4U17A

Swapped dimer of the human fyn-sh2 domain
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
102
structure length
102
Chain Sequence
b'MEWYFGKLGRKDAERQLLSFGNPRGTFLIRESETTKGAYSLSIRDWDDMKGDHVKHYKIRKLDNGGYYITTRAQFETLQQLVQHYSERAAGLCCRLVVPCHK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tyrosine-protein kinase Fyn
publication title Swapped dimer of the human Fyn-SH2 domain
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 21
structure length 102
sequence length 102
chains with identical sequence B, C
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2014-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00017 SH2 SH2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.505.10 Alpha Beta 2-Layer Sandwich SHC Adaptor Protein SH2 domain 4u17A00
3T04A 3US4A 2EYYA 3N84A 1LKKA 5KAZA 1YVHA 1LCJA 2Y1NA 2BBUA 2H5KA 2B3OA 2YU7A 4P9VA 3OV1A 1O4HA 2DLZA 4F5BA 2C9WA 5HKWA 1X27A 1SHAA 1F1WA 2EU0A 1D1ZA 3CXLA 1RQQC 1OPKA 1K9AA 1CSYA 3OB1B 5EG3B 3S8OA 2PLEA 1KA6A 2HCKA 1JYRA 3TKZA 2LNXA 1D4TA 1LUNA 1BHFA 1SPSA 1BFIA 4OHIA 2FCIA 1O43A 1JYUA 3GXXA 1NRVA 5EELA 4NWFA 5I6VA 2C0OA 1Z3KA 3VRPA 3CBLA 1O42A 4GWFA 2RORA 2CIAA 4JE4A 3PS5A 1O4AA 2IUIA 2H46E 3IN7A 4DGXA 1JWOA 2KK6A 3N7YA 5AULA 2L4KA 3VS7A 4OHLA 2OZOA 1O4BA 3PSKA 1OO3A 2EL8A 1M61A 2LQWA 1O4IA 4TZIA 1QADA 1A08A 2MC1A 5IBMA 4H1OA 3VS5A 2EYVA 3PLFB 1ZFPE 1Y57A 2PNBA 3NHNA 4L1BB 3VS3A 4M4ZA 2PNAA 1UUSA 3OVEA 2C0TA 1CSZA 5AXIA 1FBVA 3CWGA 2ECDA 2MRJA 3S9KA 3UYOA 4GL9E 1O45A 4OHDA 2MQIA 3S8NA 3BUOB 1GHUA 1O44A 5CDWA 1FYRA 2JYQA 1O4NA 3VRZA 4FL3A 1I3ZA 1KC2A 2CI9A 3K2MA 3PJPA 4DGPA 2CRHA 4QSYA 5GJHA 1BLKA 5HKYA 2KNOA 3OP0A 3TL0A 2IZVA 3KFJA 1O49A 2K79B 3EACA 1D4WA 2RVFA 1BG1A 2GE9A 3BUMB 1M27A 3BUNB 2DCRA 1AOUF 1O4OA 2EOBA 2MRKA 4K44A 1AYDA 1R1SA 5DF6A 2IUGA 3BUXB 1PICA 4H34A 2OQ1A 1AYAA 5IBSA 1WQUA 3VRRA 3CD3A 1FMKA 5DC4A 4D8KA 5DC9A 1X0NA 1CJ1A 1BKLA 1KSWA 2DX0A 2EO3A 1O4LA 3HIZB 3S8LA 1SPRA 2EO6A 1AB2A 5GJIA 2Y1MA 5EHPA 1O4RA 2EKXA 4OHEA 3PQZA 3GQIB 1MW4A 1LKLA 1LUKA 2XP1A 3MXYA 2VIFA 1FU5A 2Y3AB 1A1AA 1CWDL 4XZ0A 2DM0A 4LUDA 3IMJA 5J3XA 3C7IA 1A09A 2LNWA 4K45A 2YSXA 1HCSB 4LUEA 2HMHA 3VS4A 1BLJA 3BKBA 4XZ1A 2H8HA 1NZVA 2MK2A 3VGOA 5DC0B 4F5AA 4E68A 1IJRA 1BF5A 4NWGA 5D0JA 3VS6A 1BFJA 1CWEA 1JYQA 1R1QA 2DLYA 1O4KA 1O41A 1KA7A 1JU5A 3QWYA 1FHSA 1QG1E 1AYBA 4WWQA 1AYCA 1O4CA 5EHRA 1A1EA 2CI8A 2AUGA 1P13A 2AOAA 3N8MA 1BM2A 1A81A 4GPLB 1BHHA 4U1PA 2EYZA 1F2FA 1BMBA 2LCTA 2ABLA 3VS2A 3VROA 1TZEE 3PFVA 1HCTB 2ETZA 1O4QA 4X6SA 1LUMA 1SKJA 1NZLA 2SRCA 3HCKA 1QCFA 1UURA 1MILA 1OPLA 1IS0A 2IUHA 2C0IA 3VS0A 3VRYA 1YVLA 1RPYA 1A1BA 1BKMA 4K2RA 4U17A 1O46A 3IN8A 1O4EA 1LCKA 1O4GA 1SHDA 3HHMB 4A4CA 1XA6A 1X6CA 4ROJA 2L3TA 1O4PA 2CBLA 5HKZA 1A1CA 1O4FA 1AD5A 3BUWB 1O4MA 3VS1A 2FO0A 3M7FA 1FU6A 3QWXX 2PLDA 2RSYA 1O48A 2L6KA 2PTKA 5EEQA 1GRIA 3PSJA 1FBZA 4FBNA 2SHPA 2QMSA 1G83A 4OHHA 3ZNIA 3MXCA 1Y1UA 2HUWA 1OO4A 1RJAA 1R1PA 2AOBA 3EAZA 3VRNA 4K11A 2K7AB 1TCEA 4A4BA 2GSBA 4JGHA 2CS0A 3GXWA 4E93A 4EIHA 1H9OA 3IMDA 3MAZA 1A07A 2CR4A 2LQNA 3OB2B 5BO4A 4FL2A 1O4DA 2DVJA 2HDVA 1BHHB 3WA4A 4F59A 4EY0A 1LUIA 1AOTF 2RMXA 1B47A 3UF4A 4JEGA 1O47A 4P9ZA 2HDXA 3VRQA 1O4JA 1SHBA
chains in the Genus database with same CATH superfamily
3T04A 3US4A 2EYYA 3N84A 1LKKA 5KAZA 1YVHA 1LCJA 2Y1NA 2BBUA 2H5KA 2B3OA 2YU7A 4P9VA 3OV1A 1O4HA 2DLZA 4F5BA 2C9WA 5HKWA 1X27A 1SHAA 1F1WA 2EU0A 1D1ZA 3CXLA 1RQQC 1OPKA 1K9AA 1CSYA 3OB1B 5EG3B 3S8OA 2PLEA 1KA6A 2KGYA 2HCKA 1JYRA 3TKZA 2LNXA 1D4TA 1LUNA 1BHFA 1SPSA 1BFIA 4OHIA 2FCIA 1O43A 1JYUA 3GXXA 1NRVA 5EELA 4NWFA 5I6VA 2C0OA 1Z3KA 3VRPA 3CBLA 1O42A 4GWFA 2RORA 2CIAA 4JE4A 3PS5A 1O4AA 2IUIA 2H46E 3IN7A 4DGXA 1JWOA 2KK6A 3N7YA 5AULA 2L4KA 3VS7A 4OHLA 2OZOA 1O4BA 3PSKA 1OO3A 2EL8A 1M61A 2LQWA 1O4IA 4TZIA 1QADA 1A08A 2MC1A 5IBMA 4H1OA 3VS5A 2EYVA 3PLFB 1ZFPE 1Y57A 2PNBA 3NHNA 4L1BB 3VS3A 4M4ZA 2PNAA 1UUSA 3OVEA 2C0TA 1CSZA 5AXIA 1FBVA 3CWGA 2ECDA 2MRJA 3S9KA 3UYOA 4GL9E 1O45A 4OHDA 2MQIA 3S8NA 3BUOB 1GHUA 1O44A 5CDWA 1FYRA 2JYQA 1O4NA 3VRZA 4FL3A 1I3ZA 1KC2A 2CI9A 3K2MA 3PJPA 4DGPA 2CRHA 4QSYA 5GJHA 1BLKA 5HKYA 2KNOA 3OP0A 3TL0A 2IZVA 3KFJA 1O49A 2K79B 3EACA 1D4WA 2RVFA 1BG1A 2GE9A 3BUMB 1M27A 3BUNB 2DCRA 1AOUF 1O4OA 2EOBA 2MRKA 4K44A 1AYDA 1R1SA 5DF6A 2IUGA 3BUXB 1PICA 4H34A 2OQ1A 1AYAA 5IBSA 1WQUA 3VRRA 3CD3A 1FMKA 5DC4A 4D8KA 5DC9A 1X0NA 1CJ1A 1BKLA 1KSWA 2DX0A 2EO3A 1O4LA 3HIZB 3S8LA 1SPRA 2EO6A 1AB2A 5GJIA 2Y1MA 5EHPA 1O4RA 2EKXA 4OHEA 3PQZA 3GQIB 1MW4A 1LKLA 1LUKA 2XP1A 3MXYA 2VIFA 1FU5A 2Y3AB 1A1AA 1CWDL 4XZ0A 2DM0A 4LUDA 3IMJA 5J3XA 3C7IA 1A09A 2LNWA 4K45A 2YSXA 1HCSB 4LUEA 2HMHA 3VS4A 1BLJA 3BKBA 4XZ1A 2H8HA 1NZVA 2MK2A 3VGOA 5DC0B 4F5AA 4E68A 1IJRA 1BF5A 4NWGA 5D0JA 3VS6A 1BFJA 1CWEA 1JYQA 1R1QA 2DLYA 1O4KA 1O41A 1KA7A 1JU5A 3QWYA 1FHSA 1QG1E 1AYBA 4WWQA 1AYCA 1O4CA 5EHRA 1A1EA 2CI8A 2AUGA 1P13A 2AOAA 3N8MA 1BM2A 1A81A 4GPLB 1BHHA 4U1PA 2EYZA 1F2FA 1BMBA 2LCTA 2ABLA 3VS2A 3VROA 1TZEE 3PFVA 1HCTB 2ETZA 1O4QA 4X6SA 1LUMA 1SKJA 1NZLA 2SRCA 3HCKA 1QCFA 1UURA 1MILA 1OPLA 1IS0A 2IUHA 2C0IA 3VS0A 3VRYA 1YVLA 1RPYA 1A1BA 1BKMA 4K2RA 4U17A 1O46A 3IN8A 1O4EA 1LCKA 1O4GA 1SHDA 3HHMB 4A4CA 1XA6A 3K2TA 1X6CA 4ROJA 2L3TA 1O4PA 2CBLA 5HKZA 2LRAA 1A1CA 1O4FA 1AD5A 3BUWB 1O4MA 3VS1A 2FO0A 3M7FA 1FU6A 3QWXX 2PLDA 2RSYA 1O48A 2L6KA 2PTKA 5EEQA 1GRIA 3PSJA 1FBZA 4FBNA 2SHPA 2QMSA 1G83A 4OHHA 3ZNIA 3MXCA 1Y1UA 2HUWA 1OO4A 1RJAA 1R1PA 2AOBA 3EAZA 3VRNA 4K11A 2K7AB 1TCEA 4A4BA 2GSBA 4JGHA 2CS0A 3GXWA 4E93A 4EIHA 1H9OA 3IMDA 3MAZA 1A07A 2CR4A 2LQNA 3OB2B 5BO4A 4FL2A 1O4DA 2DVJA 2HDVA 1BHHB 3WA4A 4F59A 4EY0A 1LUIA 1AOTF 2RMXA 1B47A 3UF4A 4JEGA 1O47A 4P9ZA 2HDXA 3VRQA 3LYVA 1O4JA 1SHBA
chains in the Genus database with same CATH topology
3T04A 3US4A 2EYYA 3N84A 1LKKA 5KAZA 1YVHA 1LCJA 2Y1NA 2BBUA 2H5KA 2B3OA 2YU7A 4P9VA 3OV1A 1O4HA 2DLZA 4F5BA 2C9WA 5HKWA 1X27A 1SHAA 1F1WA 2EU0A 1D1ZA 3CXLA 1RQQC 1OPKA 1K9AA 1CSYA 3OB1B 5EG3B 3S8OA 2PLEA 1KA6A 2HCKA 1JYRA 3TKZA 2LNXA 1D4TA 1LUNA 1BHFA 1SPSA 1BFIA 4OHIA 2FCIA 1O43A 1JYUA 3GXXA 1NRVA 5EELA 4NWFA 5I6VA 2C0OA 1Z3KA 3VRPA 3CBLA 1O42A 4GWFA 2RORA 2CIAA 4JE4A 3PS5A 1O4AA 2IUIA 2H46E 3IN7A 4DGXA 1JWOA 2KK6A 3N7YA 5AULA 2L4KA 3VS7A 4OHLA 2OZOA 1O4BA 3PSKA 1OO3A 2EL8A 1M61A 2LQWA 1O4IA 4TZIA 1QADA 1A08A 2MC1A 5IBMA 4H1OA 3VS5A 2EYVA 3PLFB 1ZFPE 1Y57A 2PNBA 3NHNA 4L1BB 3VS3A 4M4ZA 2PNAA 1UUSA 3OVEA 2C0TA 1CSZA 5AXIA 1FBVA 3CWGA 2ECDA 2MRJA 3S9KA 3UYOA 4GL9E 1O45A 4OHDA 2MQIA 3S8NA 3BUOB 1GHUA 1O44A 5CDWA 1FYRA 2JYQA 1O4NA 3VRZA 4FL3A 1I3ZA 1KC2A 2CI9A 3K2MA 3PJPA 4DGPA 2CRHA 4QSYA 5GJHA 1BLKA 5HKYA 2KNOA 3OP0A 3TL0A 2IZVA 3KFJA 1O49A 2K79B 3EACA 1D4WA 2RVFA 1BG1A 2GE9A 3BUMB 1M27A 3BUNB 2DCRA 1AOUF 1O4OA 2EOBA 2MRKA 4K44A 1AYDA 1R1SA 5DF6A 2IUGA 3BUXB 1PICA 4H34A 2OQ1A 1AYAA 5IBSA 1WQUA 3VRRA 3CD3A 1FMKA 5DC4A 4D8KA 5DC9A 1X0NA 1CJ1A 1BKLA 1KSWA 2DX0A 2EO3A 1O4LA 3HIZB 3S8LA 1SPRA 2EO6A 1AB2A 5GJIA 2Y1MA 5EHPA 1O4RA 2EKXA 4OHEA 3PQZA 3GQIB 1MW4A 1LKLA 1LUKA 2XP1A 3MXYA 2VIFA 1FU5A 2Y3AB 1A1AA 1CWDL 4XZ0A 2DM0A 4LUDA 3IMJA 5J3XA 3C7IA 1A09A 2LNWA 4K45A 2YSXA 1HCSB 4LUEA 2HMHA 3VS4A 1BLJA 3BKBA 4XZ1A 2H8HA 1NZVA 2MK2A 3VGOA 5DC0B 4F5AA 4E68A 1IJRA 1BF5A 4NWGA 5D0JA 3VS6A 1BFJA 1CWEA 1JYQA 1R1QA 2DLYA 1O4KA 1O41A 1KA7A 1JU5A 3QWYA 1FHSA 1QG1E 1AYBA 4WWQA 1AYCA 1O4CA 5EHRA 1A1EA 2CI8A 2AUGA 1P13A 2AOAA 3N8MA 1BM2A 1A81A 4GPLB 1BHHA 4U1PA 2EYZA 1F2FA 1BMBA 2LCTA 2ABLA 3VS2A 3VROA 1TZEE 3PFVA 1HCTB 2ETZA 1O4QA 4X6SA 1LUMA 1SKJA 1NZLA 2SRCA 3HCKA 1QCFA 1UURA 1MILA 1OPLA 1IS0A 2IUHA 2C0IA 3VS0A 3VRYA 1YVLA 1RPYA 1A1BA 1BKMA 4K2RA 4U17A 1O46A 3IN8A 1O4EA 1LCKA 1O4GA 1SHDA 3HHMB 4A4CA 1XA6A 1X6CA 4ROJA 2L3TA 1O4PA 2CBLA 5HKZA 1A1CA 1O4FA 1AD5A 3BUWB 1O4MA 3VS1A 2FO0A 3M7FA 1FU6A 3QWXX 2PLDA 2RSYA 1O48A 2L6KA 2PTKA 5EEQA 1GRIA 3PSJA 1FBZA 4FBNA 2SHPA 2QMSA 1G83A 4OHHA 3ZNIA 3MXCA 1Y1UA 2HUWA 1OO4A 1RJAA 1R1PA 2AOBA 3EAZA 3VRNA 4K11A 2K7AB 1TCEA 4A4BA 2GSBA 4JGHA 2CS0A 3GXWA 4E93A 4EIHA 1H9OA 3IMDA 3MAZA 1A07A 2CR4A 2LQNA 3OB2B 5BO4A 4FL2A 1O4DA 2DVJA 2HDVA 1BHHB 3WA4A 4F59A 4EY0A 1LUIA 1AOTF 2RMXA 1B47A 3UF4A 4JEGA 1O47A 4P9ZA 2HDXA 3VRQA 1O4JA 1SHBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3T04 A;  3US4 A;  2EYY A;  3N84 A;  1LKK A;  5KAZ A;  1YVH A;  1LCJ A;  2Y1N A;  2BBU A;  2H5K A;  2B3O A;  2YU7 A;  4P9V A;  3OV1 A;  1O4H A;  2DLZ A;  4F5B A;  2C9W A;  5HKW A;  1X27 A;  1SHA A;  1F1W A;  2EU0 A;  1D1Z A;  3CXL A;  1RQQ C;  1OPK A;  1K9A A;  1CSY A;  3OB1 B;  5EG3 B;  3S8O A;  2PLE A;  1KA6 A;  2HCK A;  1JYR A;  3TKZ A;  2LNX A;  1D4T A;  1LUN A;  1BHF A;  1SPS A;  1BFI A;  4OHI A;  2FCI A;  1O43 A;  1JYU A;  3GXX A;  1NRV A;  5EEL A;  4NWF A;  5I6V A;  2C0O A;  1Z3K A;  3VRP A;  3CBL A;  1O42 A;  4GWF A;  2ROR A;  2CIA A;  4JE4 A;  3PS5 A;  1O4A A;  2IUI A;  2H46 E;  3IN7 A;  4DGX A;  1JWO A;  2KK6 A;  3N7Y A;  5AUL A;  2L4K A;  3VS7 A;  4OHL A;  2OZO A;  1O4B A;  3PSK A;  1OO3 A;  2EL8 A;  1M61 A;  2LQW A;  1O4I A;  4TZI A;  1QAD A;  1A08 A;  2MC1 A;  5IBM A;  4H1O A;  3VS5 A;  2EYV A;  3PLF B;  1ZFP E;  1Y57 A;  2PNB A;  3NHN A;  4L1B B;  3VS3 A;  4M4Z A;  2PNA A;  1UUS A;  3OVE A;  2C0T A;  1CSZ A;  5AXI A;  1FBV A;  3CWG A;  2ECD A;  2MRJ A;  3S9K A;  3UYO A;  4GL9 E;  1O45 A;  4OHD A;  2MQI A;  3S8N A;  3BUO B;  1GHU A;  1O44 A;  5CDW A;  1FYR A;  2JYQ A;  1O4N A;  3VRZ A;  4FL3 A;  1I3Z A;  1KC2 A;  2CI9 A;  3K2M A;  3PJP A;  4DGP A;  2CRH A;  4QSY A;  5GJH A;  1BLK A;  5HKY A;  2KNO A;  3OP0 A;  3TL0 A;  2IZV A;  3KFJ A;  1O49 A;  2K79 B;  3EAC A;  1D4W A;  2RVF A;  1BG1 A;  2GE9 A;  3BUM B;  1M27 A;  3BUN B;  2DCR A;  1AOU F;  1O4O A;  2EOB A;  2MRK A;  4K44 A;  1AYD A;  1R1S A;  5DF6 A;  2IUG A;  3BUX B;  1PIC A;  4H34 A;  2OQ1 A;  1AYA A;  5IBS A;  1WQU A;  3VRR A;  3CD3 A;  1FMK A;  5DC4 A;  4D8K A;  5DC9 A;  1X0N A;  1CJ1 A;  1BKL A;  1KSW A;  2DX0 A;  2EO3 A;  1O4L A;  3HIZ B;  3S8L A;  1SPR A;  2EO6 A;  1AB2 A;  5GJI A;  2Y1M A;  5EHP A;  1O4R A;  2EKX A;  4OHE A;  3PQZ A;  3GQI B;  1MW4 A;  1LKL A;  1LUK A;  2XP1 A;  3MXY A;  2VIF A;  1FU5 A;  2Y3A B;  1A1A A;  1CWD L;  4XZ0 A;  2DM0 A;  4LUD A;  3IMJ A;  5J3X A;  3C7I A;  1A09 A;  2LNW A;  4K45 A;  2YSX A;  1HCS B;  4LUE A;  2HMH A;  3VS4 A;  1BLJ A;  3BKB A;  4XZ1 A;  2H8H A;  1NZV A;  2MK2 A;  3VGO A;  5DC0 B;  4F5A A;  4E68 A;  1IJR A;  1BF5 A;  4NWG A;  5D0J A;  3VS6 A;  1BFJ A;  1CWE A;  1JYQ A;  1R1Q A;  2DLY A;  1O4K A;  1O41 A;  1KA7 A;  1JU5 A;  3QWY A;  1FHS A;  1QG1 E;  1AYB A;  4WWQ A;  1AYC A;  1O4C A;  5EHR A;  1A1E A;  2CI8 A;  2AUG A;  1P13 A;  2AOA A;  3N8M A;  1BM2 A;  1A81 A;  4GPL B;  1BHH A;  4U1P A;  2EYZ A;  1F2F A;  1BMB A;  2LCT A;  2ABL A;  3VS2 A;  3VRO A;  1TZE E;  3PFV A;  1HCT B;  2ETZ A;  1O4Q A;  4X6S A;  1LUM A;  1SKJ A;  1NZL A;  2SRC A;  3HCK A;  1QCF A;  1UUR A;  1MIL A;  1OPL A;  1IS0 A;  2IUH A;  2C0I A;  3VS0 A;  3VRY A;  1YVL A;  1RPY A;  1A1B A;  1BKM A;  4K2R A;  4U17 A;  1O46 A;  3IN8 A;  1O4E A;  1LCK A;  1O4G A;  1SHD A;  3HHM B;  4A4C A;  1XA6 A;  1X6C A;  4ROJ A;  2L3T A;  1O4P A;  2CBL A;  5HKZ A;  1A1C A;  1O4F A;  1AD5 A;  3BUW B;  1O4M A;  3VS1 A;  2FO0 A;  3M7F A;  1FU6 A;  3QWX X;  2PLD A;  2RSY A;  1O48 A;  2L6K A;  2PTK A;  5EEQ A;  1GRI A;  3PSJ A;  1FBZ A;  4FBN A;  2SHP A;  2QMS A;  1G83 A;  4OHH A;  3ZNI A;  3MXC A;  1Y1U A;  2HUW A;  1OO4 A;  1RJA A;  1R1P A;  2AOB A;  3EAZ A;  3VRN A;  4K11 A;  2K7A B;  1TCE A;  4A4B A;  2GSB A;  4JGH A;  2CS0 A;  3GXW A;  4E93 A;  4EIH A;  1H9O A;  3IMD A;  3MAZ A;  1A07 A;  2CR4 A;  2LQN A;  3OB2 B;  5BO4 A;  4FL2 A;  1O4D A;  2DVJ A;  2HDV A;  1BHH B;  3WA4 A;  4F59 A;  4EY0 A;  1LUI A;  1AOT F;  2RMX A;  1B47 A;  3UF4 A;  4JEG A;  1O47 A;  4P9Z A;  2HDX A;  3VRQ A;  1O4J A;  1SHB A; 
#chains in the Genus database with same CATH topology
 3T04 A;  3US4 A;  2EYY A;  3N84 A;  1LKK A;  5KAZ A;  1YVH A;  1LCJ A;  2Y1N A;  2BBU A;  2H5K A;  2B3O A;  2YU7 A;  4P9V A;  3OV1 A;  1O4H A;  2DLZ A;  4F5B A;  2C9W A;  5HKW A;  1X27 A;  1SHA A;  1F1W A;  2EU0 A;  1D1Z A;  3CXL A;  1RQQ C;  1OPK A;  1K9A A;  1CSY A;  3OB1 B;  5EG3 B;  3S8O A;  2PLE A;  1KA6 A;  2KGY A;  2HCK A;  1JYR A;  3TKZ A;  2LNX A;  1D4T A;  1LUN A;  1BHF A;  1SPS A;  1BFI A;  4OHI A;  2FCI A;  1O43 A;  1JYU A;  3GXX A;  1NRV A;  5EEL A;  4NWF A;  5I6V A;  2C0O A;  1Z3K A;  3VRP A;  3CBL A;  1O42 A;  4GWF A;  2ROR A;  2CIA A;  4JE4 A;  3PS5 A;  1O4A A;  2IUI A;  2H46 E;  3IN7 A;  4DGX A;  1JWO A;  2KK6 A;  3N7Y A;  5AUL A;  2L4K A;  3VS7 A;  4OHL A;  2OZO A;  1O4B A;  3PSK A;  1OO3 A;  2EL8 A;  1M61 A;  2LQW A;  1O4I A;  4TZI A;  1QAD A;  1A08 A;  2MC1 A;  5IBM A;  4H1O A;  3VS5 A;  2EYV A;  3PLF B;  1ZFP E;  1Y57 A;  2PNB A;  3NHN A;  4L1B B;  3VS3 A;  4M4Z A;  2PNA A;  1UUS A;  3OVE A;  2C0T A;  1CSZ A;  5AXI A;  1FBV A;  3CWG A;  2ECD A;  2MRJ A;  3S9K A;  3UYO A;  4GL9 E;  1O45 A;  4OHD A;  2MQI A;  3S8N A;  3BUO B;  1GHU A;  1O44 A;  5CDW A;  1FYR A;  2JYQ A;  1O4N A;  3VRZ A;  4FL3 A;  1I3Z A;  1KC2 A;  2CI9 A;  3K2M A;  3PJP A;  4DGP A;  2CRH A;  4QSY A;  5GJH A;  1BLK A;  5HKY A;  2KNO A;  3OP0 A;  3TL0 A;  2IZV A;  3KFJ A;  1O49 A;  2K79 B;  3EAC A;  1D4W A;  2RVF A;  1BG1 A;  2GE9 A;  3BUM B;  1M27 A;  3BUN B;  2DCR A;  1AOU F;  1O4O A;  2EOB A;  2MRK A;  4K44 A;  1AYD A;  1R1S A;  5DF6 A;  2IUG A;  3BUX B;  1PIC A;  4H34 A;  2OQ1 A;  1AYA A;  5IBS A;  1WQU A;  3VRR A;  3CD3 A;  1FMK A;  5DC4 A;  4D8K A;  5DC9 A;  1X0N A;  1CJ1 A;  1BKL A;  1KSW A;  2DX0 A;  2EO3 A;  1O4L A;  3HIZ B;  3S8L A;  1SPR A;  2EO6 A;  1AB2 A;  5GJI A;  2Y1M A;  5EHP A;  1O4R A;  2EKX A;  4OHE A;  3PQZ A;  3GQI B;  1MW4 A;  1LKL A;  1LUK A;  2XP1 A;  3MXY A;  2VIF A;  1FU5 A;  2Y3A B;  1A1A A;  1CWD L;  4XZ0 A;  2DM0 A;  4LUD A;  3IMJ A;  5J3X A;  3C7I A;  1A09 A;  2LNW A;  4K45 A;  2YSX A;  1HCS B;  4LUE A;  2HMH A;  3VS4 A;  1BLJ A;  3BKB A;  4XZ1 A;  2H8H A;  1NZV A;  2MK2 A;  3VGO A;  5DC0 B;  4F5A A;  4E68 A;  1IJR A;  1BF5 A;  4NWG A;  5D0J A;  3VS6 A;  1BFJ A;  1CWE A;  1JYQ A;  1R1Q A;  2DLY A;  1O4K A;  1O41 A;  1KA7 A;  1JU5 A;  3QWY A;  1FHS A;  1QG1 E;  1AYB A;  4WWQ A;  1AYC A;  1O4C A;  5EHR A;  1A1E A;  2CI8 A;  2AUG A;  1P13 A;  2AOA A;  3N8M A;  1BM2 A;  1A81 A;  4GPL B;  1BHH A;  4U1P A;  2EYZ A;  1F2F A;  1BMB A;  2LCT A;  2ABL A;  3VS2 A;  3VRO A;  1TZE E;  3PFV A;  1HCT B;  2ETZ A;  1O4Q A;  4X6S A;  1LUM A;  1SKJ A;  1NZL A;  2SRC A;  3HCK A;  1QCF A;  1UUR A;  1MIL A;  1OPL A;  1IS0 A;  2IUH A;  2C0I A;  3VS0 A;  3VRY A;  1YVL A;  1RPY A;  1A1B A;  1BKM A;  4K2R A;  4U17 A;  1O46 A;  3IN8 A;  1O4E A;  1LCK A;  1O4G A;  1SHD A;  3HHM B;  4A4C A;  1XA6 A;  3K2T A;  1X6C A;  4ROJ A;  2L3T A;  1O4P A;  2CBL A;  5HKZ A;  2LRA A;  1A1C A;  1O4F A;  1AD5 A;  3BUW B;  1O4M A;  3VS1 A;  2FO0 A;  3M7F A;  1FU6 A;  3QWX X;  2PLD A;  2RSY A;  1O48 A;  2L6K A;  2PTK A;  5EEQ A;  1GRI A;  3PSJ A;  1FBZ A;  4FBN A;  2SHP A;  2QMS A;  1G83 A;  4OHH A;  3ZNI A;  3MXC A;  1Y1U A;  2HUW A;  1OO4 A;  1RJA A;  1R1P A;  2AOB A;  3EAZ A;  3VRN A;  4K11 A;  2K7A B;  1TCE A;  4A4B A;  2GSB A;  4JGH A;  2CS0 A;  3GXW A;  4E93 A;  4EIH A;  1H9O A;  3IMD A;  3MAZ A;  1A07 A;  2CR4 A;  2LQN A;  3OB2 B;  5BO4 A;  4FL2 A;  1O4D A;  2DVJ A;  2HDV A;  1BHH B;  3WA4 A;  4F59 A;  4EY0 A;  1LUI A;  1AOT F;  2RMX A;  1B47 A;  3UF4 A;  4JEG A;  1O47 A;  4P9Z A;  2HDX A;  3VRQ A;  3LYV A;  1O4J A;  1SHB A; 
#chains in the Genus database with same CATH homology
 3T04 A;  3US4 A;  2EYY A;  3N84 A;  1LKK A;  5KAZ A;  1YVH A;  1LCJ A;  2Y1N A;  2BBU A;  2H5K A;  2B3O A;  2YU7 A;  4P9V A;  3OV1 A;  1O4H A;  2DLZ A;  4F5B A;  2C9W A;  5HKW A;  1X27 A;  1SHA A;  1F1W A;  2EU0 A;  1D1Z A;  3CXL A;  1RQQ C;  1OPK A;  1K9A A;  1CSY A;  3OB1 B;  5EG3 B;  3S8O A;  2PLE A;  1KA6 A;  2HCK A;  1JYR A;  3TKZ A;  2LNX A;  1D4T A;  1LUN A;  1BHF A;  1SPS A;  1BFI A;  4OHI A;  2FCI A;  1O43 A;  1JYU A;  3GXX A;  1NRV A;  5EEL A;  4NWF A;  5I6V A;  2C0O A;  1Z3K A;  3VRP A;  3CBL A;  1O42 A;  4GWF A;  2ROR A;  2CIA A;  4JE4 A;  3PS5 A;  1O4A A;  2IUI A;  2H46 E;  3IN7 A;  4DGX A;  1JWO A;  2KK6 A;  3N7Y A;  5AUL A;  2L4K A;  3VS7 A;  4OHL A;  2OZO A;  1O4B A;  3PSK A;  1OO3 A;  2EL8 A;  1M61 A;  2LQW A;  1O4I A;  4TZI A;  1QAD A;  1A08 A;  2MC1 A;  5IBM A;  4H1O A;  3VS5 A;  2EYV A;  3PLF B;  1ZFP E;  1Y57 A;  2PNB A;  3NHN A;  4L1B B;  3VS3 A;  4M4Z A;  2PNA A;  1UUS A;  3OVE A;  2C0T A;  1CSZ A;  5AXI A;  1FBV A;  3CWG A;  2ECD A;  2MRJ A;  3S9K A;  3UYO A;  4GL9 E;  1O45 A;  4OHD A;  2MQI A;  3S8N A;  3BUO B;  1GHU A;  1O44 A;  5CDW A;  1FYR A;  2JYQ A;  1O4N A;  3VRZ A;  4FL3 A;  1I3Z A;  1KC2 A;  2CI9 A;  3K2M A;  3PJP A;  4DGP A;  2CRH A;  4QSY A;  5GJH A;  1BLK A;  5HKY A;  2KNO A;  3OP0 A;  3TL0 A;  2IZV A;  3KFJ A;  1O49 A;  2K79 B;  3EAC A;  1D4W A;  2RVF A;  1BG1 A;  2GE9 A;  3BUM B;  1M27 A;  3BUN B;  2DCR A;  1AOU F;  1O4O A;  2EOB A;  2MRK A;  4K44 A;  1AYD A;  1R1S A;  5DF6 A;  2IUG A;  3BUX B;  1PIC A;  4H34 A;  2OQ1 A;  1AYA A;  5IBS A;  1WQU A;  3VRR A;  3CD3 A;  1FMK A;  5DC4 A;  4D8K A;  5DC9 A;  1X0N A;  1CJ1 A;  1BKL A;  1KSW A;  2DX0 A;  2EO3 A;  1O4L A;  3HIZ B;  3S8L A;  1SPR A;  2EO6 A;  1AB2 A;  5GJI A;  2Y1M A;  5EHP A;  1O4R A;  2EKX A;  4OHE A;  3PQZ A;  3GQI B;  1MW4 A;  1LKL A;  1LUK A;  2XP1 A;  3MXY A;  2VIF A;  1FU5 A;  2Y3A B;  1A1A A;  1CWD L;  4XZ0 A;  2DM0 A;  4LUD A;  3IMJ A;  5J3X A;  3C7I A;  1A09 A;  2LNW A;  4K45 A;  2YSX A;  1HCS B;  4LUE A;  2HMH A;  3VS4 A;  1BLJ A;  3BKB A;  4XZ1 A;  2H8H A;  1NZV A;  2MK2 A;  3VGO A;  5DC0 B;  4F5A A;  4E68 A;  1IJR A;  1BF5 A;  4NWG A;  5D0J A;  3VS6 A;  1BFJ A;  1CWE A;  1JYQ A;  1R1Q A;  2DLY A;  1O4K A;  1O41 A;  1KA7 A;  1JU5 A;  3QWY A;  1FHS A;  1QG1 E;  1AYB A;  4WWQ A;  1AYC A;  1O4C A;  5EHR A;  1A1E A;  2CI8 A;  2AUG A;  1P13 A;  2AOA A;  3N8M A;  1BM2 A;  1A81 A;  4GPL B;  1BHH A;  4U1P A;  2EYZ A;  1F2F A;  1BMB A;  2LCT A;  2ABL A;  3VS2 A;  3VRO A;  1TZE E;  3PFV A;  1HCT B;  2ETZ A;  1O4Q A;  4X6S A;  1LUM A;  1SKJ A;  1NZL A;  2SRC A;  3HCK A;  1QCF A;  1UUR A;  1MIL A;  1OPL A;  1IS0 A;  2IUH A;  2C0I A;  3VS0 A;  3VRY A;  1YVL A;  1RPY A;  1A1B A;  1BKM A;  4K2R A;  4U17 A;  1O46 A;  3IN8 A;  1O4E A;  1LCK A;  1O4G A;  1SHD A;  3HHM B;  4A4C A;  1XA6 A;  1X6C A;  4ROJ A;  2L3T A;  1O4P A;  2CBL A;  5HKZ A;  1A1C A;  1O4F A;  1AD5 A;  3BUW B;  1O4M A;  3VS1 A;  2FO0 A;  3M7F A;  1FU6 A;  3QWX X;  2PLD A;  2RSY A;  1O48 A;  2L6K A;  2PTK A;  5EEQ A;  1GRI A;  3PSJ A;  1FBZ A;  4FBN A;  2SHP A;  2QMS A;  1G83 A;  4OHH A;  3ZNI A;  3MXC A;  1Y1U A;  2HUW A;  1OO4 A;  1RJA A;  1R1P A;  2AOB A;  3EAZ A;  3VRN A;  4K11 A;  2K7A B;  1TCE A;  4A4B A;  2GSB A;  4JGH A;  2CS0 A;  3GXW A;  4E93 A;  4EIH A;  1H9O A;  3IMD A;  3MAZ A;  1A07 A;  2CR4 A;  2LQN A;  3OB2 B;  5BO4 A;  4FL2 A;  1O4D A;  2DVJ A;  2HDV A;  1BHH B;  3WA4 A;  4F59 A;  4EY0 A;  1LUI A;  1AOT F;  2RMX A;  1B47 A;  3UF4 A;  4JEG A;  1O47 A;  4P9Z A;  2HDX A;  3VRQ A;  1O4J A;  1SHB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...