2IUHA

Crystal structure of the pi3-kinase p85 n-terminal sh2 domain in complex with c-kit phosphotyrosyl peptide
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
115
structure length
115
Chain Sequence
b'NMSLQNAEWYWGDISREEVNEKLRDTADGTFLVRDASTKMHGDYTLTLRKGGNNKLIKIFHRDGKYGFSDPLTFSSVVELINHYRNESLAQYNPKLDVKLLYPVSKYQQDQVVKE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PHOSPHATIDYLINOSITOL 3-KINASE REGULATORY ALPHA SUBUNIT
publication title Crystal Structure of the Pi 3-Kinase P85 Amino-Terminal Sh2 Domain and its Phosphopeptide Complexes
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 32
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2006-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00017 SH2 SH2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.505.10 Alpha Beta 2-Layer Sandwich SHC Adaptor Protein SH2 domain 2iuhA00
1KSWA 1A1BA 2EL8A 2CS0A 2HDVA 2H8HA 4P9VA 3BUOB 4K44A 2C0IA 2CR4A 3MXYA 1WQUA 3VS2A 1A81A 1OPKA 3VS1A 2GE9A 1PICA 1SHAA 2GSBA 3IMJA 1M27A 1OPLA 1D1ZA 1SHBA 2IUGA 1JYUA 3BUWB 1O4FA 4D8KA 1A09A 2DLYA 3CBLA 2Y3AB 1HCTB 1O4LA 3OVEA 1RPYA 4H34A 2L3TA 5DF6A 5HKWA 4XZ1A 1SHDA 3N7YA 2EO3A 1BKLA 3BUXB 3KFJA 1G83A 4NWGA 2H46E 2YSXA 5J3XA 1BFIA 5EEQA 1FBVA 3VS7A 3CXLA 2DCRA 3VS5A 1I3ZA 4LUDA 2ETZA 3S8OA 1BMBA 1O4DA 2EO6A 1JYRA 3UF4A 4LUEA 3S8NA 4EY0A 3VS6A 3QWXX 2HDXA 2K79B 1O4BA 1FYRA 2L6KA 4OHHA 4DGPA 2RVFA 1Y57A 3VGOA 1CSZA 1A07A 2MRKA 1BF5A 2AUGA 3OV1A 1ZFPE 3PSKA 1A1CA 1Y1UA 2PTKA 4ROJA 1O4RA 1LKKA 1IJRA 2OZOA 5AXIA 1O43A 3UYOA 3M7FA 2LNWA 2QMSA 1O4EA 1LUIA 1RJAA 4P9ZA 1O4OA 1JYQA 3PQZA 3VRNA 1O4AA 5EG3B 2CRHA 3K2MA 4A4CA 4WWQA 3VRRA 3PJPA 2LQNA 1AB2A 2VIFA 4JE4A 4FL2A 4OHEA 3VRZA 1BKMA 2IUHA 1AYAA 1CSYA 3MXCA 1RQQC 4XZ0A 1BHHA 1GHUA 3VS0A 1XA6A 5EELA 2H5KA 1R1PA 1B47A 1LUMA 1H9OA 1QADA 2MC1A 1BG1A 1MW4A 1O48A 5DC9A 1O46A 1FMKA 1SPRA 3TKZA 2PNBA 4FBNA 1BLKA 5AULA 2CBLA 2DM0A 1IS0A 4QSYA 3EACA 1Z3KA 3N8MA 3VS4A 3S8LA 1CWEA 5GJIA 3VRPA 2C9WA 4F5AA 1D4TA 1YVHA 2KNOA 4DGXA 5CDWA 2EOBA 3GXXA 4GWFA 3PLFB 4JGHA 2DX0A 2C0TA 1UURA 2EYVA 1JWOA 3CWGA 3HIZB 1NRVA 2HMHA 1BHFA 1BHHB 2LCTA 1FU6A 2LQWA 1O4PA 2CI9A 2IUIA 1O44A 2MRJA 4L1BB 2AOAA 5HKZA 3OB1B 4A4BA 1X6CA 3IN7A 1A1EA 4H1OA 2PLEA 4U17A 1MILA 1GRIA 1FHSA 1BM2A 4FL3A 1BFJA 1QG1E 4OHLA 2Y1NA 1D4WA 3S9KA 3NHNA 3VROA 1QCFA 4F59A 3N84A 1UUSA 1LUKA 1M61A 1O42A 2FO0A 4U1PA 2MK2A 1YVLA 1AYBA 1O4NA 5BO4A 4TZIA 2DVJA 5DC0B 3OP0A 5KAZA 3PSJA 5GJHA 1O41A 1LUNA 2JYQA 1F1WA 3BUNB 1X27A 1AOTF 3HCKA 2EU0A 1F2FA 2KK6A 5EHPA 3OB2B 3BKBA 3IMDA 2FCIA 1AOUF 1O4KA 1KA7A 2HCKA 3TL0A 2ECDA 1AD5A 5EHRA 2PLDA 3MAZA 4E68A 1TCEA 2C0OA 3CD3A 3EAZA 5D0JA 1HCSB 1LCJA 4K45A 3IN8A 3VS3A 3VRQA 3ZNIA 2B3OA 2SRCA 2BBUA 3GQIB 4M4ZA 4F5BA 1O45A 2MQIA 2Y1MA 2DLZA 1JU5A 4GPLB 2SHPA 3HHMB 1TZEE 4GL9E 3US4A 4E93A 3PS5A 2RSYA 2L4KA 1FU5A 4K11A 1O4GA 3VRYA 1CJ1A 1FBZA 2K7AB 2EYYA 1AYCA 1NZVA 1O4QA 2YU7A 3WA4A 3T04A 2CIAA 1A1AA 1O4CA 3C7IA 1OO3A 2XP1A 1AYDA 5DC4A 3PFVA 2LNXA 2HUWA 5HKYA 2OQ1A 1KC2A 2EKXA 4OHIA 1O47A 1BLJA 2RMXA 2AOBA 1O49A 4X6SA 5IBMA 1O4JA 3QWYA 1OO4A 2IZVA 2EYZA 1R1QA 1LKLA 4K2RA 1P13A 1O4MA 1O4IA 3BUMB 4OHDA 1LCKA 2RORA 1NZLA 3GXWA 1R1SA 1A08A 1KA6A 1K9AA 2CI8A 1CWDL 1O4HA 2ABLA 2PNAA 4NWFA 1SPSA 4JEGA 1SKJA 4EIHA 5I6VA 1X0NA 5IBSA
chains in the Genus database with same CATH superfamily
1KSWA 1A1BA 2EL8A 2CS0A 2HDVA 2H8HA 4P9VA 3BUOB 4K44A 2C0IA 2CR4A 3MXYA 1WQUA 3VS2A 1A81A 1OPKA 3VS1A 2GE9A 1PICA 1SHAA 2GSBA 3IMJA 1M27A 1OPLA 1D1ZA 1SHBA 2IUGA 1JYUA 3BUWB 1O4FA 4D8KA 1A09A 2DLYA 3CBLA 2Y3AB 1HCTB 1O4LA 3OVEA 1RPYA 4H34A 2L3TA 5DF6A 5HKWA 4XZ1A 1SHDA 3N7YA 2EO3A 1BKLA 3BUXB 3KFJA 1G83A 4NWGA 2H46E 2YSXA 5J3XA 1BFIA 5EEQA 1FBVA 3VS7A 3CXLA 2DCRA 3VS5A 1I3ZA 4LUDA 3LYVA 2ETZA 3S8OA 1BMBA 1O4DA 2EO6A 1JYRA 3UF4A 4LUEA 3S8NA 4EY0A 3VS6A 3QWXX 2HDXA 2K79B 1O4BA 1FYRA 2L6KA 4OHHA 4DGPA 2RVFA 1Y57A 3VGOA 1CSZA 1A07A 2MRKA 1BF5A 2AUGA 3OV1A 1ZFPE 3PSKA 1A1CA 1Y1UA 2PTKA 4ROJA 1O4RA 1LKKA 1IJRA 2OZOA 5AXIA 1O43A 3UYOA 3M7FA 2LNWA 2QMSA 1O4EA 1LUIA 1RJAA 4P9ZA 1O4OA 1JYQA 3K2TA 3PQZA 3VRNA 1O4AA 5EG3B 2CRHA 3K2MA 4A4CA 4WWQA 3VRRA 3PJPA 2LQNA 1AB2A 2VIFA 4JE4A 4FL2A 4OHEA 3VRZA 1BKMA 2IUHA 1AYAA 1CSYA 3MXCA 1RQQC 4XZ0A 1BHHA 1GHUA 3VS0A 1XA6A 5EELA 2H5KA 1R1PA 1B47A 1LUMA 1H9OA 1QADA 2MC1A 1BG1A 1MW4A 1O48A 5DC9A 1O46A 1FMKA 1SPRA 3TKZA 2PNBA 4FBNA 1BLKA 5AULA 2CBLA 2DM0A 1IS0A 4QSYA 3EACA 1Z3KA 3N8MA 3VS4A 3S8LA 1CWEA 5GJIA 3VRPA 2C9WA 4F5AA 1D4TA 1YVHA 2KNOA 4DGXA 5CDWA 2EOBA 3GXXA 4GWFA 3PLFB 4JGHA 2DX0A 2C0TA 1UURA 2EYVA 1JWOA 3CWGA 3HIZB 1NRVA 2HMHA 1BHFA 1BHHB 2LCTA 1FU6A 2LQWA 1O4PA 2CI9A 2IUIA 1O44A 2MRJA 4L1BB 2AOAA 5HKZA 3OB1B 4A4BA 1X6CA 3IN7A 1A1EA 4H1OA 2PLEA 4U17A 1MILA 1GRIA 1FHSA 1BM2A 4FL3A 1BFJA 1QG1E 4OHLA 2Y1NA 1D4WA 3S9KA 3NHNA 3VROA 1QCFA 4F59A 3N84A 1UUSA 1LUKA 1M61A 1O42A 2FO0A 4U1PA 2MK2A 1YVLA 1AYBA 1O4NA 5BO4A 4TZIA 2DVJA 5DC0B 3OP0A 5KAZA 3PSJA 5GJHA 1O41A 1LUNA 2JYQA 1F1WA 3BUNB 1X27A 1AOTF 3HCKA 2EU0A 1F2FA 2KK6A 5EHPA 3OB2B 3BKBA 3IMDA 2FCIA 1AOUF 1O4KA 1KA7A 2HCKA 3TL0A 2ECDA 1AD5A 5EHRA 2PLDA 3MAZA 4E68A 1TCEA 2C0OA 3CD3A 3EAZA 5D0JA 1HCSB 1LCJA 4K45A 2KGYA 3IN8A 3VS3A 3VRQA 3ZNIA 2B3OA 2SRCA 2BBUA 3GQIB 4M4ZA 4F5BA 1O45A 2MQIA 2Y1MA 2DLZA 1JU5A 4GPLB 2SHPA 3HHMB 1TZEE 4GL9E 3US4A 4E93A 3PS5A 2RSYA 2L4KA 1FU5A 4K11A 1O4GA 3VRYA 1CJ1A 1FBZA 2K7AB 2EYYA 1AYCA 1NZVA 1O4QA 2LRAA 2YU7A 3WA4A 3T04A 2CIAA 1A1AA 1O4CA 3C7IA 1OO3A 2XP1A 1AYDA 5DC4A 3PFVA 2LNXA 2HUWA 5HKYA 2OQ1A 1KC2A 2EKXA 4OHIA 1O47A 1BLJA 2RMXA 2AOBA 1O49A 4X6SA 5IBMA 1O4JA 3QWYA 1OO4A 2IZVA 2EYZA 1R1QA 1LKLA 4K2RA 1P13A 1O4MA 1O4IA 3BUMB 4OHDA 1LCKA 2RORA 1NZLA 3GXWA 1R1SA 1A08A 1KA6A 1K9AA 2CI8A 1CWDL 1O4HA 2ABLA 2PNAA 4NWFA 1SPSA 4JEGA 1SKJA 4EIHA 5I6VA 1X0NA 5IBSA
chains in the Genus database with same CATH topology
1KSWA 1A1BA 2EL8A 2CS0A 2HDVA 2H8HA 4P9VA 3BUOB 4K44A 2C0IA 2CR4A 3MXYA 1WQUA 3VS2A 1A81A 1OPKA 3VS1A 2GE9A 1PICA 1SHAA 2GSBA 3IMJA 1M27A 1OPLA 1D1ZA 1SHBA 2IUGA 1JYUA 3BUWB 1O4FA 4D8KA 1A09A 2DLYA 3CBLA 2Y3AB 1HCTB 1O4LA 3OVEA 1RPYA 4H34A 2L3TA 5DF6A 5HKWA 4XZ1A 1SHDA 3N7YA 2EO3A 1BKLA 3BUXB 3KFJA 1G83A 4NWGA 2H46E 2YSXA 5J3XA 1BFIA 5EEQA 1FBVA 3VS7A 3CXLA 2DCRA 3VS5A 1I3ZA 4LUDA 2ETZA 3S8OA 1BMBA 1O4DA 2EO6A 1JYRA 3UF4A 4LUEA 3S8NA 4EY0A 3VS6A 3QWXX 2HDXA 2K79B 1O4BA 1FYRA 2L6KA 4OHHA 4DGPA 2RVFA 1Y57A 3VGOA 1CSZA 1A07A 2MRKA 1BF5A 2AUGA 3OV1A 1ZFPE 3PSKA 1A1CA 1Y1UA 2PTKA 4ROJA 1O4RA 1LKKA 1IJRA 2OZOA 5AXIA 1O43A 3UYOA 3M7FA 2LNWA 2QMSA 1O4EA 1LUIA 1RJAA 4P9ZA 1O4OA 1JYQA 3PQZA 3VRNA 1O4AA 5EG3B 2CRHA 3K2MA 4A4CA 4WWQA 3VRRA 3PJPA 2LQNA 1AB2A 2VIFA 4JE4A 4FL2A 4OHEA 3VRZA 1BKMA 2IUHA 1AYAA 1CSYA 3MXCA 1RQQC 4XZ0A 1BHHA 1GHUA 3VS0A 1XA6A 5EELA 2H5KA 1R1PA 1B47A 1LUMA 1H9OA 1QADA 2MC1A 1BG1A 1MW4A 1O48A 5DC9A 1O46A 1FMKA 1SPRA 3TKZA 2PNBA 4FBNA 1BLKA 5AULA 2CBLA 2DM0A 1IS0A 4QSYA 3EACA 1Z3KA 3N8MA 3VS4A 3S8LA 1CWEA 5GJIA 3VRPA 2C9WA 4F5AA 1D4TA 1YVHA 2KNOA 4DGXA 5CDWA 2EOBA 3GXXA 4GWFA 3PLFB 4JGHA 2DX0A 2C0TA 1UURA 2EYVA 1JWOA 3CWGA 3HIZB 1NRVA 2HMHA 1BHFA 1BHHB 2LCTA 1FU6A 2LQWA 1O4PA 2CI9A 2IUIA 1O44A 2MRJA 4L1BB 2AOAA 5HKZA 3OB1B 4A4BA 1X6CA 3IN7A 1A1EA 4H1OA 2PLEA 4U17A 1MILA 1GRIA 1FHSA 1BM2A 4FL3A 1BFJA 1QG1E 4OHLA 2Y1NA 1D4WA 3S9KA 3NHNA 3VROA 1QCFA 4F59A 3N84A 1UUSA 1LUKA 1M61A 1O42A 2FO0A 4U1PA 2MK2A 1YVLA 1AYBA 1O4NA 5BO4A 4TZIA 2DVJA 5DC0B 3OP0A 5KAZA 3PSJA 5GJHA 1O41A 1LUNA 2JYQA 1F1WA 3BUNB 1X27A 1AOTF 3HCKA 2EU0A 1F2FA 2KK6A 5EHPA 3OB2B 3BKBA 3IMDA 2FCIA 1AOUF 1O4KA 1KA7A 2HCKA 3TL0A 2ECDA 1AD5A 5EHRA 2PLDA 3MAZA 4E68A 1TCEA 2C0OA 3CD3A 3EAZA 5D0JA 1HCSB 1LCJA 4K45A 3IN8A 3VS3A 3VRQA 3ZNIA 2B3OA 2SRCA 2BBUA 3GQIB 4M4ZA 4F5BA 1O45A 2MQIA 2Y1MA 2DLZA 1JU5A 4GPLB 2SHPA 3HHMB 1TZEE 4GL9E 3US4A 4E93A 3PS5A 2RSYA 2L4KA 1FU5A 4K11A 1O4GA 3VRYA 1CJ1A 1FBZA 2K7AB 2EYYA 1AYCA 1NZVA 1O4QA 2YU7A 3WA4A 3T04A 2CIAA 1A1AA 1O4CA 3C7IA 1OO3A 2XP1A 1AYDA 5DC4A 3PFVA 2LNXA 2HUWA 5HKYA 2OQ1A 1KC2A 2EKXA 4OHIA 1O47A 1BLJA 2RMXA 2AOBA 1O49A 4X6SA 5IBMA 1O4JA 3QWYA 1OO4A 2IZVA 2EYZA 1R1QA 1LKLA 4K2RA 1P13A 1O4MA 1O4IA 3BUMB 4OHDA 1LCKA 2RORA 1NZLA 3GXWA 1R1SA 1A08A 1KA6A 1K9AA 2CI8A 1CWDL 1O4HA 2ABLA 2PNAA 4NWFA 1SPSA 4JEGA 1SKJA 4EIHA 5I6VA 1X0NA 5IBSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KSW A;  1A1B A;  2EL8 A;  2CS0 A;  2HDV A;  2H8H A;  4P9V A;  3BUO B;  4K44 A;  2C0I A;  2CR4 A;  3MXY A;  1WQU A;  3VS2 A;  1A81 A;  1OPK A;  3VS1 A;  2GE9 A;  1PIC A;  1SHA A;  2GSB A;  3IMJ A;  1M27 A;  1OPL A;  1D1Z A;  1SHB A;  2IUG A;  1JYU A;  3BUW B;  1O4F A;  4D8K A;  1A09 A;  2DLY A;  3CBL A;  2Y3A B;  1HCT B;  1O4L A;  3OVE A;  1RPY A;  4H34 A;  2L3T A;  5DF6 A;  5HKW A;  4XZ1 A;  1SHD A;  3N7Y A;  2EO3 A;  1BKL A;  3BUX B;  3KFJ A;  1G83 A;  4NWG A;  2H46 E;  2YSX A;  5J3X A;  1BFI A;  5EEQ A;  1FBV A;  3VS7 A;  3CXL A;  2DCR A;  3VS5 A;  1I3Z A;  4LUD A;  2ETZ A;  3S8O A;  1BMB A;  1O4D A;  2EO6 A;  1JYR A;  3UF4 A;  4LUE A;  3S8N A;  4EY0 A;  3VS6 A;  3QWX X;  2HDX A;  2K79 B;  1O4B A;  1FYR A;  2L6K A;  4OHH A;  4DGP A;  2RVF A;  1Y57 A;  3VGO A;  1CSZ A;  1A07 A;  2MRK A;  1BF5 A;  2AUG A;  3OV1 A;  1ZFP E;  3PSK A;  1A1C A;  1Y1U A;  2PTK A;  4ROJ A;  1O4R A;  1LKK A;  1IJR A;  2OZO A;  5AXI A;  1O43 A;  3UYO A;  3M7F A;  2LNW A;  2QMS A;  1O4E A;  1LUI A;  1RJA A;  4P9Z A;  1O4O A;  1JYQ A;  3PQZ A;  3VRN A;  1O4A A;  5EG3 B;  2CRH A;  3K2M A;  4A4C A;  4WWQ A;  3VRR A;  3PJP A;  2LQN A;  1AB2 A;  2VIF A;  4JE4 A;  4FL2 A;  4OHE A;  3VRZ A;  1BKM A;  2IUH A;  1AYA A;  1CSY A;  3MXC A;  1RQQ C;  4XZ0 A;  1BHH A;  1GHU A;  3VS0 A;  1XA6 A;  5EEL A;  2H5K A;  1R1P A;  1B47 A;  1LUM A;  1H9O A;  1QAD A;  2MC1 A;  1BG1 A;  1MW4 A;  1O48 A;  5DC9 A;  1O46 A;  1FMK A;  1SPR A;  3TKZ A;  2PNB A;  4FBN A;  1BLK A;  5AUL A;  2CBL A;  2DM0 A;  1IS0 A;  4QSY A;  3EAC A;  1Z3K A;  3N8M A;  3VS4 A;  3S8L A;  1CWE A;  5GJI A;  3VRP A;  2C9W A;  4F5A A;  1D4T A;  1YVH A;  2KNO A;  4DGX A;  5CDW A;  2EOB A;  3GXX A;  4GWF A;  3PLF B;  4JGH A;  2DX0 A;  2C0T A;  1UUR A;  2EYV A;  1JWO A;  3CWG A;  3HIZ B;  1NRV A;  2HMH A;  1BHF A;  1BHH B;  2LCT A;  1FU6 A;  2LQW A;  1O4P A;  2CI9 A;  2IUI A;  1O44 A;  2MRJ A;  4L1B B;  2AOA A;  5HKZ A;  3OB1 B;  4A4B A;  1X6C A;  3IN7 A;  1A1E A;  4H1O A;  2PLE A;  4U17 A;  1MIL A;  1GRI A;  1FHS A;  1BM2 A;  4FL3 A;  1BFJ A;  1QG1 E;  4OHL A;  2Y1N A;  1D4W A;  3S9K A;  3NHN A;  3VRO A;  1QCF A;  4F59 A;  3N84 A;  1UUS A;  1LUK A;  1M61 A;  1O42 A;  2FO0 A;  4U1P A;  2MK2 A;  1YVL A;  1AYB A;  1O4N A;  5BO4 A;  4TZI A;  2DVJ A;  5DC0 B;  3OP0 A;  5KAZ A;  3PSJ A;  5GJH A;  1O41 A;  1LUN A;  2JYQ A;  1F1W A;  3BUN B;  1X27 A;  1AOT F;  3HCK A;  2EU0 A;  1F2F A;  2KK6 A;  5EHP A;  3OB2 B;  3BKB A;  3IMD A;  2FCI A;  1AOU F;  1O4K A;  1KA7 A;  2HCK A;  3TL0 A;  2ECD A;  1AD5 A;  5EHR A;  2PLD A;  3MAZ A;  4E68 A;  1TCE A;  2C0O A;  3CD3 A;  3EAZ A;  5D0J A;  1HCS B;  1LCJ A;  4K45 A;  3IN8 A;  3VS3 A;  3VRQ A;  3ZNI A;  2B3O A;  2SRC A;  2BBU A;  3GQI B;  4M4Z A;  4F5B A;  1O45 A;  2MQI A;  2Y1M A;  2DLZ A;  1JU5 A;  4GPL B;  2SHP A;  3HHM B;  1TZE E;  4GL9 E;  3US4 A;  4E93 A;  3PS5 A;  2RSY A;  2L4K A;  1FU5 A;  4K11 A;  1O4G A;  3VRY A;  1CJ1 A;  1FBZ A;  2K7A B;  2EYY A;  1AYC A;  1NZV A;  1O4Q A;  2YU7 A;  3WA4 A;  3T04 A;  2CIA A;  1A1A A;  1O4C A;  3C7I A;  1OO3 A;  2XP1 A;  1AYD A;  5DC4 A;  3PFV A;  2LNX A;  2HUW A;  5HKY A;  2OQ1 A;  1KC2 A;  2EKX A;  4OHI A;  1O47 A;  1BLJ A;  2RMX A;  2AOB A;  1O49 A;  4X6S A;  5IBM A;  1O4J A;  3QWY A;  1OO4 A;  2IZV A;  2EYZ A;  1R1Q A;  1LKL A;  4K2R A;  1P13 A;  1O4M A;  1O4I A;  3BUM B;  4OHD A;  1LCK A;  2ROR A;  1NZL A;  3GXW A;  1R1S A;  1A08 A;  1KA6 A;  1K9A A;  2CI8 A;  1CWD L;  1O4H A;  2ABL A;  2PNA A;  4NWF A;  1SPS A;  4JEG A;  1SKJ A;  4EIH A;  5I6V A;  1X0N A;  5IBS A; 
#chains in the Genus database with same CATH topology
 1KSW A;  1A1B A;  2EL8 A;  2CS0 A;  2HDV A;  2H8H A;  4P9V A;  3BUO B;  4K44 A;  2C0I A;  2CR4 A;  3MXY A;  1WQU A;  3VS2 A;  1A81 A;  1OPK A;  3VS1 A;  2GE9 A;  1PIC A;  1SHA A;  2GSB A;  3IMJ A;  1M27 A;  1OPL A;  1D1Z A;  1SHB A;  2IUG A;  1JYU A;  3BUW B;  1O4F A;  4D8K A;  1A09 A;  2DLY A;  3CBL A;  2Y3A B;  1HCT B;  1O4L A;  3OVE A;  1RPY A;  4H34 A;  2L3T A;  5DF6 A;  5HKW A;  4XZ1 A;  1SHD A;  3N7Y A;  2EO3 A;  1BKL A;  3BUX B;  3KFJ A;  1G83 A;  4NWG A;  2H46 E;  2YSX A;  5J3X A;  1BFI A;  5EEQ A;  1FBV A;  3VS7 A;  3CXL A;  2DCR A;  3VS5 A;  1I3Z A;  4LUD A;  3LYV A;  2ETZ A;  3S8O A;  1BMB A;  1O4D A;  2EO6 A;  1JYR A;  3UF4 A;  4LUE A;  3S8N A;  4EY0 A;  3VS6 A;  3QWX X;  2HDX A;  2K79 B;  1O4B A;  1FYR A;  2L6K A;  4OHH A;  4DGP A;  2RVF A;  1Y57 A;  3VGO A;  1CSZ A;  1A07 A;  2MRK A;  1BF5 A;  2AUG A;  3OV1 A;  1ZFP E;  3PSK A;  1A1C A;  1Y1U A;  2PTK A;  4ROJ A;  1O4R A;  1LKK A;  1IJR A;  2OZO A;  5AXI A;  1O43 A;  3UYO A;  3M7F A;  2LNW A;  2QMS A;  1O4E A;  1LUI A;  1RJA A;  4P9Z A;  1O4O A;  1JYQ A;  3K2T A;  3PQZ A;  3VRN A;  1O4A A;  5EG3 B;  2CRH A;  3K2M A;  4A4C A;  4WWQ A;  3VRR A;  3PJP A;  2LQN A;  1AB2 A;  2VIF A;  4JE4 A;  4FL2 A;  4OHE A;  3VRZ A;  1BKM A;  2IUH A;  1AYA A;  1CSY A;  3MXC A;  1RQQ C;  4XZ0 A;  1BHH A;  1GHU A;  3VS0 A;  1XA6 A;  5EEL A;  2H5K A;  1R1P A;  1B47 A;  1LUM A;  1H9O A;  1QAD A;  2MC1 A;  1BG1 A;  1MW4 A;  1O48 A;  5DC9 A;  1O46 A;  1FMK A;  1SPR A;  3TKZ A;  2PNB A;  4FBN A;  1BLK A;  5AUL A;  2CBL A;  2DM0 A;  1IS0 A;  4QSY A;  3EAC A;  1Z3K A;  3N8M A;  3VS4 A;  3S8L A;  1CWE A;  5GJI A;  3VRP A;  2C9W A;  4F5A A;  1D4T A;  1YVH A;  2KNO A;  4DGX A;  5CDW A;  2EOB A;  3GXX A;  4GWF A;  3PLF B;  4JGH A;  2DX0 A;  2C0T A;  1UUR A;  2EYV A;  1JWO A;  3CWG A;  3HIZ B;  1NRV A;  2HMH A;  1BHF A;  1BHH B;  2LCT A;  1FU6 A;  2LQW A;  1O4P A;  2CI9 A;  2IUI A;  1O44 A;  2MRJ A;  4L1B B;  2AOA A;  5HKZ A;  3OB1 B;  4A4B A;  1X6C A;  3IN7 A;  1A1E A;  4H1O A;  2PLE A;  4U17 A;  1MIL A;  1GRI A;  1FHS A;  1BM2 A;  4FL3 A;  1BFJ A;  1QG1 E;  4OHL A;  2Y1N A;  1D4W A;  3S9K A;  3NHN A;  3VRO A;  1QCF A;  4F59 A;  3N84 A;  1UUS A;  1LUK A;  1M61 A;  1O42 A;  2FO0 A;  4U1P A;  2MK2 A;  1YVL A;  1AYB A;  1O4N A;  5BO4 A;  4TZI A;  2DVJ A;  5DC0 B;  3OP0 A;  5KAZ A;  3PSJ A;  5GJH A;  1O41 A;  1LUN A;  2JYQ A;  1F1W A;  3BUN B;  1X27 A;  1AOT F;  3HCK A;  2EU0 A;  1F2F A;  2KK6 A;  5EHP A;  3OB2 B;  3BKB A;  3IMD A;  2FCI A;  1AOU F;  1O4K A;  1KA7 A;  2HCK A;  3TL0 A;  2ECD A;  1AD5 A;  5EHR A;  2PLD A;  3MAZ A;  4E68 A;  1TCE A;  2C0O A;  3CD3 A;  3EAZ A;  5D0J A;  1HCS B;  1LCJ A;  4K45 A;  2KGY A;  3IN8 A;  3VS3 A;  3VRQ A;  3ZNI A;  2B3O A;  2SRC A;  2BBU A;  3GQI B;  4M4Z A;  4F5B A;  1O45 A;  2MQI A;  2Y1M A;  2DLZ A;  1JU5 A;  4GPL B;  2SHP A;  3HHM B;  1TZE E;  4GL9 E;  3US4 A;  4E93 A;  3PS5 A;  2RSY A;  2L4K A;  1FU5 A;  4K11 A;  1O4G A;  3VRY A;  1CJ1 A;  1FBZ A;  2K7A B;  2EYY A;  1AYC A;  1NZV A;  1O4Q A;  2LRA A;  2YU7 A;  3WA4 A;  3T04 A;  2CIA A;  1A1A A;  1O4C A;  3C7I A;  1OO3 A;  2XP1 A;  1AYD A;  5DC4 A;  3PFV A;  2LNX A;  2HUW A;  5HKY A;  2OQ1 A;  1KC2 A;  2EKX A;  4OHI A;  1O47 A;  1BLJ A;  2RMX A;  2AOB A;  1O49 A;  4X6S A;  5IBM A;  1O4J A;  3QWY A;  1OO4 A;  2IZV A;  2EYZ A;  1R1Q A;  1LKL A;  4K2R A;  1P13 A;  1O4M A;  1O4I A;  3BUM B;  4OHD A;  1LCK A;  2ROR A;  1NZL A;  3GXW A;  1R1S A;  1A08 A;  1KA6 A;  1K9A A;  2CI8 A;  1CWD L;  1O4H A;  2ABL A;  2PNA A;  4NWF A;  1SPS A;  4JEG A;  1SKJ A;  4EIH A;  5I6V A;  1X0N A;  5IBS A; 
#chains in the Genus database with same CATH homology
 1KSW A;  1A1B A;  2EL8 A;  2CS0 A;  2HDV A;  2H8H A;  4P9V A;  3BUO B;  4K44 A;  2C0I A;  2CR4 A;  3MXY A;  1WQU A;  3VS2 A;  1A81 A;  1OPK A;  3VS1 A;  2GE9 A;  1PIC A;  1SHA A;  2GSB A;  3IMJ A;  1M27 A;  1OPL A;  1D1Z A;  1SHB A;  2IUG A;  1JYU A;  3BUW B;  1O4F A;  4D8K A;  1A09 A;  2DLY A;  3CBL A;  2Y3A B;  1HCT B;  1O4L A;  3OVE A;  1RPY A;  4H34 A;  2L3T A;  5DF6 A;  5HKW A;  4XZ1 A;  1SHD A;  3N7Y A;  2EO3 A;  1BKL A;  3BUX B;  3KFJ A;  1G83 A;  4NWG A;  2H46 E;  2YSX A;  5J3X A;  1BFI A;  5EEQ A;  1FBV A;  3VS7 A;  3CXL A;  2DCR A;  3VS5 A;  1I3Z A;  4LUD A;  2ETZ A;  3S8O A;  1BMB A;  1O4D A;  2EO6 A;  1JYR A;  3UF4 A;  4LUE A;  3S8N A;  4EY0 A;  3VS6 A;  3QWX X;  2HDX A;  2K79 B;  1O4B A;  1FYR A;  2L6K A;  4OHH A;  4DGP A;  2RVF A;  1Y57 A;  3VGO A;  1CSZ A;  1A07 A;  2MRK A;  1BF5 A;  2AUG A;  3OV1 A;  1ZFP E;  3PSK A;  1A1C A;  1Y1U A;  2PTK A;  4ROJ A;  1O4R A;  1LKK A;  1IJR A;  2OZO A;  5AXI A;  1O43 A;  3UYO A;  3M7F A;  2LNW A;  2QMS A;  1O4E A;  1LUI A;  1RJA A;  4P9Z A;  1O4O A;  1JYQ A;  3PQZ A;  3VRN A;  1O4A A;  5EG3 B;  2CRH A;  3K2M A;  4A4C A;  4WWQ A;  3VRR A;  3PJP A;  2LQN A;  1AB2 A;  2VIF A;  4JE4 A;  4FL2 A;  4OHE A;  3VRZ A;  1BKM A;  2IUH A;  1AYA A;  1CSY A;  3MXC A;  1RQQ C;  4XZ0 A;  1BHH A;  1GHU A;  3VS0 A;  1XA6 A;  5EEL A;  2H5K A;  1R1P A;  1B47 A;  1LUM A;  1H9O A;  1QAD A;  2MC1 A;  1BG1 A;  1MW4 A;  1O48 A;  5DC9 A;  1O46 A;  1FMK A;  1SPR A;  3TKZ A;  2PNB A;  4FBN A;  1BLK A;  5AUL A;  2CBL A;  2DM0 A;  1IS0 A;  4QSY A;  3EAC A;  1Z3K A;  3N8M A;  3VS4 A;  3S8L A;  1CWE A;  5GJI A;  3VRP A;  2C9W A;  4F5A A;  1D4T A;  1YVH A;  2KNO A;  4DGX A;  5CDW A;  2EOB A;  3GXX A;  4GWF A;  3PLF B;  4JGH A;  2DX0 A;  2C0T A;  1UUR A;  2EYV A;  1JWO A;  3CWG A;  3HIZ B;  1NRV A;  2HMH A;  1BHF A;  1BHH B;  2LCT A;  1FU6 A;  2LQW A;  1O4P A;  2CI9 A;  2IUI A;  1O44 A;  2MRJ A;  4L1B B;  2AOA A;  5HKZ A;  3OB1 B;  4A4B A;  1X6C A;  3IN7 A;  1A1E A;  4H1O A;  2PLE A;  4U17 A;  1MIL A;  1GRI A;  1FHS A;  1BM2 A;  4FL3 A;  1BFJ A;  1QG1 E;  4OHL A;  2Y1N A;  1D4W A;  3S9K A;  3NHN A;  3VRO A;  1QCF A;  4F59 A;  3N84 A;  1UUS A;  1LUK A;  1M61 A;  1O42 A;  2FO0 A;  4U1P A;  2MK2 A;  1YVL A;  1AYB A;  1O4N A;  5BO4 A;  4TZI A;  2DVJ A;  5DC0 B;  3OP0 A;  5KAZ A;  3PSJ A;  5GJH A;  1O41 A;  1LUN A;  2JYQ A;  1F1W A;  3BUN B;  1X27 A;  1AOT F;  3HCK A;  2EU0 A;  1F2F A;  2KK6 A;  5EHP A;  3OB2 B;  3BKB A;  3IMD A;  2FCI A;  1AOU F;  1O4K A;  1KA7 A;  2HCK A;  3TL0 A;  2ECD A;  1AD5 A;  5EHR A;  2PLD A;  3MAZ A;  4E68 A;  1TCE A;  2C0O A;  3CD3 A;  3EAZ A;  5D0J A;  1HCS B;  1LCJ A;  4K45 A;  3IN8 A;  3VS3 A;  3VRQ A;  3ZNI A;  2B3O A;  2SRC A;  2BBU A;  3GQI B;  4M4Z A;  4F5B A;  1O45 A;  2MQI A;  2Y1M A;  2DLZ A;  1JU5 A;  4GPL B;  2SHP A;  3HHM B;  1TZE E;  4GL9 E;  3US4 A;  4E93 A;  3PS5 A;  2RSY A;  2L4K A;  1FU5 A;  4K11 A;  1O4G A;  3VRY A;  1CJ1 A;  1FBZ A;  2K7A B;  2EYY A;  1AYC A;  1NZV A;  1O4Q A;  2YU7 A;  3WA4 A;  3T04 A;  2CIA A;  1A1A A;  1O4C A;  3C7I A;  1OO3 A;  2XP1 A;  1AYD A;  5DC4 A;  3PFV A;  2LNX A;  2HUW A;  5HKY A;  2OQ1 A;  1KC2 A;  2EKX A;  4OHI A;  1O47 A;  1BLJ A;  2RMX A;  2AOB A;  1O49 A;  4X6S A;  5IBM A;  1O4J A;  3QWY A;  1OO4 A;  2IZV A;  2EYZ A;  1R1Q A;  1LKL A;  4K2R A;  1P13 A;  1O4M A;  1O4I A;  3BUM B;  4OHD A;  1LCK A;  2ROR A;  1NZL A;  3GXW A;  1R1S A;  1A08 A;  1KA6 A;  1K9A A;  2CI8 A;  1CWD L;  1O4H A;  2ABL A;  2PNA A;  4NWF A;  1SPS A;  4JEG A;  1SKJ A;  4EIH A;  5I6V A;  1X0N A;  5IBS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...