 1OPLA 4FL2A 2XP1A 2Y1NA 3ZNIA 2HDVA 1P13A 1O4OA 1LKKA 5IBMA
chains in the Genus database with same CATH superfamily
1A1AA 3VRZA 4JEGA 1BKMA 4LUDA 4U17A 5AXIA 4QSYA 1X27A 4DGXA 1M61A 2RMXA 2LQNA 2CI8A 1KA7A 2C0OA 4FL3A 1A07A 4U1PA 1GHUA 1R1SA 2CBLA 2L6KA 2PLEA 3QWXX 2K79B 1O44A 2MK2A 2IUHA 2PNAA 1QG1E 1O4NA 3BUNB 1FHSA 2BBUA 1JYQA 1LUMA 1XA6A 1K9AA 1OO4A 2GE9A 3VS7A 2ECDA 5HKYA 1BHHA 3QWYA 1BFIA 1A09A 2C0TA 1O4QA 2YSXA 4L1BB 2MQIA 3BUXB 2HUWA 4JGHA 1D4TA 1LCJA 1D4WA 3PSKA 1UURA 1CJ1A 5HKZA 3K2MA 1JU5A 1O47A 3OB1B 1CWEA 5HKWA 5GJIA 3NHNA 2CR4A 1O42A 3MXCA 3PQZA 2EU0A 3VS6A 1X0NA 1FBZA 3BUOB 4H34A 4OHIA 5DF6A 4P9ZA 3IN7A 2OZOA 1O4PA 4GPLB 1O4KA 1SHDA 1B47A 2Y3AB 1RQQC 5D0JA 4TZIA 5GJHA 1MILA 1O49A 1JWOA 2DX0A 2H46E 5EEQA 2L4KA 1MW4A 2YU7A 4XZ1A 2AUGA 3IMDA 4E93A 1O4FA 4EIHA 3M7FA 1BF5A 1FYRA 1O4JA 4K45A 1IJRA 1F2FA 3PS5A 1PICA 2PLDA 1I3ZA 1IS0A 2B3OA 1A1BA 1A1CA 1Z3KA 4NWGA 1R1QA 3TL0A 2KNOA 3GQIB 4WWQA 2MRJA 2EO3A 2AOAA 2OQ1A 5DC4A 1KA6A 2C9WA 1SPSA 4A4BA 1A81A 4OHDA 4OHEA 2DLZA 2ABLA 4GWFA 3N8MA 1O4IA 5DC9A 3CBLA 3OP0A 2KK6A 4LUEA 1TCEA 1O43A 2EL8A 2H5KA 1SKJA 1BLJA 1FU5A 2JYQA 4K2RA 3PFVA 2IUGA 1YVLA 1FBVA 1A1EA 1HCSB 1AOUF 3VS2A 1FMKA 3PLFB 1LUNA 2SRCA 2H8HA 3VROA 1O4MA 3EACA 3VS5A 3VS3A 2IUIA 3US4A 4M4ZA 3CD3A 1A08A 5DC0B 5EG3B 5EHRA 1LUIA 2HMHA 3OV1A 5AULA 2VIFA 1CSZA 2LNXA 1SPRA 2LCTA 2CRHA 1F1WA 4EY0A 3MXYA 4ROJA 1O4GA 4K11A 1AOTF 1O48A 1GRIA 3S9KA 1BHHB 4X6SA 1O4EA 4F5AA 2MC1A 3S8NA 2LQWA 1BM2A 1FU6A 5I6VA 4K44A 3IN8A 2RORA 3VGOA 4OHHA 2HDXA 3WA4A 2EYZA 1LKLA 2PNBA 2HCKA 1BG1A 4OHLA 1G83A 1Y57A 1LUKA 1O4AA 2SHPA 3VRQA 2EOBA 1AYAA 2EYVA 1O45A 3CWGA 2Y1MA 3TKZA 1O4BA 1LCKA 3CXLA 3HIZB 3C7IA 3N7YA 4DGPA 4GL9E 1O4CA 2IZVA 2FO0A 2DVJA 1NRVA 2L3TA 1NZLA 2K7AB 1H9OA 2ETZA 1JYRA 2PTKA 3GXWA 2MRKA 1YVHA 3VS4A 1ZFPE 1OPKA 1RJAA 5EELA 1M27A 3VRNA 1CWDL 4XZ0A 3PJPA 2RSYA 3OVEA 3VS0A 1BKLA 4F5BA 2CI9A 3VRRA 1AD5A 1OO3A 1SHAA 1O41A 2GSBA 3UYOA 5KAZA 3K2TA 2CIAA 1BMBA 3LYVA 1NZVA 2DCRA 3S8LA 1O4RA 2FCIA 2CS0A 1KC2A 3HCKA 1O4DA 1JYUA 3BUWB 5CDWA 3UF4A 4A4CA 4NWFA 3VRPA 3BKBA 2QMSA 2RVFA 2EO6A 5IBSA 1CSYA 2DM0A 3HHMB 1UUSA 1R1PA 1AB2A 4H1OA 4E68A 3EAZA 1KSWA 4P9VA 3PSJA 4JE4A 4F59A 1TZEE 2KGYA 2AOBA 4FBNA 3KFJA 1BLKA 3VRYA 3IMJA 3GXXA 1O46A 1AYCA 1X6CA 3T04A 3MAZA 5J3XA 2EKXA 2LRAA 1QCFA 1AYBA 3BUMB 1RPYA 2DLYA 5EHPA 2C0IA 3OB2B 4D8KA 1O4LA 3S8OA 1O4HA 5BO4A 1HCTB 3VS1A 1D1ZA 2LNWA 1SHBA 3N84A 1WQUA 1BFJA 1BHFA 1AYDA 1Y1UA 2EYYA 1QADA 1OPLA 4FL2A 2XP1A 2Y1NA 3ZNIA 2HDVA 1P13A 1O4OA 1LKKA 5IBMA
chains in the Genus database with same CATH topology
1A1AA 3VRZA 4JEGA 1BKMA 4LUDA 4U17A 5AXIA 4QSYA 1X27A 4DGXA 1M61A 2RMXA 2LQNA 2CI8A 1KA7A 2C0OA 4FL3A 1A07A 4U1PA 1GHUA 1R1SA 2CBLA 2L6KA 2PLEA 3QWXX 2K79B 1O44A 2MK2A 2IUHA 2PNAA 1QG1E 1O4NA 3BUNB 1FHSA 2BBUA 1JYQA 1LUMA 1XA6A 1K9AA 1OO4A 2GE9A 3VS7A 2ECDA 5HKYA 1BHHA 3QWYA 1BFIA 1A09A 2C0TA 1O4QA 2YSXA 4L1BB 2MQIA 3BUXB 2HUWA 4JGHA 1D4TA 1LCJA 1D4WA 3PSKA 1UURA 1CJ1A 5HKZA 3K2MA 1JU5A 1O47A 3OB1B 1CWEA 5HKWA 5GJIA 3NHNA 2CR4A 1O42A 3MXCA 3PQZA 2EU0A 3VS6A 1X0NA 1FBZA 3BUOB 4H34A 4OHIA 5DF6A 4P9ZA 3IN7A 2OZOA 1O4PA 4GPLB 1O4KA 1SHDA 1B47A 2Y3AB 1RQQC 5D0JA 4TZIA 5GJHA 1MILA 1O49A 1JWOA 2DX0A 2H46E 5EEQA 2L4KA 1MW4A 2YU7A 4XZ1A 2AUGA 3IMDA 4E93A 1O4FA 4EIHA 3M7FA 1BF5A 1FYRA 1O4JA 4K45A 1IJRA 1F2FA 3PS5A 1PICA 2PLDA 1I3ZA 1IS0A 2B3OA 1A1BA 1A1CA 1Z3KA 4NWGA 1R1QA 3TL0A 2KNOA 3GQIB 4WWQA 2MRJA 2EO3A 2AOAA 2OQ1A 5DC4A 1KA6A 2C9WA 1SPSA 4A4BA 1A81A 4OHDA 4OHEA 2DLZA 2ABLA 4GWFA 3N8MA 1O4IA 5DC9A 3CBLA 3OP0A 2KK6A 4LUEA 1TCEA 1O43A 2EL8A 2H5KA 1SKJA 1BLJA 1FU5A 2JYQA 4K2RA 3PFVA 2IUGA 1YVLA 1FBVA 1A1EA 1HCSB 1AOUF 3VS2A 1FMKA 3PLFB 1LUNA 2SRCA 2H8HA 3VROA 1O4MA 3EACA 3VS5A 3VS3A 2IUIA 3US4A 4M4ZA 3CD3A 1A08A 5DC0B 5EG3B 5EHRA 1LUIA 2HMHA 3OV1A 5AULA 2VIFA 1CSZA 2LNXA 1SPRA 2LCTA 2CRHA 1F1WA 4EY0A 3MXYA 4ROJA 1O4GA 4K11A 1AOTF 1O48A 1GRIA 3S9KA 1BHHB 4X6SA 1O4EA 4F5AA 2MC1A 3S8NA 2LQWA 1BM2A 1FU6A 5I6VA 4K44A 3IN8A 2RORA 3VGOA 4OHHA 2HDXA 3WA4A 2EYZA 1LKLA 2PNBA 2HCKA 1BG1A 4OHLA 1G83A 1Y57A 1LUKA 1O4AA 2SHPA 3VRQA 2EOBA 1AYAA 2EYVA 1O45A 3CWGA 2Y1MA 3TKZA 1O4BA 1LCKA 3CXLA 3HIZB 3C7IA 3N7YA 4DGPA 4GL9E 1O4CA 2IZVA 2FO0A 2DVJA 1NRVA 2L3TA 1NZLA 2K7AB 1H9OA 2ETZA 1JYRA 2PTKA 3GXWA 2MRKA 1YVHA 3VS4A 1ZFPE 1OPKA 1RJAA 5EELA 1M27A 3VRNA 1CWDL 4XZ0A 3PJPA 2RSYA 3OVEA 3VS0A 1BKLA 4F5BA 2CI9A 3VRRA 1AD5A 1OO3A 1SHAA 1O41A 2GSBA 3UYOA 5KAZA 2CIAA 1BMBA 1NZVA 2DCRA 3S8LA 1O4RA 2FCIA 2CS0A 1KC2A 3HCKA 1O4DA 1JYUA 3BUWB 5CDWA 3UF4A 4A4CA 4NWFA 3VRPA 3BKBA 2QMSA 2RVFA 2EO6A 5IBSA 1CSYA 2DM0A 3HHMB 1UUSA 1R1PA 1AB2A 4H1OA 4E68A 3EAZA 1KSWA 4P9VA 3PSJA 4JE4A 4F59A 1TZEE 2AOBA 4FBNA 3KFJA 1BLKA 3VRYA 3IMJA 3GXXA 1O46A 1AYCA 1X6CA 3T04A 3MAZA 5J3XA 2EKXA 1QCFA 1AYBA 3BUMB 1RPYA 2DLYA 5EHPA 2C0IA 3OB2B 4D8KA 1O4LA 3S8OA 1O4HA 5BO4A 1HCTB 3VS1A 1D1ZA 2LNWA 1SHBA 3N84A 1WQUA 1BFJA 1BHFA 1AYDA 1Y1UA 2EYYA 1QADA 1OPLA 4FL2A 2XP1A 2Y1NA 3ZNIA 2HDVA 1P13A 1O4OA 1LKKA 5IBMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1A1A A;  3VRZ A;  4JEG A;  1BKM A;  4LUD A;  4U17 A;  5AXI A;  4QSY A;  1X27 A;  4DGX A;  1M61 A;  2RMX A;  2LQN A;  2CI8 A;  1KA7 A;  2C0O A;  4FL3 A;  1A07 A;  4U1P A;  1GHU A;  1R1S A;  2CBL A;  2L6K A;  2PLE A;  3QWX X;  2K79 B;  1O44 A;  2MK2 A;  2IUH A;  2PNA A;  1QG1 E;  1O4N A;  3BUN B;  1FHS A;  2BBU A;  1JYQ A;  1LUM A;  1XA6 A;  1K9A A;  1OO4 A;  2GE9 A;  3VS7 A;  2ECD A;  5HKY A;  1BHH A;  3QWY A;  1BFI A;  1A09 A;  2C0T A;  1O4Q A;  2YSX A;  4L1B B;  2MQI A;  3BUX B;  2HUW A;  4JGH A;  1D4T A;  1LCJ A;  1D4W A;  3PSK A;  1UUR A;  1CJ1 A;  5HKZ A;  3K2M A;  1JU5 A;  1O47 A;  3OB1 B;  1CWE A;  5HKW A;  5GJI A;  3NHN A;  2CR4 A;  1O42 A;  3MXC A;  3PQZ A;  2EU0 A;  3VS6 A;  1X0N A;  1FBZ A;  3BUO B;  4H34 A;  4OHI A;  5DF6 A;  4P9Z A;  3IN7 A;  2OZO A;  1O4P A;  4GPL B;  1O4K A;  1SHD A;  1B47 A;  2Y3A B;  1RQQ C;  5D0J A;  4TZI A;  5GJH A;  1MIL A;  1O49 A;  1JWO A;  2DX0 A;  2H46 E;  5EEQ A;  2L4K A;  1MW4 A;  2YU7 A;  4XZ1 A;  2AUG A;  3IMD A;  4E93 A;  1O4F A;  4EIH A;  3M7F A;  1BF5 A;  1FYR A;  1O4J A;  4K45 A;  1IJR A;  1F2F A;  3PS5 A;  1PIC A;  2PLD A;  1I3Z A;  1IS0 A;  2B3O A;  1A1B A;  1A1C A;  1Z3K A;  4NWG A;  1R1Q A;  3TL0 A;  2KNO A;  3GQI B;  4WWQ A;  2MRJ A;  2EO3 A;  2AOA A;  2OQ1 A;  5DC4 A;  1KA6 A;  2C9W A;  1SPS A;  4A4B A;  1A81 A;  4OHD A;  4OHE A;  2DLZ A;  2ABL A;  4GWF A;  3N8M A;  1O4I A;  5DC9 A;  3CBL A;  3OP0 A;  2KK6 A;  4LUE A;  1TCE A;  1O43 A;  2EL8 A;  2H5K A;  1SKJ A;  1BLJ A;  1FU5 A;  2JYQ A;  4K2R A;  3PFV A;  2IUG A;  1YVL A;  1FBV A;  1A1E A;  1HCS B;  1AOU F;  3VS2 A;  1FMK A;  3PLF B;  1LUN A;  2SRC A;  2H8H A;  3VRO A;  1O4M A;  3EAC A;  3VS5 A;  3VS3 A;  2IUI A;  3US4 A;  4M4Z A;  3CD3 A;  1A08 A;  5DC0 B;  5EG3 B;  5EHR A;  1LUI A;  2HMH A;  3OV1 A;  5AUL A;  2VIF A;  1CSZ A;  2LNX A;  1SPR A;  2LCT A;  2CRH A;  1F1W A;  4EY0 A;  3MXY A;  4ROJ A;  1O4G A;  4K11 A;  1AOT F;  1O48 A;  1GRI A;  3S9K A;  1BHH B;  4X6S A;  1O4E A;  4F5A A;  2MC1 A;  3S8N A;  2LQW A;  1BM2 A;  1FU6 A;  5I6V A;  4K44 A;  3IN8 A;  2ROR A;  3VGO A;  4OHH A;  2HDX A;  3WA4 A;  2EYZ A;  1LKL A;  2PNB A;  2HCK A;  1BG1 A;  4OHL A;  1G83 A;  1Y57 A;  1LUK A;  1O4A A;  2SHP A;  3VRQ A;  2EOB A;  1AYA A;  2EYV A;  1O45 A;  3CWG A;  2Y1M A;  3TKZ A;  1O4B A;  1LCK A;  3CXL A;  3HIZ B;  3C7I A;  3N7Y A;  4DGP A;  4GL9 E;  1O4C A;  2IZV A;  2FO0 A;  2DVJ A;  1NRV A;  2L3T A;  1NZL A;  2K7A B;  1H9O A;  2ETZ A;  1JYR A;  2PTK A;  3GXW A;  2MRK A;  1YVH A;  3VS4 A;  1ZFP E;  1OPK A;  1RJA A;  5EEL A;  1M27 A;  3VRN A;  1CWD L;  4XZ0 A;  3PJP A;  2RSY A;  3OVE A;  3VS0 A;  1BKL A;  4F5B A;  2CI9 A;  3VRR A;  1AD5 A;  1OO3 A;  1SHA A;  1O41 A;  2GSB A;  3UYO A;  5KAZ A;  2CIA A;  1BMB A;  1NZV A;  2DCR A;  3S8L A;  1O4R A;  2FCI A;  2CS0 A;  1KC2 A;  3HCK A;  1O4D A;  1JYU A;  3BUW B;  5CDW A;  3UF4 A;  4A4C A;  4NWF A;  3VRP A;  3BKB A;  2QMS A;  2RVF A;  2EO6 A;  5IBS A;  1CSY A;  2DM0 A;  3HHM B;  1UUS A;  1R1P A;  1AB2 A;  4H1O A;  4E68 A;  3EAZ A;  1KSW A;  4P9V A;  3PSJ A;  4JE4 A;  4F59 A;  1TZE E;  2AOB A;  4FBN A;  3KFJ A;  1BLK A;  3VRY A;  3IMJ A;  3GXX A;  1O46 A;  1AYC A;  1X6C A;  3T04 A;  3MAZ A;  5J3X A;  2EKX A;  1QCF A;  1AYB A;  3BUM B;  1RPY A;  2DLY A;  5EHP A;  2C0I A;  3OB2 B;  4D8K A;  1O4L A;  3S8O A;  1O4H A;  5BO4 A;  1HCT B;  3VS1 A;  1D1Z A;  2LNW A;  1SHB A;  3N84 A;  1WQU A;  1BFJ A;  1BHF A;  1AYD A;  1Y1U A;  2EYY A;  1QAD A;  1OPL A;  4FL2 A;  2XP1 A;  2Y1N A;  3ZNI A;  2HDV A;  1P13 A;  1O4O A;  1LKK A;  5IBM A; 
#chains in the Genus database with same CATH topology
 1A1A A;  3VRZ A;  4JEG A;  1BKM A;  4LUD A;  4U17 A;  5AXI A;  4QSY A;  1X27 A;  4DGX A;  1M61 A;  2RMX A;  2LQN A;  2CI8 A;  1KA7 A;  2C0O A;  4FL3 A;  1A07 A;  4U1P A;  1GHU A;  1R1S A;  2CBL A;  2L6K A;  2PLE A;  3QWX X;  2K79 B;  1O44 A;  2MK2 A;  2IUH A;  2PNA A;  1QG1 E;  1O4N A;  3BUN B;  1FHS A;  2BBU A;  1JYQ A;  1LUM A;  1XA6 A;  1K9A A;  1OO4 A;  2GE9 A;  3VS7 A;  2ECD A;  5HKY A;  1BHH A;  3QWY A;  1BFI A;  1A09 A;  2C0T A;  1O4Q A;  2YSX A;  4L1B B;  2MQI A;  3BUX B;  2HUW A;  4JGH A;  1D4T A;  1LCJ A;  1D4W A;  3PSK A;  1UUR A;  1CJ1 A;  5HKZ A;  3K2M A;  1JU5 A;  1O47 A;  3OB1 B;  1CWE A;  5HKW A;  5GJI A;  3NHN A;  2CR4 A;  1O42 A;  3MXC A;  3PQZ A;  2EU0 A;  3VS6 A;  1X0N A;  1FBZ A;  3BUO B;  4H34 A;  4OHI A;  5DF6 A;  4P9Z A;  3IN7 A;  2OZO A;  1O4P A;  4GPL B;  1O4K A;  1SHD A;  1B47 A;  2Y3A B;  1RQQ C;  5D0J A;  4TZI A;  5GJH A;  1MIL A;  1O49 A;  1JWO A;  2DX0 A;  2H46 E;  5EEQ A;  2L4K A;  1MW4 A;  2YU7 A;  4XZ1 A;  2AUG A;  3IMD A;  4E93 A;  1O4F A;  4EIH A;  3M7F A;  1BF5 A;  1FYR A;  1O4J A;  4K45 A;  1IJR A;  1F2F A;  3PS5 A;  1PIC A;  2PLD A;  1I3Z A;  1IS0 A;  2B3O A;  1A1B A;  1A1C A;  1Z3K A;  4NWG A;  1R1Q A;  3TL0 A;  2KNO A;  3GQI B;  4WWQ A;  2MRJ A;  2EO3 A;  2AOA A;  2OQ1 A;  5DC4 A;  1KA6 A;  2C9W A;  1SPS A;  4A4B A;  1A81 A;  4OHD A;  4OHE A;  2DLZ A;  2ABL A;  4GWF A;  3N8M A;  1O4I A;  5DC9 A;  3CBL A;  3OP0 A;  2KK6 A;  4LUE A;  1TCE A;  1O43 A;  2EL8 A;  2H5K A;  1SKJ A;  1BLJ A;  1FU5 A;  2JYQ A;  4K2R A;  3PFV A;  2IUG A;  1YVL A;  1FBV A;  1A1E A;  1HCS B;  1AOU F;  3VS2 A;  1FMK A;  3PLF B;  1LUN A;  2SRC A;  2H8H A;  3VRO A;  1O4M A;  3EAC A;  3VS5 A;  3VS3 A;  2IUI A;  3US4 A;  4M4Z A;  3CD3 A;  1A08 A;  5DC0 B;  5EG3 B;  5EHR A;  1LUI A;  2HMH A;  3OV1 A;  5AUL A;  2VIF A;  1CSZ A;  2LNX A;  1SPR A;  2LCT A;  2CRH A;  1F1W A;  4EY0 A;  3MXY A;  4ROJ A;  1O4G A;  4K11 A;  1AOT F;  1O48 A;  1GRI A;  3S9K A;  1BHH B;  4X6S A;  1O4E A;  4F5A A;  2MC1 A;  3S8N A;  2LQW A;  1BM2 A;  1FU6 A;  5I6V A;  4K44 A;  3IN8 A;  2ROR A;  3VGO A;  4OHH A;  2HDX A;  3WA4 A;  2EYZ A;  1LKL A;  2PNB A;  2HCK A;  1BG1 A;  4OHL A;  1G83 A;  1Y57 A;  1LUK A;  1O4A A;  2SHP A;  3VRQ A;  2EOB A;  1AYA A;  2EYV A;  1O45 A;  3CWG A;  2Y1M A;  3TKZ A;  1O4B A;  1LCK A;  3CXL A;  3HIZ B;  3C7I A;  3N7Y A;  4DGP A;  4GL9 E;  1O4C A;  2IZV A;  2FO0 A;  2DVJ A;  1NRV A;  2L3T A;  1NZL A;  2K7A B;  1H9O A;  2ETZ A;  1JYR A;  2PTK A;  3GXW A;  2MRK A;  1YVH A;  3VS4 A;  1ZFP E;  1OPK A;  1RJA A;  5EEL A;  1M27 A;  3VRN A;  1CWD L;  4XZ0 A;  3PJP A;  2RSY A;  3OVE A;  3VS0 A;  1BKL A;  4F5B A;  2CI9 A;  3VRR A;  1AD5 A;  1OO3 A;  1SHA A;  1O41 A;  2GSB A;  3UYO A;  5KAZ A;  3K2T A;  2CIA A;  1BMB A;  3LYV A;  1NZV A;  2DCR A;  3S8L A;  1O4R A;  2FCI A;  2CS0 A;  1KC2 A;  3HCK A;  1O4D A;  1JYU A;  3BUW B;  5CDW A;  3UF4 A;  4A4C A;  4NWF A;  3VRP A;  3BKB A;  2QMS A;  2RVF A;  2EO6 A;  5IBS A;  1CSY A;  2DM0 A;  3HHM B;  1UUS A;  1R1P A;  1AB2 A;  4H1O A;  4E68 A;  3EAZ A;  1KSW A;  4P9V A;  3PSJ A;  4JE4 A;  4F59 A;  1TZE E;  2KGY A;  2AOB A;  4FBN A;  3KFJ A;  1BLK A;  3VRY A;  3IMJ A;  3GXX A;  1O46 A;  1AYC A;  1X6C A;  3T04 A;  3MAZ A;  5J3X A;  2EKX A;  2LRA A;  1QCF A;  1AYB A;  3BUM B;  1RPY A;  2DLY A;  5EHP A;  2C0I A;  3OB2 B;  4D8K A;  1O4L A;  3S8O A;  1O4H A;  5BO4 A;  1HCT B;  3VS1 A;  1D1Z A;  2LNW A;  1SHB A;  3N84 A;  1WQU A;  1BFJ A;  1BHF A;  1AYD A;  1Y1U A;  2EYY A;  1QAD A;  1OPL A;  4FL2 A;  2XP1 A;  2Y1N A;  3ZNI A;  2HDV A;  1P13 A;  1O4O A;  1LKK A;  5IBM A; 
#chains in the Genus database with same CATH homology
 1A1A A;  3VRZ A;  4JEG A;  1BKM A;  4LUD A;  4U17 A;  5AXI A;  4QSY A;  1X27 A;  4DGX A;  1M61 A;  2RMX A;  2LQN A;  2CI8 A;  1KA7 A;  2C0O A;  4FL3 A;  1A07 A;  4U1P A;  1GHU A;  1R1S A;  2CBL A;  2L6K A;  2PLE A;  3QWX X;  2K79 B;  1O44 A;  2MK2 A;  2IUH A;  2PNA A;  1QG1 E;  1O4N A;  3BUN B;  1FHS A;  2BBU A;  1JYQ A;  1LUM A;  1XA6 A;  1K9A A;  1OO4 A;  2GE9 A;  3VS7 A;  2ECD A;  5HKY A;  1BHH A;  3QWY A;  1BFI A;  1A09 A;  2C0T A;  1O4Q A;  2YSX A;  4L1B B;  2MQI A;  3BUX B;  2HUW A;  4JGH A;  1D4T A;  1LCJ A;  1D4W A;  3PSK A;  1UUR A;  1CJ1 A;  5HKZ A;  3K2M A;  1JU5 A;  1O47 A;  3OB1 B;  1CWE A;  5HKW A;  5GJI A;  3NHN A;  2CR4 A;  1O42 A;  3MXC A;  3PQZ A;  2EU0 A;  3VS6 A;  1X0N A;  1FBZ A;  3BUO B;  4H34 A;  4OHI A;  5DF6 A;  4P9Z A;  3IN7 A;  2OZO A;  1O4P A;  4GPL B;  1O4K A;  1SHD A;  1B47 A;  2Y3A B;  1RQQ C;  5D0J A;  4TZI A;  5GJH A;  1MIL A;  1O49 A;  1JWO A;  2DX0 A;  2H46 E;  5EEQ A;  2L4K A;  1MW4 A;  2YU7 A;  4XZ1 A;  2AUG A;  3IMD A;  4E93 A;  1O4F A;  4EIH A;  3M7F A;  1BF5 A;  1FYR A;  1O4J A;  4K45 A;  1IJR A;  1F2F A;  3PS5 A;  1PIC A;  2PLD A;  1I3Z A;  1IS0 A;  2B3O A;  1A1B A;  1A1C A;  1Z3K A;  4NWG A;  1R1Q A;  3TL0 A;  2KNO A;  3GQI B;  4WWQ A;  2MRJ A;  2EO3 A;  2AOA A;  2OQ1 A;  5DC4 A;  1KA6 A;  2C9W A;  1SPS A;  4A4B A;  1A81 A;  4OHD A;  4OHE A;  2DLZ A;  2ABL A;  4GWF A;  3N8M A;  1O4I A;  5DC9 A;  3CBL A;  3OP0 A;  2KK6 A;  4LUE A;  1TCE A;  1O43 A;  2EL8 A;  2H5K A;  1SKJ A;  1BLJ A;  1FU5 A;  2JYQ A;  4K2R A;  3PFV A;  2IUG A;  1YVL A;  1FBV A;  1A1E A;  1HCS B;  1AOU F;  3VS2 A;  1FMK A;  3PLF B;  1LUN A;  2SRC A;  2H8H A;  3VRO A;  1O4M A;  3EAC A;  3VS5 A;  3VS3 A;  2IUI A;  3US4 A;  4M4Z A;  3CD3 A;  1A08 A;  5DC0 B;  5EG3 B;  5EHR A;  1LUI A;  2HMH A;  3OV1 A;  5AUL A;  2VIF A;  1CSZ A;  2LNX A;  1SPR A;  2LCT A;  2CRH A;  1F1W A;  4EY0 A;  3MXY A;  4ROJ A;  1O4G A;  4K11 A;  1AOT F;  1O48 A;  1GRI A;  3S9K A;  1BHH B;  4X6S A;  1O4E A;  4F5A A;  2MC1 A;  3S8N A;  2LQW A;  1BM2 A;  1FU6 A;  5I6V A;  4K44 A;  3IN8 A;  2ROR A;  3VGO A;  4OHH A;  2HDX A;  3WA4 A;  2EYZ A;  1LKL A;  2PNB A;  2HCK A;  1BG1 A;  4OHL A;  1G83 A;  1Y57 A;  1LUK A;  1O4A A;  2SHP A;  3VRQ A;  2EOB A;  1AYA A;  2EYV A;  1O45 A;  3CWG A;  2Y1M A;  3TKZ A;  1O4B A;  1LCK A;  3CXL A;  3HIZ B;  3C7I A;  3N7Y A;  4DGP A;  4GL9 E;  1O4C A;  2IZV A;  2FO0 A;  2DVJ A;  1NRV A;  2L3T A;  1NZL A;  2K7A B;  1H9O A;  2ETZ A;  1JYR A;  2PTK A;  3GXW A;  2MRK A;  1YVH A;  3VS4 A;  1ZFP E;  1OPK A;  1RJA A;  5EEL A;  1M27 A;  3VRN A;  1CWD L;  4XZ0 A;  3PJP A;  2RSY A;  3OVE A;  3VS0 A;  1BKL A;  4F5B A;  2CI9 A;  3VRR A;  1AD5 A;  1OO3 A;  1SHA A;  1O41 A;  2GSB A;  3UYO A;  5KAZ A;  2CIA A;  1BMB A;  1NZV A;  2DCR A;  3S8L A;  1O4R A;  2FCI A;  2CS0 A;  1KC2 A;  3HCK A;  1O4D A;  1JYU A;  3BUW B;  5CDW A;  3UF4 A;  4A4C A;  4NWF A;  3VRP A;  3BKB A;  2QMS A;  2RVF A;  2EO6 A;  5IBS A;  1CSY A;  2DM0 A;  3HHM B;  1UUS A;  1R1P A;  1AB2 A;  4H1O A;  4E68 A;  3EAZ A;  1KSW A;  4P9V A;  3PSJ A;  4JE4 A;  4F59 A;  1TZE E;  2AOB A;  4FBN A;  3KFJ A;  1BLK A;  3VRY A;  3IMJ A;  3GXX A;  1O46 A;  1AYC A;  1X6C A;  3T04 A;  3MAZ A;  5J3X A;  2EKX A;  1QCF A;  1AYB A;  3BUM B;  1RPY A;  2DLY A;  5EHP A;  2C0I A;  3OB2 B;  4D8K A;  1O4L A;  3S8O A;  1O4H A;  5BO4 A;  1HCT B;  3VS1 A;  1D1Z A;  2LNW A;  1SHB A;  3N84 A;  1WQU A;  1BFJ A;  1BHF A;  1AYD A;  1Y1U A;  2EYY A;  1QAD A;  1OPL A;  4FL2 A;  2XP1 A;  2Y1N A;  3ZNI A;  2HDV A;  1P13 A;  1O4O A;  1LKK A;  5IBM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...