1LUMA

Nmr structure of the itk sh2 domain, pro287trans, 20 low energy structures
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
108
structure length
108
Chain Sequence
b'NNLETYEWYNKSISRDKAEKLLLDTGKEGAFMVRDSRTPGTYTVSVFTKAIISENPCIKHYHIKETNDSPKRYYVAEKYVFDSIPLLIQYHQYNGGGLVTRLRYPVCG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tyrosine-protein kinase ITK/TSK
publication title Structural characterization of a proline-driven conformational switch within the Itk SH2 domain
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase
total genus 14
structure length 108
sequence length 108
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2002-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00017 SH2 SH2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.505.10 Alpha Beta 2-Layer Sandwich SHC Adaptor Protein SH2 domain 1lumA00
5IBSA 3VRZA 1FBVA 4LUDA 2Y1MA 1A08A 3VROA 4DGPA 2LQNA 2PNAA 2GE9A 3EACA 1O42A 1WQUA 2AUGA 2RORA 2C0TA 2CBLA 2MC1A 1AOTF 2MK2A 2LNWA 4U17A 3VS0A 1JYRA 3BKBA 1PICA 2EL8A 1BLJA 1IJRA 4ROJA 1LUIA 3US4A 1O41A 3IN8A 2EYYA 3QWYA 1TCEA 3PSJA 3GXXA 2SHPA 1QCFA 3PLFB 3VS6A 1Y57A 1QG1E 3VS3A 2AOAA 3MXYA 1X0NA 1O4KA 3IMJA 5EHPA 2LQWA 5HKZA 2DCRA 2IUIA 3S9KA 1O45A 5GJHA 2OQ1A 4GWFA 2C0OA 3N7YA 1UUSA 4K11A 3K2MA 2PNBA 5GJIA 1MW4A 1O4JA 2MQIA 1AYAA 1A09A 1CWDL 3VS5A 3PJPA 1SHBA 5DC0B 2HMHA 1GRIA 1TZEE 1R1SA 1JU5A 1RQQC 1KA6A 2B3OA 1R1PA 1FHSA 1RPYA 3OB2B 2Y3AB 5BO4A 1A1CA 3NHNA 2EOBA 1R1QA 1KA7A 1JWOA 1OO3A 2YSXA 1BHFA 2MRJA 3KFJA 4NWGA 5I6VA 1BMBA 2MRKA 3VRYA 1A1BA 3HHMB 3PSKA 3GQIB 1O4EA 1LUMA 3WA4A 1BFIA 1CJ1A 2ABLA 5DC4A 3IN7A 1D1ZA 2CI9A 2LCTA 4OHHA 3VRPA 2EO6A 4K2RA 2HUWA 4P9VA 1O4FA 1O4HA 2CRHA 1BLKA 1BKLA 2CS0A 1G83A 1O4RA 1NZLA 1H9OA 1O4DA 4XZ0A 5EHRA 1LCKA 2CI8A 2EO3A 1F1WA 3MXCA 4K45A 3T04A 3PFVA 5DF6A 3VS7A 1O49A 4OHEA 1ZFPE 3VS2A 2RSYA 5DC9A 3QWXX 2IUHA 4GPLB 4F5AA 1MILA 1K9AA 3VRRA 3EAZA 1GHUA 3VGOA 5EG3B 4A4BA 1FMKA 2EYVA 2LNXA 1NZVA 1O47A 4K44A 1OPKA 5CDWA 2CIAA 1I3ZA 1FBZA 4OHDA 4JEGA 2HDVA 1BM2A 3MAZA 1HCSB 3VRNA 1KSWA 1BHHB 2PTKA 1QADA 2SRCA 4X6SA 2H46E 2DLZA 3PQZA 2H8HA 3BUNB 1D4WA 1BF5A 1KC2A 1NRVA 2BBUA 1A1EA 2FO0A 2L3TA 1FYRA 3HCKA 2CR4A 5D0JA 3BUOB 2DLYA 2QMSA 1O4AA 1M27A 3C7IA 4F5BA 1AB2A 1M61A 4FBNA 4FL3A 2EU0A 1A07A 1O4IA 1CSZA 3UF4A 1LUKA 3S8LA 1OPLA 1Y1UA 1O46A 2PLEA 2PLDA 5IBMA 1BFJA 2C0IA 1CSYA 3M7FA 1IS0A 3VS4A 1CWEA 4H34A 3ZNIA 4OHIA 1HCTB 2RVFA 3OB1B 3BUMB 2FCIA 2H5KA 2ECDA 1SHDA 1LKLA 5KAZA 1YVLA 4M4ZA 1O4OA 1BKMA 2RMXA 1B47A 5J3XA 1FU6A 1XA6A 2EYZA 5EELA 3OV1A 2YU7A 4EY0A 5AULA 3TL0A 1O4CA 2C9WA 2IUGA 3PS5A 2DM0A 3CD3A 1X27A 2L6KA 2VIFA 1O48A 1OO4A 3BUXB 2L4KA 3OP0A 2XP1A 3S8NA 2HDXA 1AOUF 3BUWB 1O4LA 4NWFA 4P9ZA 1SHAA 4WWQA 1O44A 3N8MA 1AYDA 1O4PA 1BG1A 2KNOA 4OHLA 1O4NA 1AYCA 4U1PA 3OVEA 1AYBA 5EEQA 1JYQA 2ETZA 4EIHA 4XZ1A 3CWGA 1UURA 5HKYA 2DX0A 4E68A 5HKWA 4F59A 1SKJA 3TKZA 4D8KA 1O43A 1BHHA 1LCJA 4E93A 1A1AA 1O4GA 2Y1NA 4DGXA 5AXIA 2K7AB 3VS1A 2AOBA 4QSYA 2GSBA 1LKKA 3CXLA 1O4BA 1SPRA 2K79B 3CBLA 1AD5A 3IMDA 2OZOA 4A4CA 1O4QA 1RJAA 2IZVA 1FU5A 4JGHA 3S8OA 1F2FA 4H1OA 3HIZB 1O4MA 4JE4A 3VRQA 1A81A 2HCKA 1JYUA 1LUNA 4L1BB 4LUEA 1P13A 3UYOA 2DVJA 1SPSA 2EKXA 2JYQA 1Z3KA 4FL2A 3N84A 1D4TA 2KK6A 4GL9E 4TZIA 3GXWA 1YVHA 1X6CA
chains in the Genus database with same CATH superfamily
5IBSA 3VRZA 1FBVA 4LUDA 2Y1MA 1A08A 3VROA 4DGPA 2LQNA 2PNAA 2GE9A 3EACA 1O42A 1WQUA 2AUGA 2RORA 2C0TA 2CBLA 2MC1A 1AOTF 2MK2A 2LNWA 4U17A 3VS0A 1JYRA 3BKBA 1PICA 2EL8A 1BLJA 1IJRA 4ROJA 1LUIA 3US4A 1O41A 3IN8A 2EYYA 3QWYA 1TCEA 3PSJA 3GXXA 2SHPA 1QCFA 3PLFB 3VS6A 1Y57A 1QG1E 3VS3A 2AOAA 3MXYA 1X0NA 1O4KA 3IMJA 5EHPA 2LQWA 5HKZA 2DCRA 2IUIA 3S9KA 1O45A 5GJHA 2OQ1A 4GWFA 2C0OA 3N7YA 1UUSA 4K11A 3K2MA 2PNBA 5GJIA 1MW4A 1O4JA 2MQIA 1AYAA 1A09A 1CWDL 3VS5A 3PJPA 1SHBA 5DC0B 2HMHA 1GRIA 1TZEE 1R1SA 1JU5A 1RQQC 1KA6A 2B3OA 1R1PA 1FHSA 2LRAA 1RPYA 3OB2B 2Y3AB 5BO4A 1A1CA 3NHNA 2EOBA 1R1QA 1KA7A 1JWOA 1OO3A 2YSXA 1BHFA 2MRJA 3KFJA 4NWGA 5I6VA 1BMBA 2MRKA 3VRYA 1A1BA 3HHMB 3PSKA 3GQIB 1O4EA 1LUMA 3WA4A 1BFIA 1CJ1A 2ABLA 5DC4A 3IN7A 1D1ZA 2CI9A 2LCTA 4OHHA 3VRPA 2EO6A 4K2RA 2HUWA 4P9VA 1O4FA 1O4HA 2CRHA 1BLKA 1BKLA 2CS0A 1G83A 1O4RA 1NZLA 1H9OA 1O4DA 4XZ0A 5EHRA 1LCKA 2CI8A 2EO3A 1F1WA 3MXCA 4K45A 3T04A 3PFVA 5DF6A 3VS7A 1O49A 4OHEA 1ZFPE 3VS2A 2RSYA 5DC9A 3QWXX 2IUHA 4GPLB 4F5AA 1MILA 1K9AA 3VRRA 3EAZA 1GHUA 3VGOA 5EG3B 4A4BA 1FMKA 2EYVA 2LNXA 1NZVA 1O47A 4K44A 1OPKA 5CDWA 2CIAA 1I3ZA 1FBZA 4OHDA 4JEGA 2HDVA 1BM2A 3MAZA 1HCSB 3VRNA 1KSWA 1BHHB 2PTKA 1QADA 2SRCA 4X6SA 2H46E 2DLZA 3PQZA 2H8HA 3BUNB 1D4WA 1BF5A 1KC2A 1NRVA 2BBUA 1A1EA 2FO0A 2L3TA 1FYRA 3HCKA 2CR4A 5D0JA 3BUOB 2DLYA 2QMSA 1O4AA 1M27A 3C7IA 4F5BA 1AB2A 1M61A 4FBNA 4FL3A 2EU0A 1A07A 1O4IA 1CSZA 3UF4A 1LUKA 2KGYA 3S8LA 1OPLA 1Y1UA 1O46A 2PLEA 2PLDA 5IBMA 1BFJA 2C0IA 1CSYA 3M7FA 1IS0A 3VS4A 1CWEA 4H34A 3ZNIA 4OHIA 1HCTB 2RVFA 3OB1B 3BUMB 2FCIA 2H5KA 2ECDA 1SHDA 1LKLA 5KAZA 1YVLA 4M4ZA 1O4OA 1BKMA 2RMXA 1B47A 5J3XA 1FU6A 1XA6A 2EYZA 5EELA 3OV1A 2YU7A 4EY0A 5AULA 3TL0A 1O4CA 2C9WA 2IUGA 3PS5A 2DM0A 3CD3A 1X27A 2L6KA 2VIFA 1O48A 1OO4A 3BUXB 3K2TA 2L4KA 3OP0A 2XP1A 3LYVA 3S8NA 2HDXA 1AOUF 3BUWB 1O4LA 4NWFA 4P9ZA 1SHAA 4WWQA 1O44A 3N8MA 1AYDA 1O4PA 1BG1A 2KNOA 4OHLA 1O4NA 1AYCA 4U1PA 3OVEA 1AYBA 5EEQA 1JYQA 2ETZA 4EIHA 4XZ1A 3CWGA 1UURA 5HKYA 2DX0A 4E68A 5HKWA 4F59A 1SKJA 3TKZA 4D8KA 1O43A 1BHHA 1LCJA 4E93A 1A1AA 1O4GA 2Y1NA 4DGXA 5AXIA 2K7AB 3VS1A 2AOBA 4QSYA 2GSBA 1LKKA 3CXLA 1O4BA 1SPRA 2K79B 3CBLA 1AD5A 3IMDA 2OZOA 4A4CA 1O4QA 1RJAA 2IZVA 1FU5A 4JGHA 3S8OA 1F2FA 4H1OA 3HIZB 1O4MA 4JE4A 3VRQA 1A81A 2HCKA 1JYUA 1LUNA 4L1BB 4LUEA 1P13A 3UYOA 2DVJA 1SPSA 2EKXA 2JYQA 1Z3KA 4FL2A 3N84A 1D4TA 2KK6A 4GL9E 4TZIA 3GXWA 1YVHA 1X6CA
chains in the Genus database with same CATH topology
5IBSA 3VRZA 1FBVA 4LUDA 2Y1MA 1A08A 3VROA 4DGPA 2LQNA 2PNAA 2GE9A 3EACA 1O42A 1WQUA 2AUGA 2RORA 2C0TA 2CBLA 2MC1A 1AOTF 2MK2A 2LNWA 4U17A 3VS0A 1JYRA 3BKBA 1PICA 2EL8A 1BLJA 1IJRA 4ROJA 1LUIA 3US4A 1O41A 3IN8A 2EYYA 3QWYA 1TCEA 3PSJA 3GXXA 2SHPA 1QCFA 3PLFB 3VS6A 1Y57A 1QG1E 3VS3A 2AOAA 3MXYA 1X0NA 1O4KA 3IMJA 5EHPA 2LQWA 5HKZA 2DCRA 2IUIA 3S9KA 1O45A 5GJHA 2OQ1A 4GWFA 2C0OA 3N7YA 1UUSA 4K11A 3K2MA 2PNBA 5GJIA 1MW4A 1O4JA 2MQIA 1AYAA 1A09A 1CWDL 3VS5A 3PJPA 1SHBA 5DC0B 2HMHA 1GRIA 1TZEE 1R1SA 1JU5A 1RQQC 1KA6A 2B3OA 1R1PA 1FHSA 1RPYA 3OB2B 2Y3AB 5BO4A 1A1CA 3NHNA 2EOBA 1R1QA 1KA7A 1JWOA 1OO3A 2YSXA 1BHFA 2MRJA 3KFJA 4NWGA 5I6VA 1BMBA 2MRKA 3VRYA 1A1BA 3HHMB 3PSKA 3GQIB 1O4EA 1LUMA 3WA4A 1BFIA 1CJ1A 2ABLA 5DC4A 3IN7A 1D1ZA 2CI9A 2LCTA 4OHHA 3VRPA 2EO6A 4K2RA 2HUWA 4P9VA 1O4FA 1O4HA 2CRHA 1BLKA 1BKLA 2CS0A 1G83A 1O4RA 1NZLA 1H9OA 1O4DA 4XZ0A 5EHRA 1LCKA 2CI8A 2EO3A 1F1WA 3MXCA 4K45A 3T04A 3PFVA 5DF6A 3VS7A 1O49A 4OHEA 1ZFPE 3VS2A 2RSYA 5DC9A 3QWXX 2IUHA 4GPLB 4F5AA 1MILA 1K9AA 3VRRA 3EAZA 1GHUA 3VGOA 5EG3B 4A4BA 1FMKA 2EYVA 2LNXA 1NZVA 1O47A 4K44A 1OPKA 5CDWA 2CIAA 1I3ZA 1FBZA 4OHDA 4JEGA 2HDVA 1BM2A 3MAZA 1HCSB 3VRNA 1KSWA 1BHHB 2PTKA 1QADA 2SRCA 4X6SA 2H46E 2DLZA 3PQZA 2H8HA 3BUNB 1D4WA 1BF5A 1KC2A 1NRVA 2BBUA 1A1EA 2FO0A 2L3TA 1FYRA 3HCKA 2CR4A 5D0JA 3BUOB 2DLYA 2QMSA 1O4AA 1M27A 3C7IA 4F5BA 1AB2A 1M61A 4FBNA 4FL3A 2EU0A 1A07A 1O4IA 1CSZA 3UF4A 1LUKA 3S8LA 1OPLA 1Y1UA 1O46A 2PLEA 2PLDA 5IBMA 1BFJA 2C0IA 1CSYA 3M7FA 1IS0A 3VS4A 1CWEA 4H34A 3ZNIA 4OHIA 1HCTB 2RVFA 3OB1B 3BUMB 2FCIA 2H5KA 2ECDA 1SHDA 1LKLA 5KAZA 1YVLA 4M4ZA 1O4OA 1BKMA 2RMXA 1B47A 5J3XA 1FU6A 1XA6A 2EYZA 5EELA 3OV1A 2YU7A 4EY0A 5AULA 3TL0A 1O4CA 2C9WA 2IUGA 3PS5A 2DM0A 3CD3A 1X27A 2L6KA 2VIFA 1O48A 1OO4A 3BUXB 2L4KA 3OP0A 2XP1A 3S8NA 2HDXA 1AOUF 3BUWB 1O4LA 4NWFA 4P9ZA 1SHAA 4WWQA 1O44A 3N8MA 1AYDA 1O4PA 1BG1A 2KNOA 4OHLA 1O4NA 1AYCA 4U1PA 3OVEA 1AYBA 5EEQA 1JYQA 2ETZA 4EIHA 4XZ1A 3CWGA 1UURA 5HKYA 2DX0A 4E68A 5HKWA 4F59A 1SKJA 3TKZA 4D8KA 1O43A 1BHHA 1LCJA 4E93A 1A1AA 1O4GA 2Y1NA 4DGXA 5AXIA 2K7AB 3VS1A 2AOBA 4QSYA 2GSBA 1LKKA 3CXLA 1O4BA 1SPRA 2K79B 3CBLA 1AD5A 3IMDA 2OZOA 4A4CA 1O4QA 1RJAA 2IZVA 1FU5A 4JGHA 3S8OA 1F2FA 4H1OA 3HIZB 1O4MA 4JE4A 3VRQA 1A81A 2HCKA 1JYUA 1LUNA 4L1BB 4LUEA 1P13A 3UYOA 2DVJA 1SPSA 2EKXA 2JYQA 1Z3KA 4FL2A 3N84A 1D4TA 2KK6A 4GL9E 4TZIA 3GXWA 1YVHA 1X6CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IBS A;  3VRZ A;  1FBV A;  4LUD A;  2Y1M A;  1A08 A;  3VRO A;  4DGP A;  2LQN A;  2PNA A;  2GE9 A;  3EAC A;  1O42 A;  1WQU A;  2AUG A;  2ROR A;  2C0T A;  2CBL A;  2MC1 A;  1AOT F;  2MK2 A;  2LNW A;  4U17 A;  3VS0 A;  1JYR A;  3BKB A;  1PIC A;  2EL8 A;  1BLJ A;  1IJR A;  4ROJ A;  1LUI A;  3US4 A;  1O41 A;  3IN8 A;  2EYY A;  3QWY A;  1TCE A;  3PSJ A;  3GXX A;  2SHP A;  1QCF A;  3PLF B;  3VS6 A;  1Y57 A;  1QG1 E;  3VS3 A;  2AOA A;  3MXY A;  1X0N A;  1O4K A;  3IMJ A;  5EHP A;  2LQW A;  5HKZ A;  2DCR A;  2IUI A;  3S9K A;  1O45 A;  5GJH A;  2OQ1 A;  4GWF A;  2C0O A;  3N7Y A;  1UUS A;  4K11 A;  3K2M A;  2PNB A;  5GJI A;  1MW4 A;  1O4J A;  2MQI A;  1AYA A;  1A09 A;  1CWD L;  3VS5 A;  3PJP A;  1SHB A;  5DC0 B;  2HMH A;  1GRI A;  1TZE E;  1R1S A;  1JU5 A;  1RQQ C;  1KA6 A;  2B3O A;  1R1P A;  1FHS A;  1RPY A;  3OB2 B;  2Y3A B;  5BO4 A;  1A1C A;  3NHN A;  2EOB A;  1R1Q A;  1KA7 A;  1JWO A;  1OO3 A;  2YSX A;  1BHF A;  2MRJ A;  3KFJ A;  4NWG A;  5I6V A;  1BMB A;  2MRK A;  3VRY A;  1A1B A;  3HHM B;  3PSK A;  3GQI B;  1O4E A;  1LUM A;  3WA4 A;  1BFI A;  1CJ1 A;  2ABL A;  5DC4 A;  3IN7 A;  1D1Z A;  2CI9 A;  2LCT A;  4OHH A;  3VRP A;  2EO6 A;  4K2R A;  2HUW A;  4P9V A;  1O4F A;  1O4H A;  2CRH A;  1BLK A;  1BKL A;  2CS0 A;  1G83 A;  1O4R A;  1NZL A;  1H9O A;  1O4D A;  4XZ0 A;  5EHR A;  1LCK A;  2CI8 A;  2EO3 A;  1F1W A;  3MXC A;  4K45 A;  3T04 A;  3PFV A;  5DF6 A;  3VS7 A;  1O49 A;  4OHE A;  1ZFP E;  3VS2 A;  2RSY A;  5DC9 A;  3QWX X;  2IUH A;  4GPL B;  4F5A A;  1MIL A;  1K9A A;  3VRR A;  3EAZ A;  1GHU A;  3VGO A;  5EG3 B;  4A4B A;  1FMK A;  2EYV A;  2LNX A;  1NZV A;  1O47 A;  4K44 A;  1OPK A;  5CDW A;  2CIA A;  1I3Z A;  1FBZ A;  4OHD A;  4JEG A;  2HDV A;  1BM2 A;  3MAZ A;  1HCS B;  3VRN A;  1KSW A;  1BHH B;  2PTK A;  1QAD A;  2SRC A;  4X6S A;  2H46 E;  2DLZ A;  3PQZ A;  2H8H A;  3BUN B;  1D4W A;  1BF5 A;  1KC2 A;  1NRV A;  2BBU A;  1A1E A;  2FO0 A;  2L3T A;  1FYR A;  3HCK A;  2CR4 A;  5D0J A;  3BUO B;  2DLY A;  2QMS A;  1O4A A;  1M27 A;  3C7I A;  4F5B A;  1AB2 A;  1M61 A;  4FBN A;  4FL3 A;  2EU0 A;  1A07 A;  1O4I A;  1CSZ A;  3UF4 A;  1LUK A;  3S8L A;  1OPL A;  1Y1U A;  1O46 A;  2PLE A;  2PLD A;  5IBM A;  1BFJ A;  2C0I A;  1CSY A;  3M7F A;  1IS0 A;  3VS4 A;  1CWE A;  4H34 A;  3ZNI A;  4OHI A;  1HCT B;  2RVF A;  3OB1 B;  3BUM B;  2FCI A;  2H5K A;  2ECD A;  1SHD A;  1LKL A;  5KAZ A;  1YVL A;  4M4Z A;  1O4O A;  1BKM A;  2RMX A;  1B47 A;  5J3X A;  1FU6 A;  1XA6 A;  2EYZ A;  5EEL A;  3OV1 A;  2YU7 A;  4EY0 A;  5AUL A;  3TL0 A;  1O4C A;  2C9W A;  2IUG A;  3PS5 A;  2DM0 A;  3CD3 A;  1X27 A;  2L6K A;  2VIF A;  1O48 A;  1OO4 A;  3BUX B;  2L4K A;  3OP0 A;  2XP1 A;  3S8N A;  2HDX A;  1AOU F;  3BUW B;  1O4L A;  4NWF A;  4P9Z A;  1SHA A;  4WWQ A;  1O44 A;  3N8M A;  1AYD A;  1O4P A;  1BG1 A;  2KNO A;  4OHL A;  1O4N A;  1AYC A;  4U1P A;  3OVE A;  1AYB A;  5EEQ A;  1JYQ A;  2ETZ A;  4EIH A;  4XZ1 A;  3CWG A;  1UUR A;  5HKY A;  2DX0 A;  4E68 A;  5HKW A;  4F59 A;  1SKJ A;  3TKZ A;  4D8K A;  1O43 A;  1BHH A;  1LCJ A;  4E93 A;  1A1A A;  1O4G A;  2Y1N A;  4DGX A;  5AXI A;  2K7A B;  3VS1 A;  2AOB A;  4QSY A;  2GSB A;  1LKK A;  3CXL A;  1O4B A;  1SPR A;  2K79 B;  3CBL A;  1AD5 A;  3IMD A;  2OZO A;  4A4C A;  1O4Q A;  1RJA A;  2IZV A;  1FU5 A;  4JGH A;  3S8O A;  1F2F A;  4H1O A;  3HIZ B;  1O4M A;  4JE4 A;  3VRQ A;  1A81 A;  2HCK A;  1JYU A;  1LUN A;  4L1B B;  4LUE A;  1P13 A;  3UYO A;  2DVJ A;  1SPS A;  2EKX A;  2JYQ A;  1Z3K A;  4FL2 A;  3N84 A;  1D4T A;  2KK6 A;  4GL9 E;  4TZI A;  3GXW A;  1YVH A;  1X6C A; 
#chains in the Genus database with same CATH topology
 5IBS A;  3VRZ A;  1FBV A;  4LUD A;  2Y1M A;  1A08 A;  3VRO A;  4DGP A;  2LQN A;  2PNA A;  2GE9 A;  3EAC A;  1O42 A;  1WQU A;  2AUG A;  2ROR A;  2C0T A;  2CBL A;  2MC1 A;  1AOT F;  2MK2 A;  2LNW A;  4U17 A;  3VS0 A;  1JYR A;  3BKB A;  1PIC A;  2EL8 A;  1BLJ A;  1IJR A;  4ROJ A;  1LUI A;  3US4 A;  1O41 A;  3IN8 A;  2EYY A;  3QWY A;  1TCE A;  3PSJ A;  3GXX A;  2SHP A;  1QCF A;  3PLF B;  3VS6 A;  1Y57 A;  1QG1 E;  3VS3 A;  2AOA A;  3MXY A;  1X0N A;  1O4K A;  3IMJ A;  5EHP A;  2LQW A;  5HKZ A;  2DCR A;  2IUI A;  3S9K A;  1O45 A;  5GJH A;  2OQ1 A;  4GWF A;  2C0O A;  3N7Y A;  1UUS A;  4K11 A;  3K2M A;  2PNB A;  5GJI A;  1MW4 A;  1O4J A;  2MQI A;  1AYA A;  1A09 A;  1CWD L;  3VS5 A;  3PJP A;  1SHB A;  5DC0 B;  2HMH A;  1GRI A;  1TZE E;  1R1S A;  1JU5 A;  1RQQ C;  1KA6 A;  2B3O A;  1R1P A;  1FHS A;  2LRA A;  1RPY A;  3OB2 B;  2Y3A B;  5BO4 A;  1A1C A;  3NHN A;  2EOB A;  1R1Q A;  1KA7 A;  1JWO A;  1OO3 A;  2YSX A;  1BHF A;  2MRJ A;  3KFJ A;  4NWG A;  5I6V A;  1BMB A;  2MRK A;  3VRY A;  1A1B A;  3HHM B;  3PSK A;  3GQI B;  1O4E A;  1LUM A;  3WA4 A;  1BFI A;  1CJ1 A;  2ABL A;  5DC4 A;  3IN7 A;  1D1Z A;  2CI9 A;  2LCT A;  4OHH A;  3VRP A;  2EO6 A;  4K2R A;  2HUW A;  4P9V A;  1O4F A;  1O4H A;  2CRH A;  1BLK A;  1BKL A;  2CS0 A;  1G83 A;  1O4R A;  1NZL A;  1H9O A;  1O4D A;  4XZ0 A;  5EHR A;  1LCK A;  2CI8 A;  2EO3 A;  1F1W A;  3MXC A;  4K45 A;  3T04 A;  3PFV A;  5DF6 A;  3VS7 A;  1O49 A;  4OHE A;  1ZFP E;  3VS2 A;  2RSY A;  5DC9 A;  3QWX X;  2IUH A;  4GPL B;  4F5A A;  1MIL A;  1K9A A;  3VRR A;  3EAZ A;  1GHU A;  3VGO A;  5EG3 B;  4A4B A;  1FMK A;  2EYV A;  2LNX A;  1NZV A;  1O47 A;  4K44 A;  1OPK A;  5CDW A;  2CIA A;  1I3Z A;  1FBZ A;  4OHD A;  4JEG A;  2HDV A;  1BM2 A;  3MAZ A;  1HCS B;  3VRN A;  1KSW A;  1BHH B;  2PTK A;  1QAD A;  2SRC A;  4X6S A;  2H46 E;  2DLZ A;  3PQZ A;  2H8H A;  3BUN B;  1D4W A;  1BF5 A;  1KC2 A;  1NRV A;  2BBU A;  1A1E A;  2FO0 A;  2L3T A;  1FYR A;  3HCK A;  2CR4 A;  5D0J A;  3BUO B;  2DLY A;  2QMS A;  1O4A A;  1M27 A;  3C7I A;  4F5B A;  1AB2 A;  1M61 A;  4FBN A;  4FL3 A;  2EU0 A;  1A07 A;  1O4I A;  1CSZ A;  3UF4 A;  1LUK A;  2KGY A;  3S8L A;  1OPL A;  1Y1U A;  1O46 A;  2PLE A;  2PLD A;  5IBM A;  1BFJ A;  2C0I A;  1CSY A;  3M7F A;  1IS0 A;  3VS4 A;  1CWE A;  4H34 A;  3ZNI A;  4OHI A;  1HCT B;  2RVF A;  3OB1 B;  3BUM B;  2FCI A;  2H5K A;  2ECD A;  1SHD A;  1LKL A;  5KAZ A;  1YVL A;  4M4Z A;  1O4O A;  1BKM A;  2RMX A;  1B47 A;  5J3X A;  1FU6 A;  1XA6 A;  2EYZ A;  5EEL A;  3OV1 A;  2YU7 A;  4EY0 A;  5AUL A;  3TL0 A;  1O4C A;  2C9W A;  2IUG A;  3PS5 A;  2DM0 A;  3CD3 A;  1X27 A;  2L6K A;  2VIF A;  1O48 A;  1OO4 A;  3BUX B;  3K2T A;  2L4K A;  3OP0 A;  2XP1 A;  3LYV A;  3S8N A;  2HDX A;  1AOU F;  3BUW B;  1O4L A;  4NWF A;  4P9Z A;  1SHA A;  4WWQ A;  1O44 A;  3N8M A;  1AYD A;  1O4P A;  1BG1 A;  2KNO A;  4OHL A;  1O4N A;  1AYC A;  4U1P A;  3OVE A;  1AYB A;  5EEQ A;  1JYQ A;  2ETZ A;  4EIH A;  4XZ1 A;  3CWG A;  1UUR A;  5HKY A;  2DX0 A;  4E68 A;  5HKW A;  4F59 A;  1SKJ A;  3TKZ A;  4D8K A;  1O43 A;  1BHH A;  1LCJ A;  4E93 A;  1A1A A;  1O4G A;  2Y1N A;  4DGX A;  5AXI A;  2K7A B;  3VS1 A;  2AOB A;  4QSY A;  2GSB A;  1LKK A;  3CXL A;  1O4B A;  1SPR A;  2K79 B;  3CBL A;  1AD5 A;  3IMD A;  2OZO A;  4A4C A;  1O4Q A;  1RJA A;  2IZV A;  1FU5 A;  4JGH A;  3S8O A;  1F2F A;  4H1O A;  3HIZ B;  1O4M A;  4JE4 A;  3VRQ A;  1A81 A;  2HCK A;  1JYU A;  1LUN A;  4L1B B;  4LUE A;  1P13 A;  3UYO A;  2DVJ A;  1SPS A;  2EKX A;  2JYQ A;  1Z3K A;  4FL2 A;  3N84 A;  1D4T A;  2KK6 A;  4GL9 E;  4TZI A;  3GXW A;  1YVH A;  1X6C A; 
#chains in the Genus database with same CATH homology
 5IBS A;  3VRZ A;  1FBV A;  4LUD A;  2Y1M A;  1A08 A;  3VRO A;  4DGP A;  2LQN A;  2PNA A;  2GE9 A;  3EAC A;  1O42 A;  1WQU A;  2AUG A;  2ROR A;  2C0T A;  2CBL A;  2MC1 A;  1AOT F;  2MK2 A;  2LNW A;  4U17 A;  3VS0 A;  1JYR A;  3BKB A;  1PIC A;  2EL8 A;  1BLJ A;  1IJR A;  4ROJ A;  1LUI A;  3US4 A;  1O41 A;  3IN8 A;  2EYY A;  3QWY A;  1TCE A;  3PSJ A;  3GXX A;  2SHP A;  1QCF A;  3PLF B;  3VS6 A;  1Y57 A;  1QG1 E;  3VS3 A;  2AOA A;  3MXY A;  1X0N A;  1O4K A;  3IMJ A;  5EHP A;  2LQW A;  5HKZ A;  2DCR A;  2IUI A;  3S9K A;  1O45 A;  5GJH A;  2OQ1 A;  4GWF A;  2C0O A;  3N7Y A;  1UUS A;  4K11 A;  3K2M A;  2PNB A;  5GJI A;  1MW4 A;  1O4J A;  2MQI A;  1AYA A;  1A09 A;  1CWD L;  3VS5 A;  3PJP A;  1SHB A;  5DC0 B;  2HMH A;  1GRI A;  1TZE E;  1R1S A;  1JU5 A;  1RQQ C;  1KA6 A;  2B3O A;  1R1P A;  1FHS A;  1RPY A;  3OB2 B;  2Y3A B;  5BO4 A;  1A1C A;  3NHN A;  2EOB A;  1R1Q A;  1KA7 A;  1JWO A;  1OO3 A;  2YSX A;  1BHF A;  2MRJ A;  3KFJ A;  4NWG A;  5I6V A;  1BMB A;  2MRK A;  3VRY A;  1A1B A;  3HHM B;  3PSK A;  3GQI B;  1O4E A;  1LUM A;  3WA4 A;  1BFI A;  1CJ1 A;  2ABL A;  5DC4 A;  3IN7 A;  1D1Z A;  2CI9 A;  2LCT A;  4OHH A;  3VRP A;  2EO6 A;  4K2R A;  2HUW A;  4P9V A;  1O4F A;  1O4H A;  2CRH A;  1BLK A;  1BKL A;  2CS0 A;  1G83 A;  1O4R A;  1NZL A;  1H9O A;  1O4D A;  4XZ0 A;  5EHR A;  1LCK A;  2CI8 A;  2EO3 A;  1F1W A;  3MXC A;  4K45 A;  3T04 A;  3PFV A;  5DF6 A;  3VS7 A;  1O49 A;  4OHE A;  1ZFP E;  3VS2 A;  2RSY A;  5DC9 A;  3QWX X;  2IUH A;  4GPL B;  4F5A A;  1MIL A;  1K9A A;  3VRR A;  3EAZ A;  1GHU A;  3VGO A;  5EG3 B;  4A4B A;  1FMK A;  2EYV A;  2LNX A;  1NZV A;  1O47 A;  4K44 A;  1OPK A;  5CDW A;  2CIA A;  1I3Z A;  1FBZ A;  4OHD A;  4JEG A;  2HDV A;  1BM2 A;  3MAZ A;  1HCS B;  3VRN A;  1KSW A;  1BHH B;  2PTK A;  1QAD A;  2SRC A;  4X6S A;  2H46 E;  2DLZ A;  3PQZ A;  2H8H A;  3BUN B;  1D4W A;  1BF5 A;  1KC2 A;  1NRV A;  2BBU A;  1A1E A;  2FO0 A;  2L3T A;  1FYR A;  3HCK A;  2CR4 A;  5D0J A;  3BUO B;  2DLY A;  2QMS A;  1O4A A;  1M27 A;  3C7I A;  4F5B A;  1AB2 A;  1M61 A;  4FBN A;  4FL3 A;  2EU0 A;  1A07 A;  1O4I A;  1CSZ A;  3UF4 A;  1LUK A;  3S8L A;  1OPL A;  1Y1U A;  1O46 A;  2PLE A;  2PLD A;  5IBM A;  1BFJ A;  2C0I A;  1CSY A;  3M7F A;  1IS0 A;  3VS4 A;  1CWE A;  4H34 A;  3ZNI A;  4OHI A;  1HCT B;  2RVF A;  3OB1 B;  3BUM B;  2FCI A;  2H5K A;  2ECD A;  1SHD A;  1LKL A;  5KAZ A;  1YVL A;  4M4Z A;  1O4O A;  1BKM A;  2RMX A;  1B47 A;  5J3X A;  1FU6 A;  1XA6 A;  2EYZ A;  5EEL A;  3OV1 A;  2YU7 A;  4EY0 A;  5AUL A;  3TL0 A;  1O4C A;  2C9W A;  2IUG A;  3PS5 A;  2DM0 A;  3CD3 A;  1X27 A;  2L6K A;  2VIF A;  1O48 A;  1OO4 A;  3BUX B;  2L4K A;  3OP0 A;  2XP1 A;  3S8N A;  2HDX A;  1AOU F;  3BUW B;  1O4L A;  4NWF A;  4P9Z A;  1SHA A;  4WWQ A;  1O44 A;  3N8M A;  1AYD A;  1O4P A;  1BG1 A;  2KNO A;  4OHL A;  1O4N A;  1AYC A;  4U1P A;  3OVE A;  1AYB A;  5EEQ A;  1JYQ A;  2ETZ A;  4EIH A;  4XZ1 A;  3CWG A;  1UUR A;  5HKY A;  2DX0 A;  4E68 A;  5HKW A;  4F59 A;  1SKJ A;  3TKZ A;  4D8K A;  1O43 A;  1BHH A;  1LCJ A;  4E93 A;  1A1A A;  1O4G A;  2Y1N A;  4DGX A;  5AXI A;  2K7A B;  3VS1 A;  2AOB A;  4QSY A;  2GSB A;  1LKK A;  3CXL A;  1O4B A;  1SPR A;  2K79 B;  3CBL A;  1AD5 A;  3IMD A;  2OZO A;  4A4C A;  1O4Q A;  1RJA A;  2IZV A;  1FU5 A;  4JGH A;  3S8O A;  1F2F A;  4H1O A;  3HIZ B;  1O4M A;  4JE4 A;  3VRQ A;  1A81 A;  2HCK A;  1JYU A;  1LUN A;  4L1B B;  4LUE A;  1P13 A;  3UYO A;  2DVJ A;  1SPS A;  2EKX A;  2JYQ A;  1Z3K A;  4FL2 A;  3N84 A;  1D4T A;  2KK6 A;  4GL9 E;  4TZI A;  3GXW A;  1YVH A;  1X6C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...