3NHNA

Crystal structure of the src-family kinase hck sh3-sh2-linker regulatory region
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
163
structure length
163
Chain Sequence
DIIVVALYDYEAIHHEDLSFQKGDQMVVLEESGEWWKARSLATRKEGYIPSNYVARVDSLETEEWFFKGISRKDAERQLLAPGNMLGSFMIRDSETTKGSYSLSVRDYDPRQGDTVKHYKIRTLDNGGFYISPRSTFSTLQELVDHYKKGNDGLCQKLSVPCM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Tyrosine-protein kinase HCK
publication title Crystal Structure of the Src Family Kinase Hck SH3-SH2 Linker Regulatory Region Supports an SH3-dominant Activation Mechanism.
pubmed doi rcsb
source organism Homo sapiens
total genus 31
structure length 163
sequence length 163
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2010-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00017 SH2 SH2 domain
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 3nhnA01
3.30.505.10 Alpha Beta 2-Layer Sandwich SHC Adaptor Protein SH2 domain 3nhnA02
2MRJA 2GNCA 5EHRA 1T0HA 3UA7A 2K3BA 1FHSA 4ZNXA 1ZSGA 4NWGA 3CBLA 2Y3AB 3MXYA 2BZ8A 2JYQA 2CDTA 2EGAA 2DLPA 2HBWA 1X69A 1O43A 2DM1A 3PVQA 4J9FA 1SSHA 2JW4A 2EVRA 3PSJA 4DGXA 1XA6A 5KAZA 1H9OA 3UA6A 2DL7A 4J9CA 1RQQC 3PVLA 3VROA 2KE9A 3LH5A 3EG1A 2MQIA 4FL2A 2DL5A 4J9GA 5AXIA 2BZYA 3WA4A 2CIAA 4LNPA 2A37A 3PFVA 1JEGA 5D0JA 4OMPA 4HVWA 1LUMA 2JTEA 4LE9A 2YSQA 1F1WA 1BLKA 1RLQC 4DEXA 3BUXB 4M4ZA 4F17A 4Y92A 2CUBA 1E6HA 1SHBA 1SHDA 3BKBA 1CSKA 2JS0A 2L3PA 2CH4A 2CSQA 1O4JA 3GXXA 1BLJA 5IH2A 2M51A 1UTIA 1UDLA 1H92A 1Z3KA 1O49A 2FPEA 4AG1C 4OHEA 5EG3B 2KRMA 1NZVA 1X6CA 3OVEA 3EG2A 2AKLA 4E68A 1JO8A 5L23A 1ZUYA 2ESWA 2JM9A 2OJ2A 1AOTF 1SHAA 2D1XA 1R1PA 1YVLA 1UURA 1CWEA 1O44A 3BUOB 4U17A 3OB2B 4HVVA 2KR3A 1BKMA 3THKA 3S9KA 2EQIA 2HCKA 1W1FA 1NZLA 1YCSB 2C0TA 1O4EA 3FJ5A 1ABOA 1D1ZA 1BBZA 1JWOA 3M0QA 2AOBA 2RORA 1E6GA 1K1ZA 3EAZA 4JE4A 1AB2A 1YWPA 2EO6A 2F2VA 1A08A 3VGOA 2AK5A 3PS5A 1PKSA 1D4TA 4L1BB 3PE0A 2DNUA 4IIOA 4R0KA 3BUNB 1X2QA 3M7FA 3TL0A 3VS2A 2CRHA 1AOJA 2DF6A 4JPBW 1V1CA 4EIKA 2FRWA 1CKBA 1A0NB 2CREA 2JXBA 1SKJA 4AFQC 2IUIA 1I1JA 1BHFA 4J9BA 4J9HA 1FU5A 3VRPA 1ARKA 1UHCA 5IHIA 1O4DA 2EYVA 2DILA 2LJ3A 2L0AA 3HIZB 4H1OA 5IBMA 1BM2A 2DYBA 4X6SA 4J9DA 4TZIA 1BB9A 2FPDA 4FSSA 4OHIA 2YUOA 1SRMA 2C9WA 5BO4A 2O9VA 1NLPC 2IUHA 4OMOA 3REBB 1X2KA 1O4AA 2DRMA 4IIMA 1PRLC 2LCSA 1G83A 4HXJA 3VS5A 1M27C 3RBBB 1CWDL 1UUSA 2EL8A 2LNWA 5HKZA 1M30A 1Z9QA 2DBKA 1WYXA 5FWCA 4HVUA 3UF4A 1PKTA 4ORZA 1ABQA 1AD5A 1CJ1A 1O4IA 3NGPA 4Z89A 3M0UA 1M27A 2JS2A 1ZFPE 3I5RA 3VS0A 1MUZA 4AG2C 2KGTA 3PSKA 2KXDA 1OO3A 3TSWA 3IMJA 2J6KA 1UE9A 1NG2A 2D8HA 1QWFA 2IZVA 5DF6A 5GJVB 4CC2A 2LJ0A 1NYFA 4AFZC 1FYRA 1O45A 2W10A 1KA7A 1O46A 2FCIA 2XMFA 2DBMA 4F5BA 3SEMA 2O2OA 2OQ1A 1X27A 1IJRA 2A08A 1WIEA 1H3HA 2Y1NA 2EPDA 3IMDA 3NMZC 1MW4A 2LMJA 4K11A 1VA7A 2KXCA 4XZ0A 2D8JA 4RTXA 3UATA 3EHQA 1IS0A 2RQRA 2X3WD 1RJAA 3VS3A 1KFZA 2DX0A 1Y57A 4EIHA 1YN8A 2L2PA 2L3QA 2LCTA 1M3BA 1LKLA 4OMQA 4RTVA 2QMSA 1ZUKA 2VIFA 5FWBA 2MOXA 1AZGB 1SPRA 4FL3A 1X0NA 4LUEA 1O4KA 1B3QA 1ZUUA 2LQWA 2KEAA 1FMKA 3QWXX 1Z9ZA 1O4RA 2HDAA 2HDVA 1QADA 3TKZA 3M0SA 2HSPA 1HSQA 4JJBA 4JZ3A 3TSZA 1WQUA 2EGEA 2GTOA 2YDLA 2X3XD 2EYWA 5IHKA 1LCJA 2H8HA 1HCSB 3VRYA 1LKKA 3VRQA 1X6BA 1FU6A 4GL9E 4Z88A 1O4LA 1U06A 4K45A 2KRSA 1AYAA 2MC1A 2YUQA 1GBRA 4CC3A 4HCKA 2PLDA 4FBNA 1OPKA 2DE0X 3MAZA 1BU1A 4F59A 1YNZA 4OMNA 1A1CA 1R1SA 1I07A 1WA7A 1MV3A 2KYMA 1HD3A 1O42A 2FRYA 3EACA 1LUKA 2EGCA 1D4WA 2GBQA 2KNOA 4RTZA 4A4BA 1JYQA 4J9EA 3NHNA 3GXWA 2ABLA 1W70A 4P9VA 4DEYA 2PTKA 2DL3A 3US4A 1T3LA 1FBZA 4WWQA 1ZLMA 1FYNA 4JZ4A 1WFWA 2DLZA 5IXFA 3TVTA 2J05A 1WDXA 1MV0B 5IXBA 1MILA 4CC7A 3PQZA 1RLPC 1BFJA 4JEGA 3H0HA 1AVZC 1OPLA 2RF0A 1O4FA 2O88A 2YT6A 1TZEE 2DM0A 3IN7A 1O41A 4Z8AA 1NEBA 3A98A 1J3TA 2RQTA 3C7IA 2MIOA 2B86A 2GTJA 1YWOA 1SPSA 2VWFA 1N5ZA 1UG1A 4JJDA 1GBQA 3QWYA 1UJ0A 4QT7A 3S8NA 1X43A 4DGPA 2FEIA 2H46E 3S8OA 1QG1E 1GFDA 2K79A 3ZL7C 2DMOA 4A63B 1O4PA 1K4US 2KROA 2M0YA 1O4BA 2L4KA 4P9ZA 2GE9A 5HKYA 1P13A 1M8MA 2EYYA 3OV1A 1JQQA 1JU5C 2GGRA 1U5SA 2J7IA 1YVHA 4H34A 2MK2A 3CD3A 2CS0A 2PNAA 2DL8A 2EYXA 1A07A 4F5AA 3EGUA 4OMMA 1HCTB 5GJWB 4X1VA 3H0IA 1K9AA 1CSZA 1PHTA 1TG0A 1JU5A 1M61A 1AYDA 1M3AA 2KRNA 1XOVA 3H0FA 4KRTA 4ESRA 3CQTA 1E7OA 1IO6A 1O4OA 2IUGA 2LNXA 2J06A 2BTTA 4AFUC 5EELA 1KC2A 3I5SA 2AZVA 1BHHA 3O5ZA 5IBSA 2W0ZA 3EG0A 1BF5A 2CUDA 4GLMA 2ETZA 3VS6A 2K6DA 1O47A 1UFFA 1HJDA 3N8MA 2KNBB 2YUNA 5EHPA 1NRVA 1Y1UA 1QWEA 2PZ1A 2RQVA 3BUMB 4F14A 1W6XA 2YU7A 2D0NA 3UYOA 1AOUF 1G2BA 1K76A 4GWFA 4GBQA 2K2MA 2OAWA 2FG0A 2J6FA 2LQNA 1F2FA 1FBVA 3MXCA 2DX1A 1UGVA 1JXMA 1A81A 2QDLA 4K2RA 1CKAA 1O4NA 4JJCA 4NWFA 5I6VA 3VS7A 3CXLA 1GRIA 2ECZA 3EG3A 2YUPA 1GL5A 4OHDA 3PJPA 2AOAA 2HDXA 2F2WA 2FPFA 1AEYA 2DCRA 2KYBA 4D8DA 2DL4A 1VYVA 3K2MA 2LNHB 2LP5A 1TCEA 1NLOC 2P4RA 3HCKA 2L3SA 2K7AA 1A1BA 4RTTA 1GCQC 1AZEA 1SPKA 2LZ6B 3HHMB 1AWXA 3M0RA 2GSBA 2RMXA 1JYUA 2EKHA 1GHUA 2SEMA 1VYUA 2PNIA 2RMOA 3H41A 1AWWA 2PNBA 5HCKA 2ED0A 1GCQA 3OP0A 3REAB 3I35A 4D8KA 1CSYA 4E6RA 5IHNA 2MRKA 2O31A 2CSIA 2RNAA 2K9GA 5ECAA 2EOBA 3ULRB 2EW3A 3NPFA 1B07A 1OV3A 1BMBA 2IIMA 2NWMA 4RTUA 2K79B 1M3CA 2CR4A 3T04A 2XP1A 2EO3A 2DJQA 1NM7A 2AZSA 2ROLA 2JM8A 2DRKA 1KSWA 2CI9A 1U3OA 1LUNA 4U1PA 2EYZA 2LJ1A 1SRLA 3SHWA 2PLEA 2V1RA 3IN8A 2MCNA 2FO0A 1ZBJA 1O4QA 2L6KA 2KK6A 2RN8A 1WX6A 1GCPA 2J6OA 3PLFB 1AWJA 1WXTA 2YSXA 1SHGA 1UECA 2CT3A 1PNJA 2A28A 1WXBA 2LX7A 2C0IA 2BZXA 1T0JA 5J3XA 1RUWA 2SRCA 2ROTA 2ECDA 4OHHA 2B3OA 1JYRA 2DA9A 2JMCA 1BHHB 2C0OA 3KFVA 1NEGA 1GFCA 1BKLA 2BBUA 1O48A 2O9SA 2CT4A 2E5KA 2SHPA 3C0CA 1A09A 5DC4A 1T3SA 4K44A 1A1AA 2RQWA 2AUGA 1JXOA 1AWOA 1KJWA 4E93A 3OB1B 1QLYA 1PRMC 1UJYA 3U23A 1AYBA 1ZX6A 2KT8A 2RVFA 1OEBA 2Y1MA 3EHRA 3S8LA 1LCKA 4EY0A 2OZOA 2EKXA 5DC9A 3JV3A 4CC4B 2VKNA 2CI8A 3RNJA 3I9QA 1O4GA 1UHFA 3KFJA 5EEQA 1UUEA 1NYGA 1A1EA 1X6GA 1RPYA 2HMHA 2AKKA 4J9IA 5GJIA 1K0XA 1BG1A 2RQUA 1I0CA 1VYTA 3VS4A 4RTWA 1K0SA 4JGHA 3VRRA 5I11A 1O4HA 1AYCA 1PWTA 2G6FX 1R1QA 5HKWA 4A4CA 2F2XA 1YP5A 1EFNA 1QKXA 2OI3A 4QSYA 1H8KA 1Y0MA 3M0TA 3GBQA 4WCIA 1BK2A 4OMLA 1SEMA 3VS1A 1KIKA 1WLPB 2ED1A 3VRNA 4ROJA 4LUDA 2K7AB 2I0NA 4AFSC 2EU0A 1PICA 2GQIA 5FW9A 2KT1A 3M0PA 1O4CA 4OHLA 2DVJA 3R6NA 2DLYA 2V1QA 2HUWA 2ENMA 1S1NA 5EC7A 2L3TA 2HEQA 1LUIA 1TUDA 2VVKA 5I22A 2CBLA 5AULA 2NUZA 1QKWA 1WI7A 4GPLB 4F16A 2EBPA 2JMAA 2JT4A 3BUWB 1O4MA 2H5KA 3N84A 4RTYA 1QCFA 1RI9A 2RSYA 3IQLA 4RUGA 3GQIB 5GJHA 1OOTA 4XZ1A 2CH4W 1WXUA 5DC0B 3VRZA 3ZNIA 1I3ZA 2RPNA 3CWGA 3N7YA 2A36A 1B47A 1TUCA 2KBTA 1BFIA 1KA6A 1OO4A 1SHFA 4LN2A 5CDWA
chains in the Genus database with same CATH superfamily
1OI1A 2MRJA 3WVDB 2A7YA 2EJFA 4QVCA 2K3BA 4ZNXA 2MWPA 3VJPA 3MXYA 3G71T 2EIFA 3ME9A 2R5AA 1O43A 3PVQA 2JW4A 3I56A 1VQKT 2EVRA 1YJ9Q 3E9GA 3VYGA 4J9CA 2QEXA 3PVLA 3CBPA 5GAOr 1KD1C 5AXIA 2BZYA 3WA4A 4M75B 2CIAA 1D1CA 3CC7Q 4EMGA 5D0JA 4HVWA 3QDRB 1UGSB 1LUMA 1VQLT 3JCMh 1RLQC 1QP3A 4M4ZA 3CCJA 1AHJB 1M2VB 4F17A 1KC8U 2K4YA 1SHBA 1SHDA 3BKBA 1CSKA 2JS0A 1O4JA 2CSQA 1KD1U 1QVGP 3QKJA 1N8RC 2DD4A 1H92A 1YHQA 2FPEA 4AG1C 3NTIA 3INZA 1NZVA 3OVEA 4E68A 1VQ9T 4DOWA 2D1XA 1YVLA 1O44A 4U17A 3EG9B 3MKDA 4HVVA 2KR3A 4M7AF 4C92B 2FHDA 3S9KA 1K8AR 5LJ3d 2HCKA 3D7SB 1N8RU 2QGGA 4AMCA 1O4EA 1D1ZA 3G71A 2ZCFB 1Q82C 2AOBA 4L5GA 1YWPA 2EO6A 4J7IA 3BDLA 2F2VA 1VQKA 2E1HA 4M78C 4F04B 1WHMA 1U1SA 2OTJQ 1D4TA 4X9DA 3LLRA 5CIUA 4IIOA 4XTYA 3BUNB 1X2QA 3VS2A 4JPBW 1V1CA 1Q82U 2CREA 3QZ5B 1SKJA 2IUIA 3CCSQ 1BHFA 1FU5A 5KYXA 1YITQ 1ARKA 5FU7B 1M1GA 1O4DA 1WQWA 2LJ3A 4C92C 2L0AA 1BM2A 2RO0A 2DYBA 4X6SA 3E1SA 1SRMA 5KYNA 3QBYA 1C1AA 5BO4A 2IUHA 2CZ1B 1O4AA 1VQ9A 2LCSA 4HXJA 3VS5A 1M27C 3RBBB 2LNWA 2B8AA 1Z9QA 2DBKA 1WYXA 1PKTA 1CJ1A 3CC4Q 3NGPA 3LWIA 4EPCA 1M1KC 2ZPHB 4GLKA 3ZFJA 3OBYA 4XAXB 5FU7C 2VC8A 3ER0A 1OO3A 3TSWA 3IMJA 4M7AA 2IZVA 5DF6A 3RKXA 2ZAEA 1M1KU 5GJVB 2DBMA 2X35A 4F5BA 3SEMA 2O2OA 1SF9A 2QQ9A 4DQ2A 1H3HA 2EPDA 3NMZC 2LMJA 4K11A 2KXCA 1VQPQ 4M77D 3CXCP 3FIFA 4RTXA 3EHQA 2RQRA 3HRUA 2DX0A 1Y57A 2CP0A 4EIHA 3LWHA 2L2PA 1HK9A 2FZCB 1ZQ1A 1ZA1B 3HTRA 2P4TA 3V7SA 5FWBA 1SPRA 1X0NA 1O4KA 1JJ2A 1ZUUA 2LQWA 3M55A 4N4IA 1FMKA 3QWXX 3CCLQ 3GP8A 1O4RA 2HDAA 2BE9B 2HSPA 2GQVA 1R0CB 2BKDN 5IHKA 1IZ6A 1LNXA 5FLXE 1X6BA 4AT1B 5KYUB 5GMKe 4K45A 4B9XA 2PLDA 1C6VX 1OPKA 2DE0X 2QASA 1BU1A 4E7HA 5GAOp 2JVVA 4F59A 4BY6C 1ZSZB 1R1SA 1WA7A 2KYMA 4PLLA 1WHHA 1O42A 3MP8A 1LUKA 1Q7YC 1D4WA 2KNOA 4RTZA 2DD5A 3OS0A 4HCBA 5KYWA 2ABLA 2XG8D 4P9VA 2E3HA 4WTOB 3OY9A 4WWQA 3CCQT 1FBZA 2DLZA 5DM7R 3EGDB 3M5AA 2O4XA 5IXBA 1Q7YU 3PQZA 1RL2A 1D3BB 1AVZC 1OPLA 2RF0A 4NL2A 2YT6A 4Z8AA 1ZSZC 3V7RA 1J3TA 3C7IA 4PJOB 3GNGA 1SPSA 3JB9F 2E70A 3RIRA 1N5ZA 1OYXA 3V8LA 4JJDA 1GBQA 4QT7A 4DGPA 2PUKB 3BFMA 3ZL7C 2GF7A 1O4PA 5D6XA 3JCMP 2M0YA 3JCMV 1O4BA 4P9ZA 5HKYA 4FT2A 1C0MA 1QQJA 3G7ZA 3OSSC 2MK2A 4H34A 4ZN3A 4RCBA 1Q82R 4C8QC 1FXXA 5M9OA 2K5FA 5I21A 1GXIE 5D6YA 3H0IA 5FU6B 4OB3B 1M3AA 2KRNA 4ESRA 1QCNA 1O4OA 1OX9A 1VQ7T 2V26A 3JAME 5J26A 5FRNA 1KC2A 3L42A 3CCQA 2AZVA 2HMAA 2NUPB 2PVDB 1QVGA 3EG0A 4MMKA 2MWOA 4Y28E 2ETZA 3VS6A 1UFFA 2KNBB 1FWZA 1W2BA 2DEQA 4E7IA 1ZA2B 2YRDA 4M7DG 3CMAA 3OYAA 2OAWA 2LQNA 1FBVA 2XIDA 2CP6A 4JS4A 2X4YA 4JJCA 4NWFA 5I6VA 2QQAA 3SDZA 2ECZA 3VUZA 2YUPA 2DCRA 4IKFA 2DL4A 1YI2Q 1NLOC 2M16A 3HCKA 2L3SA 2M9UA 3EFSA 2D9TA 3JB9J 3G4SQ 2EYQA 4M78F 4QW2A 5EG2A 1VQ7A 2KY9A 1MMAA 1TUGB 3I55A 1B34B 5GAOn 4D8KA 4BDZA 2L3RA 3X28B 1PM3A 3A5ZB 2MRKA 2CSIA 3LX7A 3ULRB 1B07A 1YIJA 4RTUA 2K79B 3RMSA 4C92F 2EO3A 1NM7A 3A8OB 4F7UG 2DRKA 2CI9A 1U3OA 1LUNA 2EYZA 2LJ1A 3OA6A 3JB9D 1WZOA 3SHWA 3OYJA 2M0OA 3TU4K 3PLFB 2E41A 2HSEB 2YXYA 2YSXA 3CCVQ 2A28A 1RUWA 2SRCA 2ECDA 1X6OA 3K2TA 1OU8A 2DA9A 2JMCA 1TWBA 1BKLA 4HT8A 4PNOA 2MPXC 4F7UE 3C0CA 1A09A 4JLGA 3OYLA 2EWNA 1S72T 1TSFA 4E93A 2HL3A 3OB1B 1K9MR 1UJYA 3CMEQ 1QCOA 2KT8A 1VQ6T 2RVFA 3S8LA 2XICA 5DC9A 1RI0A 4M75A 3RNJA 1B7TA 1UGPB 1A1EA 3X20B 5GJIA 4M77C 4RG2A 1BG1A 3RR6A 1VYTA 1M2VA 1K0SA 3VRRA 5I11A 1O4HA 3OMGA 1AYCA 4M78A 1PWTA 2X4XA 5LJ5j 1YJ9T 2VB6A 1OX8A 6AT1B 5HKWA 2F2XA 1EFNA 5GAOq 4TVRA 1VQMQ 1H8KA 1Y0MA 4WCIA 1KIKA 1BCMA 1BIBA 1WLPB 2ED1A 5GAN4 1D09B 2K7AB 3EG9A 4AFSC 1UGQB 3H9NA 4C92A 4C5HA 3DB3A 1O4CA 2DVJA 5LJ5f 1IRXA 3CBOA 1S1NA 2ZPEB 1VUBA 4UC4A 5EC7A 2L3TA 2HEQA 1TUDA 3M59A 1D1AA 2KGYA 4EMKB 1WI7A 4GPLB 4F16A 3C94A 2EBPA 4C8QE 5GMKl 4J6WA 1V29B 2JT4A 3BUWB 1O4MA 1VQ6A 3ZEHA 1OOTA 4XZ1A 3VRZA 1I3ZA 3QG1A 2RJFA 3MCAB 3PIOA 3HFOA 1AD5A 4LN2A 3OS2A 5C6SA 1N9SA 3PTAA 5GAN7 1YJ9A 2RHYA 1T0HA 3UA7A 2OTJT 1ZSGA 4NWGA 1IGUA 2BZ8A 2CDTA 2EGAA 2DLPA 2HBWA 3CEYA 1YITT 4O6JA 4OB0B 5KAZA 2DL7A 5FROA 3VROA 2KE9A 3EG1A 2O01E 2NUTB 2YHTA 1JEGA 2X4JA 4OMPA 4Y91A 4LE9A 2WACA 4Y92A 1E6HA 4QKUA 3JCMe 2CH4A 4C8QF 3FDRA 2M51A 3OMCA 5I2SA 4PJMA 1MMGA 1UTIA 1O49A 1PCXA 3EG2A 2AKLA 1JO8A 5L23A 2OJ2A 2JM9A 2HKNA 1VIEA 1EZZB 3CCRA 5GAOl 2WSEE 1I4K1 1VQ8Q 2OTJA 1YCSB 3FJ5A 2Z0WA 2QA4A 1BBZA 4Z02A 2F1LA 2K5IA 3MP1A 3E19A 2OTLQ 1PSEA 1M2OA 2AK5A 2LRAA 5IT9E 3CCEQ 3GOXA 2OAUA 2LTOA 3PIPA 4J83A 1IXDA 4R0KA 1A0NB 1JJ2P 5KYUA 3A1PA 1RAFB 4A4GA 2EYVA 1NJIR 1ZSZA 4R56A 5IBMA 3QXEB 4TZIA 2FPDA 2LX9A 2RI3A 2O9VA 1QW1A 4JDSA 1X2KA 2LNVA 2DRMA 4B9WA 1H641 3SB2A 1UUSA 2P84A 1TU0B 2GFUA 3GIBA 3EGDA 3J81E 3LW5E 3UF4A 1WHGA 4N4GA 3GLXA 1D3BA 4E7ZA 5KH6A 3VS0A 1U8RA 5HK3A 3G6EQ 4XQ3A 2RJDA 2KGTA 4AG2C 2XDDA 3PSKA 1YJWA 3LYIA 4FCYA 4PJOA 1LVKA 4J7FA 5CKBA 1QWFA 4X34A 1M90U 2PUOB 4FYYB 1I81A 4OGEA 1NYFA 3MEAA 3BW1A 1O45A 2FCIA 1IGQA 3OYHA 2OQ1A 1WIEA 3GNFB 3IMDA 3JCMd 1RAGB 3DLMA 2D8JA 3UATA 4C8QD 3O8VA 3A8HB 2LCTA 1M3BA 1KC8C 2MOXA 4BE2A 3M57A 2NUPA 2D0QB 4JLIA 2KQWA 1Q86R 4KH0B 3M0SA 4JZ3A 1HSQA 3UWNA 1WQUA 2YDLA 2X3XD 4PJJA 2BIVA 4M77F 3VRQA 5GAMj 4JJNK 4M78B 2VUBA 3L1AA 4Z88A 1FU6A 1U06A 2GFAA 1WGSA 3SWNC 3H6ZA 1YNZA 2HKQB 2BE7D 1MV3A 4YTLA 1HD3A 1Y7XA 4E7SA 1W2BP 1VQ5Q 3S6WA 3F70A 5CK9A 2KVQG 5GAMf 2K57A 4BI8B 4DEYA 1ACMB 2IG0A 2DL3A 1T3LA 1MNEA 4QQDA 4RCCA 1FYNA 1WFWA 5GAN2 5IXFA 1M5Q1 3HSBA 2P0KA 1YCYA 4IURA 2JNGA 1B34A 2LCLA 3A98A 2RQTA 4OP0A 1VQLA 1YI2T 4ZGDB 3S8NA 2H46E 1GFDA 2K79A 2DMOA 3CCUQ 2KROA 2G3RA 4N0AA 3G4ST 1WHJA 2KK4A 5CKFA 1P13A 3JCMg 3OV1A 3HRSA 1U5SA 5A2QE 3CD3A 2RH2A 3LGLA 2DL8A 1A07A 4F5AA 4OMMA 1G3WA 4X1VA 5CKDA 4M77A 1JU5A 1M61A 1XJWB 3CQTA 1E7OA 1IO6A 1OU9A 4FU6A 4XK8E 3O5ZA 2QG9B 1PC0A 1VQOQ 4OF1A 3HRTA 3RESA 4LDXA 3VKIA 1I8FA 3N8MA 1KQSS 4QQGA 1NRVA 4ZGJB 1QWEA 2PZ1A 2X4WA 1HXDA 3BUMB 3CCVT 3DKMA 3QIIA 2PVOB 2LT4A 2K2MA 2AHJB 3MXCA 1A81A 1BIAA 2QDLA 4K2RA 4F7UB 3T9NA 5DLOA 4OHDA 4BY6B 4PJNA 3PJPA 2ZGWA 2HDXA 2F2WA 2QTVA 3PNWC 3CMET 1AEYA 4RKUE 2FL7A 3M56A 2QK0A 3TCJA 1QVFS 1VYVA 1TH7A 3C4SA 4C0DB 1I5OB 3OYCA 4C0GA 2ZPIB 2K7AA 2LC4A 1SPKA 3V8KA 2GSBA 1JYUA 2K5LA 2EKHA 2DVEA 5LJ5h 3HP9A 1GCQA 3JB9H 8AT1B 3OP0A 1EIFA 4E6RA 4EMKA 2RNAA 5ECAA 1N6AA 5GAN5 2EOBA 2DTIA 3FJPA 3DLLA 2IIMA 4A4EA 2NWMA 2XD0A 3RKYA 2V8KA 3T04A 1FMVA 2E10A 2DJQA 2QQRA 4NOYA 2JM8A 4L59A 1KSWA 2XHCA 4C0DC 2QEXQ 2F69A 4E47A 1KC8R 3IN8A 1KHCA 1O4QA 2KK6A 1KD1R 1GCPA 2YLCA 1AWJA 1WXTA 1UECA 2CT3A 2MF2A 1WXBA 2C0IA 4Q5WA 4C8QB 2ROTA 4JRPA 2B3OA 3CCJQ 1KK7A 2FYKA 1BHHB 2C0OA 3KFVA 2DKGA 3OYMA 2E5KA 1WHLA 1IHVA 2E5QA 5DC4A 4XTZA 4LXCA 1N8RR 2RQWA 1A1AA 2XI9A 1JXOA 1AWOA 1QLYA 3U23A 3WVEB 3WXMB 3LH0A 5A0GA 3EHRA 4M75G 2EKXA 1RACB 1NBEB 3JV3A 2VKNA 3GPLA 1JB0E 2CI8A 2NUTA 3I9QA 2CKKA 2VGNA 1O4GA 1UHFA 2DFUA 4KGVB 5EEQA 1UUEA 1IREB 1RAEB 4HCCA 2V8JA 5KE2A 2RQUA 5D7UA 3VS4A 4JGHA 1UEBA 2K3YA 4A4CA 1XNIA 2KMTA 3CD6T 1QKXA 4ZTJA 1NE8A 2OI3A 4QSYA 2L89A 2GCXA 4NL3A 3VS1A 3RDVA 3QYHB 4LUDA 2VXFA 1ZHIA 2I0NA 2EU0A 4IUQA 5FW9A 3N5BB 2ATCB 2ENMA 1D0XA 3SD4A 4FSXA 3Q1JA 5KCOA 3P8BB 5I22A 3E2UA 4OB2B 1IHWA 3FEOA 1NZ9A 2JMAA 8ATCB 4A53A 1Q81U 3N84A 4E7JA 1RI9A 2DYIA 3PFSA 2RJEA 4R55A 1VQ8T 5DC0B 4BB7A 5HY6A 2RPNA 1YFNA 2EFIA 1B47A 1EX4A 1M1KR 1BFIA 2DIQA 2R5MA 2CP2A 3OS5A 3J80E 4M7DE 3CCET 2GNCA 1N27A 3CD6A 1FHSA 3CBLA 2XU8A 3CC2T 5AT1B 2DM1A 2NLUA 4X9CA 4DGXA 5LJ3j 1H9OA 1RQQC 2MQIA 3TEEA 2DL5A 2FVUA 3JRZA 4LNPA 4BACA 5DY9A 2A37A 3CCMQ 4DBHA 1VQ4T 2DXTA 1R0BG 2RHXA 3BY7A 4KUIA 1BLKA 2LT1A 4DEXA 4J6XA 3RUXA 5LJ3f 3KXTA 4A4KA 3MP6A 2L3PA 1BLJA 2LQ8A 5IH2A 4M77B 1UDLA 3OYFA 2LRQA 5EG3B 2KRMA 4QQ6A 1G3TA 2RHIA 1ZUYA 1OQKA 2LQKA 1WJSA 2ESWA 1AOTF 1R1PA 3BUOB 1UURA 2KAFA 3OB2B 3NTKA 3SWNA 3L2VA 3OYBA 1ABOA 4M7DF 1BKBA 2DZCA 1JWOA 2RORA 3CC2A 1K1ZA 4KBMB 2E6NA 1Q7YR 1A08A 3PS5A 4P5NA 1PKSA 3PE0A 2DNUA 5KYYA 3TL0A 2DF6A 1O9SA 3MEUA 2IVWA 3URGA 1MMDA 2FRWA 1CKBA 1VQ4A 4AFQC 1I1JA 3VRPA 2QXFA 5IHIA 2ZPFB 3OW2S 5GANj 2E12A 3HIZB 1I5LA 3CC7T 4J9DA 1BB9A 1NPPA 1ZBXA 3AT1B 3MPUB 1NLPC 1TOVA 4OMOA 1SG5A 5GAMh 4IIMA 1PRLC 3OSVA 1G83A 3L2ZA 5J3BA 3OYGA 1CWDL 4L6V5 5GANf 5FWCA 3QJYA 1VIFA 1S72A 1KQ1A 4F7UF 1M27A 2JS2A 1VQ5T 1MUZA 4PJOG 2RHZA 2KXDA 4M75D 2D8HA 3OYNA 4XTUA 2WSCE 2HAXA 2DAQA 4CC2A 3RERA 1KA7A 2XMFA 1X27A 3EFRA 2Y1NA 1M8VA 2RA2A 3OYEA 2CYZB 2A3LA 4VUBA 3CC7A 3NFCA 3GF5A 3A8MB 3CMAQ 1IS0A 3VS3A 1KFZA 2XKOC 4PJOE 3CCST 3MJXA 1YN8A 2VIFA 1ZUKA 1AZGB 2MI6A 4FL3A 1B3QA 2DPPB 2ZZDA 2KEAA 4PKCC 2XDBA 1Z9ZA 1D0ZA 4DBFA 4GY5A 3TKZA 3TSZA 1QMCA 2EGEA 2GTOA 1LCJA 2EYWA 2MAMA 2H8HA 3TQ7P 1VQ5A 4M7DD 1BI2A 3VYHB 1D1BA 4BE1A 2Y4YA 2F5KA 3JCMJ 2VXEA 2KDSA 4CC3A 4HCKA 3CC4T 4FBNA 3HKSA 2YLBA 4V2SA 4OMNA 1VQOT 4OMFB 2FRYA 3I55Q 3EACA 3CPWS 4F7UA 2GBQA 1R77A 1JYQA 3HPWA 4J9EA 3NHNA 1KQSA 1W70A 1YBYA 1K8AU 3US4A 1YIJQ 2DTOA 3UDCA 4JZ4A 2XDPA 2HD0A 2J05A 1WDXA 1MV0B 2Y4XA 3CCSA 4FW1A 1YITA 1MILA 5CQYA 4OB1B 2EJ9A 1BFJA 4JEGA 3H0HA 1VQPT 3P8DA 1O4FA 2O88A 3QJ6A 2P0PA 3JCMX 3VU3C 5IN1A 3IN7A 1O41A 1NEBA 2B86A 5CAIA 1QVFA 1YWOA 2CZ0B 3QWYA 1X43A 1H3ZA 4XTWA 2P0QA 1IB8A 3CCLT 1RAAB 2L4KA 2GE9A 3CC4A 1JQQA 3OW2P 3A8GB 4ZGEB 2DIGA 2PNAA 1VQOA 1Y71A 2LVMA 3EGUA 1HCTB 5GJWB 5GAN6 1K9AA 1PHTA 1TG0A 4C8QA 2LNXA 5CQXA 2J06A 2I2LA 5EELA 3QSUA 1BI3A 1M90C 1BHHA 2K3XA 5IBSA 2W0ZA 3LGFA 1KQ2A 1MMNA 1BF5A 4FYWB 2CUDA 4M7AG 2RB6A 1HJDA 1VQPA 3JB9I 2H3EB 3QYGB 3M58A 2YU7A 3UYOA 4O5VA 1AOUF 1G2BA 1K76A 1MNDA 3TREA 3X24B 4GWFA 1W4SA 7AT1B 3CCJT 1F2FA 1JXMA 4FM4B 1CKAA 4ME7A 3SWNB 3VS7A 2D6FA 1GRIA 3EG3A 3CXLA 1GL5A 4JUVA 3CCLA 1R8OB 3OYYA 2AOAA 3FC3A 4BE0A 4M7AE 4D8DA 1VQ6Q 3K2MA 1TCEA 4KGXB 3PMTA 1JRIA 3HFNA 3M53A 3CXCS 3NTHA 2P4RA 4RTTA 5HKCA 3HHMB 4BUGA 2EJGA 5KYYB 1VYUA 2PNIA 2RK1A 4PLIA 1YJNQ 2RK2A 3H41A 4ANJA 2PNBA 4A4HA 5HCKA 2ED0A 1V76A 2ZPBB 1CSYA 4IUVA 5IHNA 5LJ5e 2DXBA 3BE3A 1M9SA 2K9GA 3AHUA 2EW3A 5LL6S 2A0FB 3PGGA 5GANe 4PJOD 4JRIA 4E7LA 2XP1A 3JCMQ 4A4FA 1BCOA 1K73C 2VYTA 4C0ZA 3S3NA 2DEUA 2PLEA 2FZKB 1TXQA 2MCNA 2FO0A 3CPWP 2L6KA 2J6OA 4MZPA 1SHGA 2R58A 1PNJA 5L8RE 2BZXA 1T0JA 2L5QA 1K73U 1NEGA 1GFCA 3ZBDA 2O9SA 2CT4A 4K44A 4CRIA 4M75C 5GAOm 2EQMA 1KJWA 1OZ3A 4PK4A 4QVDA 1AYBA 1ZX6A 1XQHA 3M54A 1OEBA 2Y1MA 4NS5A 1LCKA 2COYA 2OZOA 4EY0A 4HA8A 2HZYA 1D0YA 4EDUA 4M7DB 2DERA 4ELZC 3CCRQ 3OYKA 1NYGA 3EH2A 1X6GA 2LCCA 3PT9A 2HMHA 4J9IA 1AT1B 4FW2A 5IAYA 2LDMA 1I0CA 1G8XA 2QA4Q 3CPFA 5LJ3h 3E9FA 2G6FX 2KI7A 3QUIA 1X75C 3M4GA 2NYSA 2QQSA 5A0DA 3JSCA 3MHXA 1BK2A 4OMLA 1SEMA 3VRNA 4OGCA 2RJCA 3CCMT 3OB9A 4ZTFA 1M4ZA 2CS7A 9ATCB 1PICA 3JCMW 3M0PA 4OHLA 4EMHA 3R6NA 4M7DC 2HUWA 1Y96B 2E3IA 2DTHA 3VUBA 1WQ7A 2EAYA 2CBLA 1RAHB 1SKUB 2JN0A 2RI5A 4BI3A 2VV5A 1LOJA 1YI2A 2H5KA 3X26B 4BD3A 1RABB 2RSYA 1RAIB 3IQLA 3GQIB 5GJHA 3C12A 1JBMA 5LJ5d 1TS9A 2CH4W 1WXUA 1BYMA 3G4SA 5D6WA 3N7YA 5GANd 2R57A 5GAN3 1PSFA 1M90R 1TUCA 3RMQA 3JB9G 1KA6A 3CBMA 5CDWA 4QVZA 2IPOB 5EHRA 2VGMA 1VQNQ 1YJWQ 4DBQA 2M1HA 2KSSA 5KCHA 1WJRA 2Y3AB 2JUFA 3ASKA 2JYQA 3P8HA 1N9RA 5LJ3g 1X69A 3CCMA 4PJLA 4J9FA 1SSHA 3L2WA 3PSJA 1XA6A 5GANh 3OW2A 2HQHA 3UA6A 1VQMT 2EQUA 1NPRA 3LH5A 1X01A 4FL2A 2QYZA 4J9GA 3OQ5A 4HCZA 3EGXB 3PFVA 3CCVA 4A54A 4M7AD 2JTEA 2CP7A 2YSQA 3I56Q 1F1WA 3HHTB 3R6OA 3BUXB 3J7AF 2CUBA 3UT1A 3GXXA 1OZ2A 5CVIA 1Z3KA 4OHEA 2E65A 1K9MC 1X6CA 5J39A 4LD6A 3KBGA 3CMEA 2F5TX 1SHAA 1BI0A 1CWEA 4IUUA 2X51A 3OS1A 1BKMA 3THKA 2RM4A 3EFOB 2EQIA 1YHQQ 4J8OA 1W1FA 4C5IA 1NZLA 2C0TA 3FB9A 1K9MU 3M0QA 1E6GA 4JE4A 3EAZA 1AB2A 2DXUA 4KH1B 2JZ2A 3EH1A 3VGOA 4D6WA 1K73R 2HQXA 3VV0A 1VQMA 4L1BB 5I2MA 3M7FA 5LJ5g 2CRHA 1AOJA 4EIKA 3G71Q 4KULA 3CMAT 4M78G 3SFMA 4FYVB 2JXBA 2E64A 5GANg 1G3YA 4J9BA 4J9HA 1VQKQ 5CCAA 1UHCA 2DILA 4H1OA 4M75E 3A8LB 4ELYC 4FSSA 2FZGB 4OHIA 2YUOA 4RMOA 2C9WA 4JS5A 4C92G 1VQLQ 3REBB 2CP5A 2COZA 1Q81C 2C06A 2DJZA 3X25B 4BDYA 4M78E 2EL8A 5GAMe 5HKZA 1WJQA 1M30A 4HVUA 4ORZA 4PL6A 1ABQA 1O4IA 4E7KA 4FIBA 2HQEA 4Z89A 1KQSP 3M0UA 4PJOC 3CPWA 1ZFPE 3I55T 1VQ9Q 1KHIA 3I5RA 3JCMf 5CO7A 2L8DA 4C92E 1QVPA 2AT1B 2J6KA 1UE9A 1YIJT 4C5GA 1NG2A 1RADB 2AIRB 2JTFA 4MDWA 2OTLT 1HYOA 1DJ7B 2MYSA 2LJ0A 4AFZC 1FYRA 2W10A 1O46A 3KUFA 1Q95G 5GAN8 4LDVA 1IJRA 1QVFP 2A08A 2EQJA 5FU6C 1MW4A 1VA7A 4XZ0A 1RJAA 2X3WD 1KG1A 2L3QA 1WNLA 4M75F 1LKLA 4OMQA 1MGQA 4RTVA 2QMSA 2RI2A 2PU9B 3QZ9B 4LUEA 2FB7A 2M02A 2WSFE 4HT9A 2HDVA 4B6MA 1QADA 1FMWA 4JJBA 2BUDA 5GMKh 1HCSB 3VRYA 1LKKA 2DETA 5GMKi 4GL9E 3QHSA 1O4LA 3S3OA 5KYXB 2KRSA 4C5EA 3L2UA 1LJOA 2YUQA 1GBRA 1AYAA 4E2FB 2MC1A 1VQ8A 3MAZA 4OVAA 1A1CA 4KT0E 1I07A 3EAEA 1UB4A 2OTLA 2EGCA 4PFOA 5CR2A 3G6ET 4A4BA 3CCEA 3GXWA 3QPHA 2HNIA 2PTKA 3QO3A 2ZPGB 1ZLMA 1PD1A 1G5VA 4DA4A 3TVTA 2CGHA 4CC7A 5FRMA 1RLPC 2VASA 1NJIC 2K2VA 5GAMd 4XU3A 1TZEE 2DM0A 4J6YA 2E4HA 4FL6A 2MIOA 2DO3A 2GTJA 2OX7A 2VWFA 4N0AC 1UG1A 4M7AB 1UJ0A 3CXCA 4WF2A 2FEIA 3S8OA 1QG1E 1NJIU 4A63B 1K4US 1JJ2S 2EKOA 1M8MA 2EYYA 3LYVA 1JU5C 2GGRA 3META 1YVHA 2J7IA 4JRQA 1YJNT 1OULA 2CS0A 2EYXA 2JTMA 4CI0C 2DZ9A 4II1A 2QI2A 4XU1A 3G6EA 1CSZA 1AYDA 1PD0A 4C8QG 1XOVA 3H0FA 4KRTA 2IUGA 3M9QA 1WHKA 2BTTA 4AFUC 3OYIA 3H8ZA 4IUPA 3I5SA 4JRKA 4M7AC 1SSFA 4IUTA 3OYDA 2MK5A 4GLMA 2K6DA 1O47A 2YUNA 4MMLA 5EHPA 3CCQQ 1Y1UA 3JCMb 2RQVA 4F14A 1W6XA 4LDYA 2D0NA 4M7DA 3QDFA 4KGZB 4GBQA 2FG0A 2J6FA 1WPYA 1Q81R 4N4HA 4M78D 2DX1A 3S3MA 4PFPA 1UGVA 4MDXA 1O4NA 3G1JA 2H3JA 4KUDK 1Q86C 5KYWB 4LDUA 2FPFA 4MZTA 2KYBA 3V7CA 1YJNA 2JOYA 2LNHB 2LP5A 1G3SA 4C92D 3CCUT 1A1BA 2O4XB 3CCRT 3RKWA 1GCQC 1AZEA 2LZ6B 1AWXA 3M0RA 2RMXA 2DK3A 1Q86U 5GAMg 2QA4T 1GHUA 2QDYB 4EMKC 2SEMA 4DOVA 2RMOA 1AWWA 1Y96A 3REAB 3I35A 3UPUA 2JJ9A 1U1TA 3MO8A 1K8AC 4MZMA 3OBWA 2YRVA 2O31A 3CD6Q 3C95A 4RG8A 3NPFA 1OV3A 1BMBA 1VQ7Q 5DLQE 5C0MA 3DB4A 1M3CA 2CR4A 2AZSA 2ROLA 1PG5B 3HL8A 1QVGS 4LD9K 4U1PA 2X9HA 1SRLA 4XU2A 3M4YA 4DBRA 2HL5C 2V1RA 2Y90A 4BI4A 1ZBJA 2RN8A 1WX6A 1W2BS 2V8IA 1MHNA 4ATOA 3PMIA 2LX7A 5J3XA 3FRNA 4LDWA 4OHHA 3MEVA 1VOMA 1JYRA 4XU0A 2BBUA 4PJOF 1O48A 2YWWA 2CZ7B 2SHPA 2QAZA 3CCUA 1P92A 4ZN1A 1T3SA 3V8JA 2AUGA 1BI1A 1PRMC 5AYFA 4HKEA 4XTXA 1Y07A 2PVGB 4CC4B 2COWA 3EGXA 1VQNT 1YJWT 2MMPA 3KFJA 3MEWA 1RPYA 2RHUA 2AKKA 2QTXA 3JCMc 1K0XA 1LPLA 3FLGA 4RTWA 3CC2Q 2YRCA 2PQWA 4M77G 5GMKj 1R1QA 4J5YA 2QGFB 1YP5A 4XTVA 2DXCA 4FT4A 5LJ3e 3M0TA 3GBQA 2CZ6B 4ROJA 2HBPA 1XTDA 1F1BB 1VQ4Q 2GQIA 3I56T 1QP2A 2KT1A 4PFZA 5CKEA 2QEXT 3EFOA 2DLYA 2V1QA 3L2RA 1LUIA 1FX7A 2VVKA 4M77E 5AULA 2NUZA 1QKWA 5CKHA 5A0LA 4FYXB 5GMKm 2XK0A 4RTYA 1QCFA 4RUGA 3L2QA 2QQBA 2RD1A 1O75A 1YHQT 1VQNA 1M1FA 5HK0A 3ZNIA 2E6ZA 3BDUA 4C0FA 1S72Q 3CWGA 2A36A 5KE3A 2KBTA 2CP3A 1TTHB 1OO4A 1SHFA 2EQKA 1UGRB
chains in the Genus database with same CATH topology
2MRJA 2GNCA 5EHRA 1T0HA 3UA7A 2K3BA 1FHSA 4ZNXA 1ZSGA 4NWGA 3CBLA 2Y3AB 3MXYA 2BZ8A 2JYQA 2CDTA 2EGAA 2DLPA 2HBWA 1X69A 1O43A 2DM1A 3PVQA 4J9FA 1SSHA 2JW4A 2EVRA 3PSJA 4DGXA 1XA6A 5KAZA 1H9OA 3UA6A 2DL7A 4J9CA 1RQQC 3PVLA 3VROA 2KE9A 3LH5A 3EG1A 2MQIA 4FL2A 2DL5A 4J9GA 5AXIA 2BZYA 3WA4A 2CIAA 4LNPA 2A37A 3PFVA 1JEGA 5D0JA 4OMPA 4HVWA 1LUMA 2JTEA 4LE9A 2YSQA 1F1WA 1BLKA 1RLQC 4DEXA 3BUXB 4M4ZA 4F17A 4Y92A 2CUBA 1E6HA 1SHBA 1SHDA 3BKBA 1CSKA 2JS0A 2L3PA 2CH4A 2CSQA 1O4JA 3GXXA 1BLJA 5IH2A 2M51A 1UTIA 1UDLA 1H92A 1Z3KA 1O49A 2FPEA 4AG1C 4OHEA 5EG3B 2KRMA 1NZVA 1X6CA 3OVEA 3EG2A 2AKLA 4E68A 1JO8A 5L23A 1ZUYA 2ESWA 2JM9A 2OJ2A 1AOTF 1SHAA 2D1XA 1R1PA 1YVLA 1UURA 1CWEA 1O44A 3BUOB 4U17A 3OB2B 4HVVA 2KR3A 1BKMA 3THKA 3S9KA 2EQIA 2HCKA 1W1FA 1NZLA 1YCSB 2C0TA 1O4EA 3FJ5A 1ABOA 1D1ZA 1BBZA 1JWOA 3M0QA 2AOBA 2RORA 1E6GA 1K1ZA 3EAZA 4JE4A 1AB2A 1YWPA 2EO6A 2F2VA 1A08A 3VGOA 2AK5A 3PS5A 1PKSA 1D4TA 4L1BB 3PE0A 2DNUA 4IIOA 4R0KA 3BUNB 1X2QA 3M7FA 3TL0A 3VS2A 2CRHA 1AOJA 2DF6A 4JPBW 1V1CA 4EIKA 2FRWA 1CKBA 1A0NB 2CREA 2JXBA 1SKJA 4AFQC 2IUIA 1I1JA 1BHFA 4J9BA 4J9HA 1FU5A 3VRPA 1ARKA 1UHCA 5IHIA 1O4DA 2EYVA 2DILA 2LJ3A 2L0AA 3HIZB 4H1OA 5IBMA 1BM2A 2DYBA 4X6SA 4J9DA 4TZIA 1BB9A 2FPDA 4FSSA 4OHIA 2YUOA 1SRMA 2C9WA 5BO4A 2O9VA 1NLPC 2IUHA 4OMOA 3REBB 1X2KA 1O4AA 2DRMA 4IIMA 1PRLC 2LCSA 1G83A 4HXJA 3VS5A 1M27C 3RBBB 1CWDL 1UUSA 2EL8A 2LNWA 5HKZA 1M30A 1Z9QA 2DBKA 1WYXA 5FWCA 4HVUA 3UF4A 1PKTA 4ORZA 1ABQA 1AD5A 1CJ1A 1O4IA 3NGPA 4Z89A 3M0UA 1M27A 2JS2A 1ZFPE 3I5RA 3VS0A 1MUZA 4AG2C 2KGTA 3PSKA 2KXDA 1OO3A 3TSWA 3IMJA 2J6KA 1UE9A 1NG2A 2D8HA 1QWFA 2IZVA 5DF6A 5GJVB 4CC2A 2LJ0A 1NYFA 4AFZC 1FYRA 1O45A 2W10A 1KA7A 1O46A 2FCIA 2XMFA 2DBMA 4F5BA 3SEMA 2O2OA 2OQ1A 1X27A 1IJRA 2A08A 1WIEA 1H3HA 2Y1NA 2EPDA 3IMDA 3NMZC 1MW4A 2LMJA 4K11A 1VA7A 2KXCA 4XZ0A 2D8JA 4RTXA 3UATA 3EHQA 1IS0A 2RQRA 2X3WD 1RJAA 3VS3A 1KFZA 2DX0A 1Y57A 4EIHA 1YN8A 2L2PA 2L3QA 2LCTA 1M3BA 1LKLA 4OMQA 4RTVA 2QMSA 1ZUKA 2VIFA 5FWBA 2MOXA 1AZGB 1SPRA 4FL3A 1X0NA 4LUEA 1O4KA 1B3QA 1ZUUA 2LQWA 2KEAA 1FMKA 3QWXX 1Z9ZA 1O4RA 2HDAA 2HDVA 1QADA 3TKZA 3M0SA 2HSPA 1HSQA 4JJBA 4JZ3A 3TSZA 1WQUA 2EGEA 2GTOA 2YDLA 2X3XD 2EYWA 5IHKA 1LCJA 2H8HA 1HCSB 3VRYA 1LKKA 3VRQA 1X6BA 1FU6A 4GL9E 4Z88A 1O4LA 1U06A 4K45A 2KRSA 1AYAA 2MC1A 2YUQA 1GBRA 4CC3A 4HCKA 2PLDA 4FBNA 1OPKA 2DE0X 3MAZA 1BU1A 4F59A 1YNZA 4OMNA 1A1CA 1R1SA 1I07A 1WA7A 1MV3A 2KYMA 1HD3A 1O42A 2FRYA 3EACA 1LUKA 2EGCA 1D4WA 2GBQA 2KNOA 4RTZA 4A4BA 1JYQA 4J9EA 3NHNA 3GXWA 2ABLA 1W70A 4P9VA 4DEYA 2PTKA 2DL3A 3US4A 1T3LA 1FBZA 4WWQA 1ZLMA 1FYNA 4JZ4A 1WFWA 2DLZA 5IXFA 3TVTA 2J05A 1WDXA 1MV0B 5IXBA 1MILA 4CC7A 3PQZA 1RLPC 1BFJA 4JEGA 3H0HA 1AVZC 1OPLA 2RF0A 1O4FA 2O88A 2YT6A 1TZEE 2DM0A 3IN7A 1O41A 4Z8AA 1NEBA 3A98A 1J3TA 2RQTA 3C7IA 2MIOA 2B86A 2GTJA 1YWOA 1SPSA 2VWFA 1N5ZA 1UG1A 4JJDA 1GBQA 3QWYA 1UJ0A 4QT7A 3S8NA 1X43A 4DGPA 2FEIA 2H46E 3S8OA 1QG1E 1GFDA 2K79A 3ZL7C 2DMOA 4A63B 1O4PA 1K4US 2KROA 2M0YA 1O4BA 2L4KA 4P9ZA 2GE9A 5HKYA 1P13A 1M8MA 2EYYA 3OV1A 1JQQA 1JU5C 2GGRA 1U5SA 2J7IA 1YVHA 4H34A 2MK2A 3CD3A 2CS0A 2PNAA 2DL8A 2EYXA 1A07A 4F5AA 3EGUA 4OMMA 1HCTB 5GJWB 4X1VA 3H0IA 1K9AA 1CSZA 1PHTA 1TG0A 1JU5A 1M61A 1AYDA 1M3AA 2KRNA 1XOVA 3H0FA 4KRTA 4ESRA 3CQTA 1E7OA 1IO6A 1O4OA 2IUGA 2LNXA 2J06A 2BTTA 4AFUC 5EELA 1KC2A 3I5SA 2AZVA 1BHHA 3O5ZA 5IBSA 2W0ZA 3EG0A 1BF5A 2CUDA 4GLMA 2ETZA 3VS6A 2K6DA 1O47A 1UFFA 1HJDA 3N8MA 2KNBB 2YUNA 5EHPA 1NRVA 1Y1UA 1QWEA 2PZ1A 2RQVA 3BUMB 4F14A 1W6XA 2YU7A 2D0NA 3UYOA 1AOUF 1G2BA 1K76A 4GWFA 4GBQA 2K2MA 2OAWA 2FG0A 2J6FA 2LQNA 1F2FA 1FBVA 3MXCA 2DX1A 1UGVA 1JXMA 1A81A 2QDLA 4K2RA 1CKAA 1O4NA 4JJCA 4NWFA 5I6VA 3VS7A 3CXLA 1GRIA 2ECZA 3EG3A 2YUPA 1GL5A 4OHDA 3PJPA 2AOAA 2HDXA 2F2WA 2FPFA 1AEYA 2DCRA 2KYBA 4D8DA 2DL4A 1VYVA 3K2MA 2LNHB 2LP5A 1TCEA 1NLOC 2P4RA 3HCKA 2L3SA 2K7AA 1A1BA 4RTTA 1GCQC 1AZEA 1SPKA 2LZ6B 3HHMB 1AWXA 3M0RA 2GSBA 2RMXA 1JYUA 2EKHA 1GHUA 2SEMA 1VYUA 2PNIA 2RMOA 3H41A 1AWWA 2PNBA 5HCKA 2ED0A 1GCQA 3OP0A 3REAB 3I35A 4D8KA 1CSYA 4E6RA 5IHNA 2MRKA 2O31A 2CSIA 2RNAA 2K9GA 5ECAA 2EOBA 3ULRB 2EW3A 3NPFA 1B07A 1OV3A 1BMBA 2IIMA 2NWMA 4RTUA 2K79B 1M3CA 2CR4A 3T04A 2XP1A 2EO3A 2DJQA 1NM7A 2AZSA 2ROLA 2JM8A 2DRKA 1KSWA 2CI9A 1U3OA 1LUNA 4U1PA 2EYZA 2LJ1A 1SRLA 3SHWA 2PLEA 2V1RA 3IN8A 2MCNA 2FO0A 1ZBJA 1O4QA 2L6KA 2KK6A 2RN8A 1WX6A 1GCPA 2J6OA 3PLFB 1AWJA 1WXTA 2YSXA 1SHGA 1UECA 2CT3A 1PNJA 2A28A 1WXBA 2LX7A 2C0IA 2BZXA 1T0JA 5J3XA 1RUWA 2SRCA 2ROTA 2ECDA 4OHHA 2B3OA 1JYRA 2DA9A 2JMCA 1BHHB 2C0OA 3KFVA 1NEGA 1GFCA 1BKLA 2BBUA 1O48A 2O9SA 2CT4A 2E5KA 2SHPA 3C0CA 1A09A 5DC4A 1T3SA 4K44A 1A1AA 2RQWA 2AUGA 1JXOA 1AWOA 1KJWA 4E93A 3OB1B 1QLYA 1PRMC 1UJYA 3U23A 1AYBA 1ZX6A 2KT8A 2RVFA 1OEBA 2Y1MA 3EHRA 3S8LA 1LCKA 4EY0A 2OZOA 2EKXA 5DC9A 3JV3A 4CC4B 2VKNA 2CI8A 3RNJA 3I9QA 1O4GA 1UHFA 3KFJA 5EEQA 1UUEA 1NYGA 1A1EA 1X6GA 1RPYA 2HMHA 2AKKA 4J9IA 5GJIA 1K0XA 1BG1A 2RQUA 1I0CA 1VYTA 3VS4A 4RTWA 1K0SA 4JGHA 3VRRA 5I11A 1O4HA 1AYCA 1PWTA 2G6FX 1R1QA 5HKWA 4A4CA 2F2XA 1YP5A 1EFNA 1QKXA 2OI3A 4QSYA 1H8KA 1Y0MA 3M0TA 3GBQA 4WCIA 1BK2A 4OMLA 1SEMA 3VS1A 1KIKA 1WLPB 2ED1A 3VRNA 4ROJA 4LUDA 2K7AB 2I0NA 4AFSC 2EU0A 1PICA 2GQIA 5FW9A 2KT1A 3M0PA 1O4CA 4OHLA 2DVJA 3R6NA 2DLYA 2V1QA 2HUWA 2ENMA 1S1NA 5EC7A 2L3TA 2HEQA 1LUIA 1TUDA 2VVKA 5I22A 2CBLA 5AULA 2NUZA 1QKWA 1WI7A 4GPLB 4F16A 2EBPA 2JMAA 2JT4A 3BUWB 1O4MA 2H5KA 3N84A 4RTYA 1QCFA 1RI9A 2RSYA 3IQLA 4RUGA 3GQIB 5GJHA 1OOTA 4XZ1A 2CH4W 1WXUA 5DC0B 3VRZA 3ZNIA 1I3ZA 2RPNA 3CWGA 3N7YA 2A36A 1B47A 1TUCA 2KBTA 1BFIA 1KA6A 1OO4A 1SHFA 4LN2A 5CDWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MRJ A;  2GNC A;  5EHR A;  1T0H A;  3UA7 A;  2K3B A;  1FHS A;  4ZNX A;  1ZSG A;  4NWG A;  3CBL A;  2Y3A B;  3MXY A;  2BZ8 A;  2JYQ A;  2CDT A;  2EGA A;  2DLP A;  2HBW A;  1X69 A;  1O43 A;  2DM1 A;  3PVQ A;  4J9F A;  1SSH A;  2JW4 A;  2EVR A;  3PSJ A;  4DGX A;  1XA6 A;  5KAZ A;  1H9O A;  3UA6 A;  2DL7 A;  4J9C A;  1RQQ C;  3PVL A;  3VRO A;  2KE9 A;  3LH5 A;  3EG1 A;  2MQI A;  4FL2 A;  2DL5 A;  4J9G A;  5AXI A;  2BZY A;  3WA4 A;  2CIA A;  4LNP A;  2A37 A;  3PFV A;  1JEG A;  5D0J A;  4OMP A;  4HVW A;  1LUM A;  2JTE A;  4LE9 A;  2YSQ A;  1F1W A;  1BLK A;  1RLQ C;  4DEX A;  3BUX B;  4M4Z A;  4F17 A;  4Y92 A;  2CUB A;  1E6H A;  1SHB A;  1SHD A;  3BKB A;  1CSK A;  2JS0 A;  2L3P A;  2CH4 A;  2CSQ A;  1O4J A;  3GXX A;  1BLJ A;  5IH2 A;  2M51 A;  1UTI A;  1UDL A;  1H92 A;  1Z3K A;  1O49 A;  2FPE A;  4AG1 C;  4OHE A;  5EG3 B;  2KRM A;  1NZV A;  1X6C A;  3OVE A;  3EG2 A;  2AKL A;  4E68 A;  1JO8 A;  5L23 A;  1ZUY A;  2ESW A;  2JM9 A;  2OJ2 A;  1AOT F;  1SHA A;  2D1X A;  1R1P A;  1YVL A;  1UUR A;  1CWE A;  1O44 A;  3BUO B;  4U17 A;  3OB2 B;  4HVV A;  2KR3 A;  1BKM A;  3THK A;  3S9K A;  2EQI A;  2HCK A;  1W1F A;  1NZL A;  1YCS B;  2C0T A;  1O4E A;  3FJ5 A;  1ABO A;  1D1Z A;  1BBZ A;  1JWO A;  3M0Q A;  2AOB A;  2ROR A;  1E6G A;  1K1Z A;  3EAZ A;  4JE4 A;  1AB2 A;  1YWP A;  2EO6 A;  2F2V A;  1A08 A;  3VGO A;  2AK5 A;  3PS5 A;  1PKS A;  1D4T A;  4L1B B;  3PE0 A;  2DNU A;  4IIO A;  4R0K A;  3BUN B;  1X2Q A;  3M7F A;  3TL0 A;  3VS2 A;  2CRH A;  1AOJ A;  2DF6 A;  4JPB W;  1V1C A;  4EIK A;  2FRW A;  1CKB A;  1A0N B;  2CRE A;  2JXB A;  1SKJ A;  4AFQ C;  2IUI A;  1I1J A;  1BHF A;  4J9B A;  4J9H A;  1FU5 A;  3VRP A;  1ARK A;  1UHC A;  5IHI A;  1O4D A;  2EYV A;  2DIL A;  2LJ3 A;  2L0A A;  3HIZ B;  4H1O A;  5IBM A;  1BM2 A;  2DYB A;  4X6S A;  4J9D A;  4TZI A;  1BB9 A;  2FPD A;  4FSS A;  4OHI A;  2YUO A;  1SRM A;  2C9W A;  5BO4 A;  2O9V A;  1NLP C;  2IUH A;  4OMO A;  3REB B;  1X2K A;  1O4A A;  2DRM A;  4IIM A;  1PRL C;  2LCS A;  1G83 A;  4HXJ A;  3VS5 A;  1M27 C;  3RBB B;  1CWD L;  1UUS A;  2EL8 A;  2LNW A;  5HKZ A;  1M30 A;  1Z9Q A;  2DBK A;  1WYX A;  5FWC A;  4HVU A;  3UF4 A;  1PKT A;  4ORZ A;  1ABQ A;  1AD5 A;  1CJ1 A;  1O4I A;  3NGP A;  4Z89 A;  3M0U A;  1M27 A;  2JS2 A;  1ZFP E;  3I5R A;  3VS0 A;  1MUZ A;  4AG2 C;  2KGT A;  3PSK A;  2KXD A;  1OO3 A;  3TSW A;  3IMJ A;  2J6K A;  1UE9 A;  1NG2 A;  2D8H A;  1QWF A;  2IZV A;  5DF6 A;  5GJV B;  4CC2 A;  2LJ0 A;  1NYF A;  4AFZ C;  1FYR A;  1O45 A;  2W10 A;  1KA7 A;  1O46 A;  2FCI A;  2XMF A;  2DBM A;  4F5B A;  3SEM A;  2O2O A;  2OQ1 A;  1X27 A;  1IJR A;  2A08 A;  1WIE A;  1H3H A;  2Y1N A;  2EPD A;  3IMD A;  3NMZ C;  1MW4 A;  2LMJ A;  4K11 A;  1VA7 A;  2KXC A;  4XZ0 A;  2D8J A;  4RTX A;  3UAT A;  3EHQ A;  1IS0 A;  2RQR A;  2X3W D;  1RJA A;  3VS3 A;  1KFZ A;  2DX0 A;  1Y57 A;  4EIH A;  1YN8 A;  2L2P A;  2L3Q A;  2LCT A;  1M3B A;  1LKL A;  4OMQ A;  4RTV A;  2QMS A;  1ZUK A;  2VIF A;  5FWB A;  2MOX A;  1AZG B;  1SPR A;  4FL3 A;  1X0N A;  4LUE A;  1O4K A;  1B3Q A;  1ZUU A;  2LQW A;  2KEA A;  1FMK A;  3QWX X;  1Z9Z A;  1O4R A;  2HDA A;  2HDV A;  1QAD A;  3TKZ A;  3M0S A;  2HSP A;  1HSQ A;  4JJB A;  4JZ3 A;  3TSZ A;  1WQU A;  2EGE A;  2GTO A;  2YDL A;  2X3X D;  2EYW A;  5IHK A;  1LCJ A;  2H8H A;  1HCS B;  3VRY A;  1LKK A;  3VRQ A;  1X6B A;  1FU6 A;  4GL9 E;  4Z88 A;  1O4L A;  1U06 A;  4K45 A;  2KRS A;  1AYA A;  2MC1 A;  2YUQ A;  1GBR A;  4CC3 A;  4HCK A;  2PLD A;  4FBN A;  1OPK A;  2DE0 X;  3MAZ A;  1BU1 A;  4F59 A;  1YNZ A;  4OMN A;  1A1C A;  1R1S A;  1I07 A;  1WA7 A;  1MV3 A;  2KYM A;  1HD3 A;  1O42 A;  2FRY A;  3EAC A;  1LUK A;  2EGC A;  1D4W A;  2GBQ A;  2KNO A;  4RTZ A;  4A4B A;  1JYQ A;  4J9E A;  3NHN A;  3GXW A;  2ABL A;  1W70 A;  4P9V A;  4DEY A;  2PTK A;  2DL3 A;  3US4 A;  1T3L A;  1FBZ A;  4WWQ A;  1ZLM A;  1FYN A;  4JZ4 A;  1WFW A;  2DLZ A;  5IXF A;  3TVT A;  2J05 A;  1WDX A;  1MV0 B;  5IXB A;  1MIL A;  4CC7 A;  3PQZ A;  1RLP C;  1BFJ A;  4JEG A;  3H0H A;  1AVZ C;  1OPL A;  2RF0 A;  1O4F A;  2O88 A;  2YT6 A;  1TZE E;  2DM0 A;  3IN7 A;  1O41 A;  4Z8A A;  1NEB A;  3A98 A;  1J3T A;  2RQT A;  3C7I A;  2MIO A;  2B86 A;  2GTJ A;  1YWO A;  1SPS A;  2VWF A;  1N5Z A;  1UG1 A;  4JJD A;  1GBQ A;  3QWY A;  1UJ0 A;  4QT7 A;  3S8N A;  1X43 A;  4DGP A;  2FEI A;  2H46 E;  3S8O A;  1QG1 E;  1GFD A;  2K79 A;  3ZL7 C;  2DMO A;  4A63 B;  1O4P A;  1K4U S;  2KRO A;  2M0Y A;  1O4B A;  2L4K A;  4P9Z A;  2GE9 A;  5HKY A;  1P13 A;  1M8M A;  2EYY A;  3OV1 A;  1JQQ A;  1JU5 C;  2GGR A;  1U5S A;  2J7I A;  1YVH A;  4H34 A;  2MK2 A;  3CD3 A;  2CS0 A;  2PNA A;  2DL8 A;  2EYX A;  1A07 A;  4F5A A;  3EGU A;  4OMM A;  1HCT B;  5GJW B;  4X1V A;  3H0I A;  1K9A A;  1CSZ A;  1PHT A;  1TG0 A;  1JU5 A;  1M61 A;  1AYD A;  1M3A A;  2KRN A;  1XOV A;  3H0F A;  4KRT A;  4ESR A;  3CQT A;  1E7O A;  1IO6 A;  1O4O A;  2IUG A;  2LNX A;  2J06 A;  2BTT A;  4AFU C;  5EEL A;  1KC2 A;  3I5S A;  2AZV A;  1BHH A;  3O5Z A;  5IBS A;  2W0Z A;  3EG0 A;  1BF5 A;  2CUD A;  4GLM A;  2ETZ A;  3VS6 A;  2K6D A;  1O47 A;  1UFF A;  1HJD A;  3N8M A;  2KNB B;  2YUN A;  5EHP A;  1NRV A;  1Y1U A;  1QWE A;  2PZ1 A;  2RQV A;  3BUM B;  4F14 A;  1W6X A;  2YU7 A;  2D0N A;  3UYO A;  1AOU F;  1G2B A;  1K76 A;  4GWF A;  4GBQ A;  2K2M A;  2OAW A;  2FG0 A;  2J6F A;  2LQN A;  1F2F A;  1FBV A;  3MXC A;  2DX1 A;  1UGV A;  1JXM A;  1A81 A;  2QDL A;  4K2R A;  1CKA A;  1O4N A;  4JJC A;  4NWF A;  5I6V A;  3VS7 A;  3CXL A;  1GRI A;  2ECZ A;  3EG3 A;  2YUP A;  1GL5 A;  4OHD A;  3PJP A;  2AOA A;  2HDX A;  2F2W A;  2FPF A;  1AEY A;  2DCR A;  2KYB A;  4D8D A;  2DL4 A;  1VYV A;  3K2M A;  2LNH B;  2LP5 A;  1TCE A;  1NLO C;  2P4R A;  3HCK A;  2L3S A;  2K7A A;  1A1B A;  4RTT A;  1GCQ C;  1AZE A;  1SPK A;  2LZ6 B;  3HHM B;  1AWX A;  3M0R A;  2GSB A;  2RMX A;  1JYU A;  2EKH A;  1GHU A;  2SEM A;  1VYU A;  2PNI A;  2RMO A;  3H41 A;  1AWW A;  2PNB A;  5HCK A;  2ED0 A;  1GCQ A;  3OP0 A;  3REA B;  3I35 A;  4D8K A;  1CSY A;  4E6R A;  5IHN A;  2MRK A;  2O31 A;  2CSI A;  2RNA A;  2K9G A;  5ECA A;  2EOB A;  3ULR B;  2EW3 A;  3NPF A;  1B07 A;  1OV3 A;  1BMB A;  2IIM A;  2NWM A;  4RTU A;  2K79 B;  1M3C A;  2CR4 A;  3T04 A;  2XP1 A;  2EO3 A;  2DJQ A;  1NM7 A;  2AZS A;  2ROL A;  2JM8 A;  2DRK A;  1KSW A;  2CI9 A;  1U3O A;  1LUN A;  4U1P A;  2EYZ A;  2LJ1 A;  1SRL A;  3SHW A;  2PLE A;  2V1R A;  3IN8 A;  2MCN A;  2FO0 A;  1ZBJ A;  1O4Q A;  2L6K A;  2KK6 A;  2RN8 A;  1WX6 A;  1GCP A;  2J6O A;  3PLF B;  1AWJ A;  1WXT A;  2YSX A;  1SHG A;  1UEC A;  2CT3 A;  1PNJ A;  2A28 A;  1WXB A;  2LX7 A;  2C0I A;  2BZX A;  1T0J A;  5J3X A;  1RUW A;  2SRC A;  2ROT A;  2ECD A;  4OHH A;  2B3O A;  1JYR A;  2DA9 A;  2JMC A;  1BHH B;  2C0O A;  3KFV A;  1NEG A;  1GFC A;  1BKL A;  2BBU A;  1O48 A;  2O9S A;  2CT4 A;  2E5K A;  2SHP A;  3C0C A;  1A09 A;  5DC4 A;  1T3S A;  4K44 A;  1A1A A;  2RQW A;  2AUG A;  1JXO A;  1AWO A;  1KJW A;  4E93 A;  3OB1 B;  1QLY A;  1PRM C;  1UJY A;  3U23 A;  1AYB A;  1ZX6 A;  2KT8 A;  2RVF A;  1OEB A;  2Y1M A;  3EHR A;  3S8L A;  1LCK A;  4EY0 A;  2OZO A;  2EKX A;  5DC9 A;  3JV3 A;  4CC4 B;  2VKN A;  2CI8 A;  3RNJ A;  3I9Q A;  1O4G A;  1UHF A;  3KFJ A;  5EEQ A;  1UUE A;  1NYG A;  1A1E A;  1X6G A;  1RPY A;  2HMH A;  2AKK A;  4J9I A;  5GJI A;  1K0X A;  1BG1 A;  2RQU A;  1I0C A;  1VYT A;  3VS4 A;  4RTW A;  1K0S A;  4JGH A;  3VRR A;  5I11 A;  1O4H A;  1AYC A;  1PWT A;  2G6F X;  1R1Q A;  5HKW A;  4A4C A;  2F2X A;  1YP5 A;  1EFN A;  1QKX A;  2OI3 A;  4QSY A;  1H8K A;  1Y0M A;  3M0T A;  3GBQ A;  4WCI A;  1BK2 A;  4OML A;  1SEM A;  3VS1 A;  1KIK A;  1WLP B;  2ED1 A;  3VRN A;  4ROJ A;  4LUD A;  2K7A B;  2I0N A;  4AFS C;  2EU0 A;  1PIC A;  2GQI A;  5FW9 A;  2KT1 A;  3M0P A;  1O4C A;  4OHL A;  2DVJ A;  3R6N A;  2DLY A;  2V1Q A;  2HUW A;  2ENM A;  1S1N A;  5EC7 A;  2L3T A;  2HEQ A;  1LUI A;  1TUD A;  2VVK A;  5I22 A;  2CBL A;  5AUL A;  2NUZ A;  1QKW A;  1WI7 A;  4GPL B;  4F16 A;  2EBP A;  2JMA A;  2JT4 A;  3BUW B;  1O4M A;  2H5K A;  3N84 A;  4RTY A;  1QCF A;  1RI9 A;  2RSY A;  3IQL A;  4RUG A;  3GQI B;  5GJH A;  1OOT A;  4XZ1 A;  2CH4 W;  1WXU A;  5DC0 B;  3VRZ A;  3ZNI A;  1I3Z A;  2RPN A;  3CWG A;  3N7Y A;  2A36 A;  1B47 A;  1TUC A;  2KBT A;  1BFI A;  1KA6 A;  1OO4 A;  1SHF A;  4LN2 A;  5CDW A; 
#chains in the Genus database with same CATH topology
 1OI1 A;  2MRJ A;  3WVD B;  2A7Y A;  2EJF A;  4QVC A;  2K3B A;  4ZNX A;  2MWP A;  3VJP A;  3MXY A;  3G71 T;  2EIF A;  3ME9 A;  2R5A A;  1O43 A;  3PVQ A;  2JW4 A;  3I56 A;  1VQK T;  2EVR A;  1YJ9 Q;  3E9G A;  3VYG A;  4J9C A;  2QEX A;  3PVL A;  3CBP A;  5GAO r;  1KD1 C;  5AXI A;  2BZY A;  3WA4 A;  4M75 B;  2CIA A;  1D1C A;  3CC7 Q;  4EMG A;  5D0J A;  4HVW A;  3QDR B;  1UGS B;  1LUM A;  1VQL T;  3JCM h;  1RLQ C;  1QP3 A;  4M4Z A;  3CCJ A;  1AHJ B;  1M2V B;  4F17 A;  1KC8 U;  2K4Y A;  1SHB A;  1SHD A;  3BKB A;  1CSK A;  2JS0 A;  1O4J A;  2CSQ A;  1KD1 U;  1QVG P;  3QKJ A;  1N8R C;  2DD4 A;  1H92 A;  1YHQ A;  2FPE A;  4AG1 C;  3NTI A;  3INZ A;  1NZV A;  3OVE A;  4E68 A;  1VQ9 T;  4DOW A;  2D1X A;  1YVL A;  1O44 A;  4U17 A;  3EG9 B;  3MKD A;  4HVV A;  2KR3 A;  4M7A F;  4C92 B;  2FHD A;  3S9K A;  1K8A R;  5LJ3 d;  2HCK A;  3D7S B;  1N8R U;  2QGG A;  4AMC A;  1O4E A;  1D1Z A;  3G71 A;  2ZCF B;  1Q82 C;  2AOB A;  4L5G A;  1YWP A;  2EO6 A;  4J7I A;  3BDL A;  2F2V A;  1VQK A;  2E1H A;  4M78 C;  4F04 B;  1WHM A;  1U1S A;  2OTJ Q;  1D4T A;  4X9D A;  3LLR A;  5CIU A;  4IIO A;  4XTY A;  3BUN B;  1X2Q A;  3VS2 A;  4JPB W;  1V1C A;  1Q82 U;  2CRE A;  3QZ5 B;  1SKJ A;  2IUI A;  3CCS Q;  1BHF A;  1FU5 A;  5KYX A;  1YIT Q;  1ARK A;  5FU7 B;  1M1G A;  1O4D A;  1WQW A;  2LJ3 A;  4C92 C;  2L0A A;  1BM2 A;  2RO0 A;  2DYB A;  4X6S A;  3E1S A;  1SRM A;  5KYN A;  3QBY A;  1C1A A;  5BO4 A;  2IUH A;  2CZ1 B;  1O4A A;  1VQ9 A;  2LCS A;  4HXJ A;  3VS5 A;  1M27 C;  3RBB B;  2LNW A;  2B8A A;  1Z9Q A;  2DBK A;  1WYX A;  1PKT A;  1CJ1 A;  3CC4 Q;  3NGP A;  3LWI A;  4EPC A;  1M1K C;  2ZPH B;  4GLK A;  3ZFJ A;  3OBY A;  4XAX B;  5FU7 C;  2VC8 A;  3ER0 A;  1OO3 A;  3TSW A;  3IMJ A;  4M7A A;  2IZV A;  5DF6 A;  3RKX A;  2ZAE A;  1M1K U;  5GJV B;  2DBM A;  2X35 A;  4F5B A;  3SEM A;  2O2O A;  1SF9 A;  2QQ9 A;  4DQ2 A;  1H3H A;  2EPD A;  3NMZ C;  2LMJ A;  4K11 A;  2KXC A;  1VQP Q;  4M77 D;  3CXC P;  3FIF A;  4RTX A;  3EHQ A;  2RQR A;  3HRU A;  2DX0 A;  1Y57 A;  2CP0 A;  4EIH A;  3LWH A;  2L2P A;  1HK9 A;  2FZC B;  1ZQ1 A;  1ZA1 B;  3HTR A;  2P4T A;  3V7S A;  5FWB A;  1SPR A;  1X0N A;  1O4K A;  1JJ2 A;  1ZUU A;  2LQW A;  3M55 A;  4N4I A;  1FMK A;  3QWX X;  3CCL Q;  3GP8 A;  1O4R A;  2HDA A;  2BE9 B;  2HSP A;  2GQV A;  1R0C B;  2BKD N;  5IHK A;  1IZ6 A;  1LNX A;  5FLX E;  1X6B A;  4AT1 B;  5KYU B;  5GMK e;  4K45 A;  4B9X A;  2PLD A;  1C6V X;  1OPK A;  2DE0 X;  2QAS A;  1BU1 A;  4E7H A;  5GAO p;  2JVV A;  4F59 A;  4BY6 C;  1ZSZ B;  1R1S A;  1WA7 A;  2KYM A;  4PLL A;  1WHH A;  1O42 A;  3MP8 A;  1LUK A;  1Q7Y C;  1D4W A;  2KNO A;  4RTZ A;  2DD5 A;  3OS0 A;  4HCB A;  5KYW A;  2ABL A;  2XG8 D;  4P9V A;  2E3H A;  4WTO B;  3OY9 A;  4WWQ A;  3CCQ T;  1FBZ A;  2DLZ A;  5DM7 R;  3EGD B;  3M5A A;  2O4X A;  5IXB A;  1Q7Y U;  3PQZ A;  1RL2 A;  1D3B B;  1AVZ C;  1OPL A;  2RF0 A;  4NL2 A;  2YT6 A;  4Z8A A;  1ZSZ C;  3V7R A;  1J3T A;  3C7I A;  4PJO B;  3GNG A;  1SPS A;  3JB9 F;  2E70 A;  3RIR A;  1N5Z A;  1OYX A;  3V8L A;  4JJD A;  1GBQ A;  4QT7 A;  4DGP A;  2PUK B;  3BFM A;  3ZL7 C;  2GF7 A;  1O4P A;  5D6X A;  3JCM P;  2M0Y A;  3JCM V;  1O4B A;  4P9Z A;  5HKY A;  4FT2 A;  1C0M A;  1QQJ A;  3G7Z A;  3OSS C;  2MK2 A;  4H34 A;  4ZN3 A;  4RCB A;  1Q82 R;  4C8Q C;  1FXX A;  5M9O A;  2K5F A;  5I21 A;  1GXI E;  5D6Y A;  3H0I A;  5FU6 B;  4OB3 B;  1M3A A;  2KRN A;  4ESR A;  1QCN A;  1O4O A;  1OX9 A;  1VQ7 T;  2V26 A;  3JAM E;  5J26 A;  5FRN A;  1KC2 A;  3L42 A;  3CCQ A;  2AZV A;  2HMA A;  2NUP B;  2PVD B;  1QVG A;  3EG0 A;  4MMK A;  2MWO A;  4Y28 E;  2ETZ A;  3VS6 A;  1UFF A;  2KNB B;  1FWZ A;  1W2B A;  2DEQ A;  4E7I A;  1ZA2 B;  2YRD A;  4M7D G;  3CMA A;  3OYA A;  2OAW A;  2LQN A;  1FBV A;  2XID A;  2CP6 A;  4JS4 A;  2X4Y A;  4JJC A;  4NWF A;  5I6V A;  2QQA A;  3SDZ A;  2ECZ A;  3VUZ A;  2YUP A;  2DCR A;  4IKF A;  2DL4 A;  1YI2 Q;  1NLO C;  2M16 A;  3HCK A;  2L3S A;  2M9U A;  3EFS A;  2D9T A;  3JB9 J;  3G4S Q;  2EYQ A;  4M78 F;  4QW2 A;  5EG2 A;  1VQ7 A;  2KY9 A;  1MMA A;  1TUG B;  3I55 A;  1B34 B;  5GAO n;  4D8K A;  4BDZ A;  2L3R A;  3X28 B;  1PM3 A;  3A5Z B;  2MRK A;  2CSI A;  3LX7 A;  3ULR B;  1B07 A;  1YIJ A;  4RTU A;  2K79 B;  3RMS A;  4C92 F;  2EO3 A;  1NM7 A;  3A8O B;  4F7U G;  2DRK A;  2CI9 A;  1U3O A;  1LUN A;  2EYZ A;  2LJ1 A;  3OA6 A;  3JB9 D;  1WZO A;  3SHW A;  3OYJ A;  2M0O A;  3TU4 K;  3PLF B;  2E41 A;  2HSE B;  2YXY A;  2YSX A;  3CCV Q;  2A28 A;  1RUW A;  2SRC A;  2ECD A;  1X6O A;  3K2T A;  1OU8 A;  2DA9 A;  2JMC A;  1TWB A;  1BKL A;  4HT8 A;  4PNO A;  2MPX C;  4F7U E;  3C0C A;  1A09 A;  4JLG A;  3OYL A;  2EWN A;  1S72 T;  1TSF A;  4E93 A;  2HL3 A;  3OB1 B;  1K9M R;  1UJY A;  3CME Q;  1QCO A;  2KT8 A;  1VQ6 T;  2RVF A;  3S8L A;  2XIC A;  5DC9 A;  1RI0 A;  4M75 A;  3RNJ A;  1B7T A;  1UGP B;  1A1E A;  3X20 B;  5GJI A;  4M77 C;  4RG2 A;  1BG1 A;  3RR6 A;  1VYT A;  1M2V A;  1K0S A;  3VRR A;  5I11 A;  1O4H A;  3OMG A;  1AYC A;  4M78 A;  1PWT A;  2X4X A;  5LJ5 j;  1YJ9 T;  2VB6 A;  1OX8 A;  6AT1 B;  5HKW A;  2F2X A;  1EFN A;  5GAO q;  4TVR A;  1VQM Q;  1H8K A;  1Y0M A;  4WCI A;  1KIK A;  1BCM A;  1BIB A;  1WLP B;  2ED1 A;  5GAN 4;  1D09 B;  2K7A B;  3EG9 A;  4AFS C;  1UGQ B;  3H9N A;  4C92 A;  4C5H A;  3DB3 A;  1O4C A;  2DVJ A;  5LJ5 f;  1IRX A;  3CBO A;  1S1N A;  2ZPE B;  1VUB A;  4UC4 A;  5EC7 A;  2L3T A;  2HEQ A;  1TUD A;  3M59 A;  1D1A A;  2KGY A;  4EMK B;  1WI7 A;  4GPL B;  4F16 A;  3C94 A;  2EBP A;  4C8Q E;  5GMK l;  4J6W A;  1V29 B;  2JT4 A;  3BUW B;  1O4M A;  1VQ6 A;  3ZEH A;  1OOT A;  4XZ1 A;  3VRZ A;  1I3Z A;  3QG1 A;  2RJF A;  3MCA B;  3PIO A;  3HFO A;  1AD5 A;  4LN2 A;  3OS2 A;  5C6S A;  1N9S A;  3PTA A;  5GAN 7;  1YJ9 A;  2RHY A;  1T0H A;  3UA7 A;  2OTJ T;  1ZSG A;  4NWG A;  1IGU A;  2BZ8 A;  2CDT A;  2EGA A;  2DLP A;  2HBW A;  3CEY A;  1YIT T;  4O6J A;  4OB0 B;  5KAZ A;  2DL7 A;  5FRO A;  3VRO A;  2KE9 A;  3EG1 A;  2O01 E;  2NUT B;  2YHT A;  1JEG A;  2X4J A;  4OMP A;  4Y91 A;  4LE9 A;  2WAC A;  4Y92 A;  1E6H A;  4QKU A;  3JCM e;  2CH4 A;  4C8Q F;  3FDR A;  2M51 A;  3OMC A;  5I2S A;  4PJM A;  1MMG A;  1UTI A;  1O49 A;  1PCX A;  3EG2 A;  2AKL A;  1JO8 A;  5L23 A;  2OJ2 A;  2JM9 A;  2HKN A;  1VIE A;  1EZZ B;  3CCR A;  5GAO l;  2WSE E;  1I4K 1;  1VQ8 Q;  2OTJ A;  1YCS B;  3FJ5 A;  2Z0W A;  2QA4 A;  1BBZ A;  4Z02 A;  2F1L A;  2K5I A;  3MP1 A;  3E19 A;  2OTL Q;  1PSE A;  1M2O A;  2AK5 A;  2LRA A;  5IT9 E;  3CCE Q;  3GOX A;  2OAU A;  2LTO A;  3PIP A;  4J83 A;  1IXD A;  4R0K A;  1A0N B;  1JJ2 P;  5KYU A;  3A1P A;  1RAF B;  4A4G A;  2EYV A;  1NJI R;  1ZSZ A;  4R56 A;  5IBM A;  3QXE B;  4TZI A;  2FPD A;  2LX9 A;  2RI3 A;  2O9V A;  1QW1 A;  4JDS A;  1X2K A;  2LNV A;  2DRM A;  4B9W A;  1H64 1;  3SB2 A;  1UUS A;  2P84 A;  1TU0 B;  2GFU A;  3GIB A;  3EGD A;  3J81 E;  3LW5 E;  3UF4 A;  1WHG A;  4N4G A;  3GLX A;  1D3B A;  4E7Z A;  5KH6 A;  3VS0 A;  1U8R A;  5HK3 A;  3G6E Q;  4XQ3 A;  2RJD A;  2KGT A;  4AG2 C;  2XDD A;  3PSK A;  1YJW A;  3LYI A;  4FCY A;  4PJO A;  1LVK A;  4J7F A;  5CKB A;  1QWF A;  4X34 A;  1M90 U;  2PUO B;  4FYY B;  1I81 A;  4OGE A;  1NYF A;  3MEA A;  3BW1 A;  1O45 A;  2FCI A;  1IGQ A;  3OYH A;  2OQ1 A;  1WIE A;  3GNF B;  3IMD A;  3JCM d;  1RAG B;  3DLM A;  2D8J A;  3UAT A;  4C8Q D;  3O8V A;  3A8H B;  2LCT A;  1M3B A;  1KC8 C;  2MOX A;  4BE2 A;  3M57 A;  2NUP A;  2D0Q B;  4JLI A;  2KQW A;  1Q86 R;  4KH0 B;  3M0S A;  4JZ3 A;  1HSQ A;  3UWN A;  1WQU A;  2YDL A;  2X3X D;  4PJJ A;  2BIV A;  4M77 F;  3VRQ A;  5GAM j;  4JJN K;  4M78 B;  2VUB A;  3L1A A;  4Z88 A;  1FU6 A;  1U06 A;  2GFA A;  1WGS A;  3SWN C;  3H6Z A;  1YNZ A;  2HKQ B;  2BE7 D;  1MV3 A;  4YTL A;  1HD3 A;  1Y7X A;  4E7S A;  1W2B P;  1VQ5 Q;  3S6W A;  3F70 A;  5CK9 A;  2KVQ G;  5GAM f;  2K57 A;  4BI8 B;  4DEY A;  1ACM B;  2IG0 A;  2DL3 A;  1T3L A;  1MNE A;  4QQD A;  4RCC A;  1FYN A;  1WFW A;  5GAN 2;  5IXF A;  1M5Q 1;  3HSB A;  2P0K A;  1YCY A;  4IUR A;  2JNG A;  1B34 A;  2LCL A;  3A98 A;  2RQT A;  4OP0 A;  1VQL A;  1YI2 T;  4ZGD B;  3S8N A;  2H46 E;  1GFD A;  2K79 A;  2DMO A;  3CCU Q;  2KRO A;  2G3R A;  4N0A A;  3G4S T;  1WHJ A;  2KK4 A;  5CKF A;  1P13 A;  3JCM g;  3OV1 A;  3HRS A;  1U5S A;  5A2Q E;  3CD3 A;  2RH2 A;  3LGL A;  2DL8 A;  1A07 A;  4F5A A;  4OMM A;  1G3W A;  4X1V A;  5CKD A;  4M77 A;  1JU5 A;  1M61 A;  1XJW B;  3CQT A;  1E7O A;  1IO6 A;  1OU9 A;  4FU6 A;  4XK8 E;  3O5Z A;  2QG9 B;  1PC0 A;  1VQO Q;  4OF1 A;  3HRT A;  3RES A;  4LDX A;  3VKI A;  1I8F A;  3N8M A;  1KQS S;  4QQG A;  1NRV A;  4ZGJ B;  1QWE A;  2PZ1 A;  2X4W A;  1HXD A;  3BUM B;  3CCV T;  3DKM A;  3QII A;  2PVO B;  2LT4 A;  2K2M A;  2AHJ B;  3MXC A;  1A81 A;  1BIA A;  2QDL A;  4K2R A;  4F7U B;  3T9N A;  5DLO A;  4OHD A;  4BY6 B;  4PJN A;  3PJP A;  2ZGW A;  2HDX A;  2F2W A;  2QTV A;  3PNW C;  3CME T;  1AEY A;  4RKU E;  2FL7 A;  3M56 A;  2QK0 A;  3TCJ A;  1QVF S;  1VYV A;  1TH7 A;  3C4S A;  4C0D B;  1I5O B;  3OYC A;  4C0G A;  2ZPI B;  2K7A A;  2LC4 A;  1SPK A;  3V8K A;  2GSB A;  1JYU A;  2K5L A;  2EKH A;  2DVE A;  5LJ5 h;  3HP9 A;  1GCQ A;  3JB9 H;  8AT1 B;  3OP0 A;  1EIF A;  4E6R A;  4EMK A;  2RNA A;  5ECA A;  1N6A A;  5GAN 5;  2EOB A;  2DTI A;  3FJP A;  3DLL A;  2IIM A;  4A4E A;  2NWM A;  2XD0 A;  3RKY A;  2V8K A;  3T04 A;  1FMV A;  2E10 A;  2DJQ A;  2QQR A;  4NOY A;  2JM8 A;  4L59 A;  1KSW A;  2XHC A;  4C0D C;  2QEX Q;  2F69 A;  4E47 A;  1KC8 R;  3IN8 A;  1KHC A;  1O4Q A;  2KK6 A;  1KD1 R;  1GCP A;  2YLC A;  1AWJ A;  1WXT A;  1UEC A;  2CT3 A;  2MF2 A;  1WXB A;  2C0I A;  4Q5W A;  4C8Q B;  2ROT A;  4JRP A;  2B3O A;  3CCJ Q;  1KK7 A;  2FYK A;  1BHH B;  2C0O A;  3KFV A;  2DKG A;  3OYM A;  2E5K A;  1WHL A;  1IHV A;  2E5Q A;  5DC4 A;  4XTZ A;  4LXC A;  1N8R R;  2RQW A;  1A1A A;  2XI9 A;  1JXO A;  1AWO A;  1QLY A;  3U23 A;  3WVE B;  3WXM B;  3LH0 A;  5A0G A;  3EHR A;  4M75 G;  2EKX A;  1RAC B;  1NBE B;  3JV3 A;  2VKN A;  3GPL A;  1JB0 E;  2CI8 A;  2NUT A;  3I9Q A;  2CKK A;  2VGN A;  1O4G A;  1UHF A;  2DFU A;  4KGV B;  5EEQ A;  1UUE A;  1IRE B;  1RAE B;  4HCC A;  2V8J A;  5KE2 A;  2RQU A;  5D7U A;  3VS4 A;  4JGH A;  1UEB A;  2K3Y A;  4A4C A;  1XNI A;  2KMT A;  3CD6 T;  1QKX A;  4ZTJ A;  1NE8 A;  2OI3 A;  4QSY A;  2L89 A;  2GCX A;  4NL3 A;  3VS1 A;  3RDV A;  3QYH B;  4LUD A;  2VXF A;  1ZHI A;  2I0N A;  2EU0 A;  4IUQ A;  5FW9 A;  3N5B B;  2ATC B;  2ENM A;  1D0X A;  3SD4 A;  4FSX A;  3Q1J A;  5KCO A;  3P8B B;  5I22 A;  3E2U A;  4OB2 B;  1IHW A;  3FEO A;  1NZ9 A;  2JMA A;  8ATC B;  4A53 A;  1Q81 U;  3N84 A;  4E7J A;  1RI9 A;  2DYI A;  3PFS A;  2RJE A;  4R55 A;  1VQ8 T;  5DC0 B;  4BB7 A;  5HY6 A;  2RPN A;  1YFN A;  2EFI A;  1B47 A;  1EX4 A;  1M1K R;  1BFI A;  2DIQ A;  2R5M A;  2CP2 A;  3OS5 A;  3J80 E;  4M7D E;  3CCE T;  2GNC A;  1N27 A;  3CD6 A;  1FHS A;  3CBL A;  2XU8 A;  3CC2 T;  5AT1 B;  2DM1 A;  2NLU A;  4X9C A;  4DGX A;  5LJ3 j;  1H9O A;  1RQQ C;  2MQI A;  3TEE A;  2DL5 A;  2FVU A;  3JRZ A;  4LNP A;  4BAC A;  5DY9 A;  2A37 A;  3CCM Q;  4DBH A;  1VQ4 T;  2DXT A;  1R0B G;  2RHX A;  3BY7 A;  4KUI A;  1BLK A;  2LT1 A;  4DEX A;  4J6X A;  3RUX A;  5LJ3 f;  3KXT A;  4A4K A;  3MP6 A;  2L3P A;  1BLJ A;  2LQ8 A;  5IH2 A;  4M77 B;  1UDL A;  3OYF A;  2LRQ A;  5EG3 B;  2KRM A;  4QQ6 A;  1G3T A;  2RHI A;  1ZUY A;  1OQK A;  2LQK A;  1WJS A;  2ESW A;  1AOT F;  1R1P A;  3BUO B;  1UUR A;  2KAF A;  3OB2 B;  3NTK A;  3SWN A;  3L2V A;  3OYB A;  1ABO A;  4M7D F;  1BKB A;  2DZC A;  1JWO A;  2ROR A;  3CC2 A;  1K1Z A;  4KBM B;  2E6N A;  1Q7Y R;  1A08 A;  3PS5 A;  4P5N A;  1PKS A;  3PE0 A;  2DNU A;  5KYY A;  3TL0 A;  2DF6 A;  1O9S A;  3MEU A;  2IVW A;  3URG A;  1MMD A;  2FRW A;  1CKB A;  1VQ4 A;  4AFQ C;  1I1J A;  3VRP A;  2QXF A;  5IHI A;  2ZPF B;  3OW2 S;  5GAN j;  2E12 A;  3HIZ B;  1I5L A;  3CC7 T;  4J9D A;  1BB9 A;  1NPP A;  1ZBX A;  3AT1 B;  3MPU B;  1NLP C;  1TOV A;  4OMO A;  1SG5 A;  5GAM h;  4IIM A;  1PRL C;  3OSV A;  1G83 A;  3L2Z A;  5J3B A;  3OYG A;  1CWD L;  4L6V 5;  5GAN f;  5FWC A;  3QJY A;  1VIF A;  1S72 A;  1KQ1 A;  4F7U F;  1M27 A;  2JS2 A;  1VQ5 T;  1MUZ A;  4PJO G;  2RHZ A;  2KXD A;  4M75 D;  2D8H A;  3OYN A;  4XTU A;  2WSC E;  2HAX A;  2DAQ A;  4CC2 A;  3RER A;  1KA7 A;  2XMF A;  1X27 A;  3EFR A;  2Y1N A;  1M8V A;  2RA2 A;  3OYE A;  2CYZ B;  2A3L A;  4VUB A;  3CC7 A;  3NFC A;  3GF5 A;  3A8M B;  3CMA Q;  1IS0 A;  3VS3 A;  1KFZ A;  2XKO C;  4PJO E;  3CCS T;  3MJX A;  1YN8 A;  2VIF A;  1ZUK A;  1AZG B;  2MI6 A;  4FL3 A;  1B3Q A;  2DPP B;  2ZZD A;  2KEA A;  4PKC C;  2XDB A;  1Z9Z A;  1D0Z A;  4DBF A;  4GY5 A;  3TKZ A;  3TSZ A;  1QMC A;  2EGE A;  2GTO A;  1LCJ A;  2EYW A;  2MAM A;  2H8H A;  3TQ7 P;  1VQ5 A;  4M7D D;  1BI2 A;  3VYH B;  1D1B A;  4BE1 A;  2Y4Y A;  2F5K A;  3JCM J;  2VXE A;  2KDS A;  4CC3 A;  4HCK A;  3CC4 T;  4FBN A;  3HKS A;  2YLB A;  4V2S A;  4OMN A;  1VQO T;  4OMF B;  2FRY A;  3I55 Q;  3EAC A;  3CPW S;  4F7U A;  2GBQ A;  1R77 A;  1JYQ A;  3HPW A;  4J9E A;  3NHN A;  1KQS A;  1W70 A;  1YBY A;  1K8A U;  3US4 A;  1YIJ Q;  2DTO A;  3UDC A;  4JZ4 A;  2XDP A;  2HD0 A;  2J05 A;  1WDX A;  1MV0 B;  2Y4X A;  3CCS A;  4FW1 A;  1YIT A;  1MIL A;  5CQY A;  4OB1 B;  2EJ9 A;  1BFJ A;  4JEG A;  3H0H A;  1VQP T;  3P8D A;  1O4F A;  2O88 A;  3QJ6 A;  2P0P A;  3JCM X;  3VU3 C;  5IN1 A;  3IN7 A;  1O41 A;  1NEB A;  2B86 A;  5CAI A;  1QVF A;  1YWO A;  2CZ0 B;  3QWY A;  1X43 A;  1H3Z A;  4XTW A;  2P0Q A;  1IB8 A;  3CCL T;  1RAA B;  2L4K A;  2GE9 A;  3CC4 A;  1JQQ A;  3OW2 P;  3A8G B;  4ZGE B;  2DIG A;  2PNA A;  1VQO A;  1Y71 A;  2LVM A;  3EGU A;  1HCT B;  5GJW B;  5GAN 6;  1K9A A;  1PHT A;  1TG0 A;  4C8Q A;  2LNX A;  5CQX A;  2J06 A;  2I2L A;  5EEL A;  3QSU A;  1BI3 A;  1M90 C;  1BHH A;  2K3X A;  5IBS A;  2W0Z A;  3LGF A;  1KQ2 A;  1MMN A;  1BF5 A;  4FYW B;  2CUD A;  4M7A G;  2RB6 A;  1HJD A;  1VQP A;  3JB9 I;  2H3E B;  3QYG B;  3M58 A;  2YU7 A;  3UYO A;  4O5V A;  1AOU F;  1G2B A;  1K76 A;  1MND A;  3TRE A;  3X24 B;  4GWF A;  1W4S A;  7AT1 B;  3CCJ T;  1F2F A;  1JXM A;  4FM4 B;  1CKA A;  4ME7 A;  3SWN B;  3VS7 A;  2D6F A;  1GRI A;  3EG3 A;  3CXL A;  1GL5 A;  4JUV A;  3CCL A;  1R8O B;  3OYY A;  2AOA A;  3FC3 A;  4BE0 A;  4M7A E;  4D8D A;  1VQ6 Q;  3K2M A;  1TCE A;  4KGX B;  3PMT A;  1JRI A;  3HFN A;  3M53 A;  3CXC S;  3NTH A;  2P4R A;  4RTT A;  5HKC A;  3HHM B;  4BUG A;  2EJG A;  5KYY B;  1VYU A;  2PNI A;  2RK1 A;  4PLI A;  1YJN Q;  2RK2 A;  3H41 A;  4ANJ A;  2PNB A;  4A4H A;  5HCK A;  2ED0 A;  1V76 A;  2ZPB B;  1CSY A;  4IUV A;  5IHN A;  5LJ5 e;  2DXB A;  3BE3 A;  1M9S A;  2K9G A;  3AHU A;  2EW3 A;  5LL6 S;  2A0F B;  3PGG A;  5GAN e;  4PJO D;  4JRI A;  4E7L A;  2XP1 A;  3JCM Q;  4A4F A;  1BCO A;  1K73 C;  2VYT A;  4C0Z A;  3S3N A;  2DEU A;  2PLE A;  2FZK B;  1TXQ A;  2MCN A;  2FO0 A;  3CPW P;  2L6K A;  2J6O A;  4MZP A;  1SHG A;  2R58 A;  1PNJ A;  5L8R E;  2BZX A;  1T0J A;  2L5Q A;  1K73 U;  1NEG A;  1GFC A;  3ZBD A;  2O9S A;  2CT4 A;  4K44 A;  4CRI A;  4M75 C;  5GAO m;  2EQM A;  1KJW A;  1OZ3 A;  4PK4 A;  4QVD A;  1AYB A;  1ZX6 A;  1XQH A;  3M54 A;  1OEB A;  2Y1M A;  4NS5 A;  1LCK A;  2COY A;  2OZO A;  4EY0 A;  4HA8 A;  2HZY A;  1D0Y A;  4EDU A;  4M7D B;  2DER A;  4ELZ C;  3CCR Q;  3OYK A;  1NYG A;  3EH2 A;  1X6G A;  2LCC A;  3PT9 A;  2HMH A;  4J9I A;  1AT1 B;  4FW2 A;  5IAY A;  2LDM A;  1I0C A;  1G8X A;  2QA4 Q;  3CPF A;  5LJ3 h;  3E9F A;  2G6F X;  2KI7 A;  3QUI A;  1X75 C;  3M4G A;  2NYS A;  2QQS A;  5A0D A;  3JSC A;  3MHX A;  1BK2 A;  4OML A;  1SEM A;  3VRN A;  4OGC A;  2RJC A;  3CCM T;  3OB9 A;  4ZTF A;  1M4Z A;  2CS7 A;  9ATC B;  1PIC A;  3JCM W;  3M0P A;  4OHL A;  4EMH A;  3R6N A;  4M7D C;  2HUW A;  1Y96 B;  2E3I A;  2DTH A;  3VUB A;  1WQ7 A;  2EAY A;  2CBL A;  1RAH B;  1SKU B;  2JN0 A;  2RI5 A;  4BI3 A;  2VV5 A;  1LOJ A;  1YI2 A;  2H5K A;  3X26 B;  4BD3 A;  1RAB B;  2RSY A;  1RAI B;  3IQL A;  3GQI B;  5GJH A;  3C12 A;  1JBM A;  5LJ5 d;  1TS9 A;  2CH4 W;  1WXU A;  1BYM A;  3G4S A;  5D6W A;  3N7Y A;  5GAN d;  2R57 A;  5GAN 3;  1PSF A;  1M90 R;  1TUC A;  3RMQ A;  3JB9 G;  1KA6 A;  3CBM A;  5CDW A;  4QVZ A;  2IPO B;  5EHR A;  2VGM A;  1VQN Q;  1YJW Q;  4DBQ A;  2M1H A;  2KSS A;  5KCH A;  1WJR A;  2Y3A B;  2JUF A;  3ASK A;  2JYQ A;  3P8H A;  1N9R A;  5LJ3 g;  1X69 A;  3CCM A;  4PJL A;  4J9F A;  1SSH A;  3L2W A;  3PSJ A;  1XA6 A;  5GAN h;  3OW2 A;  2HQH A;  3UA6 A;  1VQM T;  2EQU A;  1NPR A;  3LH5 A;  1X01 A;  4FL2 A;  2QYZ A;  4J9G A;  3OQ5 A;  4HCZ A;  3EGX B;  3PFV A;  3CCV A;  4A54 A;  4M7A D;  2JTE A;  2CP7 A;  2YSQ A;  3I56 Q;  1F1W A;  3HHT B;  3R6O A;  3BUX B;  3J7A F;  2CUB A;  3UT1 A;  3GXX A;  1OZ2 A;  5CVI A;  1Z3K A;  4OHE A;  2E65 A;  1K9M C;  1X6C A;  5J39 A;  4LD6 A;  3KBG A;  3CME A;  2F5T X;  1SHA A;  1BI0 A;  1CWE A;  4IUU A;  2X51 A;  3OS1 A;  1BKM A;  3THK A;  2RM4 A;  3EFO B;  2EQI A;  1YHQ Q;  4J8O A;  1W1F A;  4C5I A;  1NZL A;  2C0T A;  3FB9 A;  1K9M U;  3M0Q A;  1E6G A;  4JE4 A;  3EAZ A;  1AB2 A;  2DXU A;  4KH1 B;  2JZ2 A;  3EH1 A;  3VGO A;  4D6W A;  1K73 R;  2HQX A;  3VV0 A;  1VQM A;  4L1B B;  5I2M A;  3M7F A;  5LJ5 g;  2CRH A;  1AOJ A;  4EIK A;  3G71 Q;  4KUL A;  3CMA T;  4M78 G;  3SFM A;  4FYV B;  2JXB A;  2E64 A;  5GAN g;  1G3Y A;  4J9B A;  4J9H A;  1VQK Q;  5CCA A;  1UHC A;  2DIL A;  4H1O A;  4M75 E;  3A8L B;  4ELY C;  4FSS A;  2FZG B;  4OHI A;  2YUO A;  4RMO A;  2C9W A;  4JS5 A;  4C92 G;  1VQL Q;  3REB B;  2CP5 A;  2COZ A;  1Q81 C;  2C06 A;  2DJZ A;  3X25 B;  4BDY A;  4M78 E;  2EL8 A;  5GAM e;  5HKZ A;  1WJQ A;  1M30 A;  4HVU A;  4ORZ A;  4PL6 A;  1ABQ A;  1O4I A;  4E7K A;  4FIB A;  2HQE A;  4Z89 A;  1KQS P;  3M0U A;  4PJO C;  3CPW A;  1ZFP E;  3I55 T;  1VQ9 Q;  1KHI A;  3I5R A;  3JCM f;  5CO7 A;  2L8D A;  4C92 E;  1QVP A;  2AT1 B;  2J6K A;  1UE9 A;  1YIJ T;  4C5G A;  1NG2 A;  1RAD B;  2AIR B;  2JTF A;  4MDW A;  2OTL T;  1HYO A;  1DJ7 B;  2MYS A;  2LJ0 A;  4AFZ C;  1FYR A;  2W10 A;  1O46 A;  3KUF A;  1Q95 G;  5GAN 8;  4LDV A;  1IJR A;  1QVF P;  2A08 A;  2EQJ A;  5FU6 C;  1MW4 A;  1VA7 A;  4XZ0 A;  1RJA A;  2X3W D;  1KG1 A;  2L3Q A;  1WNL A;  4M75 F;  1LKL A;  4OMQ A;  1MGQ A;  4RTV A;  2QMS A;  2RI2 A;  2PU9 B;  3QZ9 B;  4LUE A;  2FB7 A;  2M02 A;  2WSF E;  4HT9 A;  2HDV A;  4B6M A;  1QAD A;  1FMW A;  4JJB A;  2BUD A;  5GMK h;  1HCS B;  3VRY A;  1LKK A;  2DET A;  5GMK i;  4GL9 E;  3QHS A;  1O4L A;  3S3O A;  5KYX B;  2KRS A;  4C5E A;  3L2U A;  1LJO A;  2YUQ A;  1GBR A;  1AYA A;  4E2F B;  2MC1 A;  1VQ8 A;  3MAZ A;  4OVA A;  1A1C A;  4KT0 E;  1I07 A;  3EAE A;  1UB4 A;  2OTL A;  2EGC A;  4PFO A;  5CR2 A;  3G6E T;  4A4B A;  3CCE A;  3GXW A;  3QPH A;  2HNI A;  2PTK A;  3QO3 A;  2ZPG B;  1ZLM A;  1PD1 A;  1G5V A;  4DA4 A;  3TVT A;  2CGH A;  4CC7 A;  5FRM A;  1RLP C;  2VAS A;  1NJI C;  2K2V A;  5GAM d;  4XU3 A;  1TZE E;  2DM0 A;  4J6Y A;  2E4H A;  4FL6 A;  2MIO A;  2DO3 A;  2GTJ A;  2OX7 A;  2VWF A;  4N0A C;  1UG1 A;  4M7A B;  1UJ0 A;  3CXC A;  4WF2 A;  2FEI A;  3S8O A;  1QG1 E;  1NJI U;  4A63 B;  1K4U S;  1JJ2 S;  2EKO A;  1M8M A;  2EYY A;  3LYV A;  1JU5 C;  2GGR A;  3MET A;  1YVH A;  2J7I A;  4JRQ A;  1YJN T;  1OUL A;  2CS0 A;  2EYX A;  2JTM A;  4CI0 C;  2DZ9 A;  4II1 A;  2QI2 A;  4XU1 A;  3G6E A;  1CSZ A;  1AYD A;  1PD0 A;  4C8Q G;  1XOV A;  3H0F A;  4KRT A;  2IUG A;  3M9Q A;  1WHK A;  2BTT A;  4AFU C;  3OYI A;  3H8Z A;  4IUP A;  3I5S A;  4JRK A;  4M7A C;  1SSF A;  4IUT A;  3OYD A;  2MK5 A;  4GLM A;  2K6D A;  1O47 A;  2YUN A;  4MML A;  5EHP A;  3CCQ Q;  1Y1U A;  3JCM b;  2RQV A;  4F14 A;  1W6X A;  4LDY A;  2D0N A;  4M7D A;  3QDF A;  4KGZ B;  4GBQ A;  2FG0 A;  2J6F A;  1WPY A;  1Q81 R;  4N4H A;  4M78 D;  2DX1 A;  3S3M A;  4PFP A;  1UGV A;  4MDX A;  1O4N A;  3G1J A;  2H3J A;  4KUD K;  1Q86 C;  5KYW B;  4LDU A;  2FPF A;  4MZT A;  2KYB A;  3V7C A;  1YJN A;  2JOY A;  2LNH B;  2LP5 A;  1G3S A;  4C92 D;  3CCU T;  1A1B A;  2O4X B;  3CCR T;  3RKW A;  1GCQ C;  1AZE A;  2LZ6 B;  1AWX A;  3M0R A;  2RMX A;  2DK3 A;  1Q86 U;  5GAM g;  2QA4 T;  1GHU A;  2QDY B;  4EMK C;  2SEM A;  4DOV A;  2RMO A;  1AWW A;  1Y96 A;  3REA B;  3I35 A;  3UPU A;  2JJ9 A;  1U1T A;  3MO8 A;  1K8A C;  4MZM A;  3OBW A;  2YRV A;  2O31 A;  3CD6 Q;  3C95 A;  4RG8 A;  3NPF A;  1OV3 A;  1BMB A;  1VQ7 Q;  5DLQ E;  5C0M A;  3DB4 A;  1M3C A;  2CR4 A;  2AZS A;  2ROL A;  1PG5 B;  3HL8 A;  1QVG S;  4LD9 K;  4U1P A;  2X9H A;  1SRL A;  4XU2 A;  3M4Y A;  4DBR A;  2HL5 C;  2V1R A;  2Y90 A;  4BI4 A;  1ZBJ A;  2RN8 A;  1WX6 A;  1W2B S;  2V8I A;  1MHN A;  4ATO A;  3PMI A;  2LX7 A;  5J3X A;  3FRN A;  4LDW A;  4OHH A;  3MEV A;  1VOM A;  1JYR A;  4XU0 A;  2BBU A;  4PJO F;  1O48 A;  2YWW A;  2CZ7 B;  2SHP A;  2QAZ A;  3CCU A;  1P92 A;  4ZN1 A;  1T3S A;  3V8J A;  2AUG A;  1BI1 A;  1PRM C;  5AYF A;  4HKE A;  4XTX A;  1Y07 A;  2PVG B;  4CC4 B;  2COW A;  3EGX A;  1VQN T;  1YJW T;  2MMP A;  3KFJ A;  3MEW A;  1RPY A;  2RHU A;  2AKK A;  2QTX A;  3JCM c;  1K0X A;  1LPL A;  3FLG A;  4RTW A;  3CC2 Q;  2YRC A;  2PQW A;  4M77 G;  5GMK j;  1R1Q A;  4J5Y A;  2QGF B;  1YP5 A;  4XTV A;  2DXC A;  4FT4 A;  5LJ3 e;  3M0T A;  3GBQ A;  2CZ6 B;  4ROJ A;  2HBP A;  1XTD A;  1F1B B;  1VQ4 Q;  2GQI A;  3I56 T;  1QP2 A;  2KT1 A;  4PFZ A;  5CKE A;  2QEX T;  3EFO A;  2DLY A;  2V1Q A;  3L2R A;  1LUI A;  1FX7 A;  2VVK A;  4M77 E;  5AUL A;  2NUZ A;  1QKW A;  5CKH A;  5A0L A;  4FYX B;  5GMK m;  2XK0 A;  4RTY A;  1QCF A;  4RUG A;  3L2Q A;  2QQB A;  2RD1 A;  1O75 A;  1YHQ T;  1VQN A;  1M1F A;  5HK0 A;  3ZNI A;  2E6Z A;  3BDU A;  4C0F A;  1S72 Q;  3CWG A;  2A36 A;  5KE3 A;  2KBT A;  2CP3 A;  1TTH B;  1OO4 A;  1SHF A;  2EQK A;  1UGR B; 
#chains in the Genus database with same CATH homology
 2MRJ A;  2GNC A;  5EHR A;  1T0H A;  3UA7 A;  2K3B A;  1FHS A;  4ZNX A;  1ZSG A;  4NWG A;  3CBL A;  2Y3A B;  3MXY A;  2BZ8 A;  2JYQ A;  2CDT A;  2EGA A;  2DLP A;  2HBW A;  1X69 A;  1O43 A;  2DM1 A;  3PVQ A;  4J9F A;  1SSH A;  2JW4 A;  2EVR A;  3PSJ A;  4DGX A;  1XA6 A;  5KAZ A;  1H9O A;  3UA6 A;  2DL7 A;  4J9C A;  1RQQ C;  3PVL A;  3VRO A;  2KE9 A;  3LH5 A;  3EG1 A;  2MQI A;  4FL2 A;  2DL5 A;  4J9G A;  5AXI A;  2BZY A;  3WA4 A;  2CIA A;  4LNP A;  2A37 A;  3PFV A;  1JEG A;  5D0J A;  4OMP A;  4HVW A;  1LUM A;  2JTE A;  4LE9 A;  2YSQ A;  1F1W A;  1BLK A;  1RLQ C;  4DEX A;  3BUX B;  4M4Z A;  4F17 A;  4Y92 A;  2CUB A;  1E6H A;  1SHB A;  1SHD A;  3BKB A;  1CSK A;  2JS0 A;  2L3P A;  2CH4 A;  2CSQ A;  1O4J A;  3GXX A;  1BLJ A;  5IH2 A;  2M51 A;  1UTI A;  1UDL A;  1H92 A;  1Z3K A;  1O49 A;  2FPE A;  4AG1 C;  4OHE A;  5EG3 B;  2KRM A;  1NZV A;  1X6C A;  3OVE A;  3EG2 A;  2AKL A;  4E68 A;  1JO8 A;  5L23 A;  1ZUY A;  2ESW A;  2JM9 A;  2OJ2 A;  1AOT F;  1SHA A;  2D1X A;  1R1P A;  1YVL A;  1UUR A;  1CWE A;  1O44 A;  3BUO B;  4U17 A;  3OB2 B;  4HVV A;  2KR3 A;  1BKM A;  3THK A;  3S9K A;  2EQI A;  2HCK A;  1W1F A;  1NZL A;  1YCS B;  2C0T A;  1O4E A;  3FJ5 A;  1ABO A;  1D1Z A;  1BBZ A;  1JWO A;  3M0Q A;  2AOB A;  2ROR A;  1E6G A;  1K1Z A;  3EAZ A;  4JE4 A;  1AB2 A;  1YWP A;  2EO6 A;  2F2V A;  1A08 A;  3VGO A;  2AK5 A;  3PS5 A;  1PKS A;  1D4T A;  4L1B B;  3PE0 A;  2DNU A;  4IIO A;  4R0K A;  3BUN B;  1X2Q A;  3M7F A;  3TL0 A;  3VS2 A;  2CRH A;  1AOJ A;  2DF6 A;  4JPB W;  1V1C A;  4EIK A;  2FRW A;  1CKB A;  1A0N B;  2CRE A;  2JXB A;  1SKJ A;  4AFQ C;  2IUI A;  1I1J A;  1BHF A;  4J9B A;  4J9H A;  1FU5 A;  3VRP A;  1ARK A;  1UHC A;  5IHI A;  1O4D A;  2EYV A;  2DIL A;  2LJ3 A;  2L0A A;  3HIZ B;  4H1O A;  5IBM A;  1BM2 A;  2DYB A;  4X6S A;  4J9D A;  4TZI A;  1BB9 A;  2FPD A;  4FSS A;  4OHI A;  2YUO A;  1SRM A;  2C9W A;  5BO4 A;  2O9V A;  1NLP C;  2IUH A;  4OMO A;  3REB B;  1X2K A;  1O4A A;  2DRM A;  4IIM A;  1PRL C;  2LCS A;  1G83 A;  4HXJ A;  3VS5 A;  1M27 C;  3RBB B;  1CWD L;  1UUS A;  2EL8 A;  2LNW A;  5HKZ A;  1M30 A;  1Z9Q A;  2DBK A;  1WYX A;  5FWC A;  4HVU A;  3UF4 A;  1PKT A;  4ORZ A;  1ABQ A;  1AD5 A;  1CJ1 A;  1O4I A;  3NGP A;  4Z89 A;  3M0U A;  1M27 A;  2JS2 A;  1ZFP E;  3I5R A;  3VS0 A;  1MUZ A;  4AG2 C;  2KGT A;  3PSK A;  2KXD A;  1OO3 A;  3TSW A;  3IMJ A;  2J6K A;  1UE9 A;  1NG2 A;  2D8H A;  1QWF A;  2IZV A;  5DF6 A;  5GJV B;  4CC2 A;  2LJ0 A;  1NYF A;  4AFZ C;  1FYR A;  1O45 A;  2W10 A;  1KA7 A;  1O46 A;  2FCI A;  2XMF A;  2DBM A;  4F5B A;  3SEM A;  2O2O A;  2OQ1 A;  1X27 A;  1IJR A;  2A08 A;  1WIE A;  1H3H A;  2Y1N A;  2EPD A;  3IMD A;  3NMZ C;  1MW4 A;  2LMJ A;  4K11 A;  1VA7 A;  2KXC A;  4XZ0 A;  2D8J A;  4RTX A;  3UAT A;  3EHQ A;  1IS0 A;  2RQR A;  2X3W D;  1RJA A;  3VS3 A;  1KFZ A;  2DX0 A;  1Y57 A;  4EIH A;  1YN8 A;  2L2P A;  2L3Q A;  2LCT A;  1M3B A;  1LKL A;  4OMQ A;  4RTV A;  2QMS A;  1ZUK A;  2VIF A;  5FWB A;  2MOX A;  1AZG B;  1SPR A;  4FL3 A;  1X0N A;  4LUE A;  1O4K A;  1B3Q A;  1ZUU A;  2LQW A;  2KEA A;  1FMK A;  3QWX X;  1Z9Z A;  1O4R A;  2HDA A;  2HDV A;  1QAD A;  3TKZ A;  3M0S A;  2HSP A;  1HSQ A;  4JJB A;  4JZ3 A;  3TSZ A;  1WQU A;  2EGE A;  2GTO A;  2YDL A;  2X3X D;  2EYW A;  5IHK A;  1LCJ A;  2H8H A;  1HCS B;  3VRY A;  1LKK A;  3VRQ A;  1X6B A;  1FU6 A;  4GL9 E;  4Z88 A;  1O4L A;  1U06 A;  4K45 A;  2KRS A;  1AYA A;  2MC1 A;  2YUQ A;  1GBR A;  4CC3 A;  4HCK A;  2PLD A;  4FBN A;  1OPK A;  2DE0 X;  3MAZ A;  1BU1 A;  4F59 A;  1YNZ A;  4OMN A;  1A1C A;  1R1S A;  1I07 A;  1WA7 A;  1MV3 A;  2KYM A;  1HD3 A;  1O42 A;  2FRY A;  3EAC A;  1LUK A;  2EGC A;  1D4W A;  2GBQ A;  2KNO A;  4RTZ A;  4A4B A;  1JYQ A;  4J9E A;  3NHN A;  3GXW A;  2ABL A;  1W70 A;  4P9V A;  4DEY A;  2PTK A;  2DL3 A;  3US4 A;  1T3L A;  1FBZ A;  4WWQ A;  1ZLM A;  1FYN A;  4JZ4 A;  1WFW A;  2DLZ A;  5IXF A;  3TVT A;  2J05 A;  1WDX A;  1MV0 B;  5IXB A;  1MIL A;  4CC7 A;  3PQZ A;  1RLP C;  1BFJ A;  4JEG A;  3H0H A;  1AVZ C;  1OPL A;  2RF0 A;  1O4F A;  2O88 A;  2YT6 A;  1TZE E;  2DM0 A;  3IN7 A;  1O41 A;  4Z8A A;  1NEB A;  3A98 A;  1J3T A;  2RQT A;  3C7I A;  2MIO A;  2B86 A;  2GTJ A;  1YWO A;  1SPS A;  2VWF A;  1N5Z A;  1UG1 A;  4JJD A;  1GBQ A;  3QWY A;  1UJ0 A;  4QT7 A;  3S8N A;  1X43 A;  4DGP A;  2FEI A;  2H46 E;  3S8O A;  1QG1 E;  1GFD A;  2K79 A;  3ZL7 C;  2DMO A;  4A63 B;  1O4P A;  1K4U S;  2KRO A;  2M0Y A;  1O4B A;  2L4K A;  4P9Z A;  2GE9 A;  5HKY A;  1P13 A;  1M8M A;  2EYY A;  3OV1 A;  1JQQ A;  1JU5 C;  2GGR A;  1U5S A;  2J7I A;  1YVH A;  4H34 A;  2MK2 A;  3CD3 A;  2CS0 A;  2PNA A;  2DL8 A;  2EYX A;  1A07 A;  4F5A A;  3EGU A;  4OMM A;  1HCT B;  5GJW B;  4X1V A;  3H0I A;  1K9A A;  1CSZ A;  1PHT A;  1TG0 A;  1JU5 A;  1M61 A;  1AYD A;  1M3A A;  2KRN A;  1XOV A;  3H0F A;  4KRT A;  4ESR A;  3CQT A;  1E7O A;  1IO6 A;  1O4O A;  2IUG A;  2LNX A;  2J06 A;  2BTT A;  4AFU C;  5EEL A;  1KC2 A;  3I5S A;  2AZV A;  1BHH A;  3O5Z A;  5IBS A;  2W0Z A;  3EG0 A;  1BF5 A;  2CUD A;  4GLM A;  2ETZ A;  3VS6 A;  2K6D A;  1O47 A;  1UFF A;  1HJD A;  3N8M A;  2KNB B;  2YUN A;  5EHP A;  1NRV A;  1Y1U A;  1QWE A;  2PZ1 A;  2RQV A;  3BUM B;  4F14 A;  1W6X A;  2YU7 A;  2D0N A;  3UYO A;  1AOU F;  1G2B A;  1K76 A;  4GWF A;  4GBQ A;  2K2M A;  2OAW A;  2FG0 A;  2J6F A;  2LQN A;  1F2F A;  1FBV A;  3MXC A;  2DX1 A;  1UGV A;  1JXM A;  1A81 A;  2QDL A;  4K2R A;  1CKA A;  1O4N A;  4JJC A;  4NWF A;  5I6V A;  3VS7 A;  3CXL A;  1GRI A;  2ECZ A;  3EG3 A;  2YUP A;  1GL5 A;  4OHD A;  3PJP A;  2AOA A;  2HDX A;  2F2W A;  2FPF A;  1AEY A;  2DCR A;  2KYB A;  4D8D A;  2DL4 A;  1VYV A;  3K2M A;  2LNH B;  2LP5 A;  1TCE A;  1NLO C;  2P4R A;  3HCK A;  2L3S A;  2K7A A;  1A1B A;  4RTT A;  1GCQ C;  1AZE A;  1SPK A;  2LZ6 B;  3HHM B;  1AWX A;  3M0R A;  2GSB A;  2RMX A;  1JYU A;  2EKH A;  1GHU A;  2SEM A;  1VYU A;  2PNI A;  2RMO A;  3H41 A;  1AWW A;  2PNB A;  5HCK A;  2ED0 A;  1GCQ A;  3OP0 A;  3REA B;  3I35 A;  4D8K A;  1CSY A;  4E6R A;  5IHN A;  2MRK A;  2O31 A;  2CSI A;  2RNA A;  2K9G A;  5ECA A;  2EOB A;  3ULR B;  2EW3 A;  3NPF A;  1B07 A;  1OV3 A;  1BMB A;  2IIM A;  2NWM A;  4RTU A;  2K79 B;  1M3C A;  2CR4 A;  3T04 A;  2XP1 A;  2EO3 A;  2DJQ A;  1NM7 A;  2AZS A;  2ROL A;  2JM8 A;  2DRK A;  1KSW A;  2CI9 A;  1U3O A;  1LUN A;  4U1P A;  2EYZ A;  2LJ1 A;  1SRL A;  3SHW A;  2PLE A;  2V1R A;  3IN8 A;  2MCN A;  2FO0 A;  1ZBJ A;  1O4Q A;  2L6K A;  2KK6 A;  2RN8 A;  1WX6 A;  1GCP A;  2J6O A;  3PLF B;  1AWJ A;  1WXT A;  2YSX A;  1SHG A;  1UEC A;  2CT3 A;  1PNJ A;  2A28 A;  1WXB A;  2LX7 A;  2C0I A;  2BZX A;  1T0J A;  5J3X A;  1RUW A;  2SRC A;  2ROT A;  2ECD A;  4OHH A;  2B3O A;  1JYR A;  2DA9 A;  2JMC A;  1BHH B;  2C0O A;  3KFV A;  1NEG A;  1GFC A;  1BKL A;  2BBU A;  1O48 A;  2O9S A;  2CT4 A;  2E5K A;  2SHP A;  3C0C A;  1A09 A;  5DC4 A;  1T3S A;  4K44 A;  1A1A A;  2RQW A;  2AUG A;  1JXO A;  1AWO A;  1KJW A;  4E93 A;  3OB1 B;  1QLY A;  1PRM C;  1UJY A;  3U23 A;  1AYB A;  1ZX6 A;  2KT8 A;  2RVF A;  1OEB A;  2Y1M A;  3EHR A;  3S8L A;  1LCK A;  4EY0 A;  2OZO A;  2EKX A;  5DC9 A;  3JV3 A;  4CC4 B;  2VKN A;  2CI8 A;  3RNJ A;  3I9Q A;  1O4G A;  1UHF A;  3KFJ A;  5EEQ A;  1UUE A;  1NYG A;  1A1E A;  1X6G A;  1RPY A;  2HMH A;  2AKK A;  4J9I A;  5GJI A;  1K0X A;  1BG1 A;  2RQU A;  1I0C A;  1VYT A;  3VS4 A;  4RTW A;  1K0S A;  4JGH A;  3VRR A;  5I11 A;  1O4H A;  1AYC A;  1PWT A;  2G6F X;  1R1Q A;  5HKW A;  4A4C A;  2F2X A;  1YP5 A;  1EFN A;  1QKX A;  2OI3 A;  4QSY A;  1H8K A;  1Y0M A;  3M0T A;  3GBQ A;  4WCI A;  1BK2 A;  4OML A;  1SEM A;  3VS1 A;  1KIK A;  1WLP B;  2ED1 A;  3VRN A;  4ROJ A;  4LUD A;  2K7A B;  2I0N A;  4AFS C;  2EU0 A;  1PIC A;  2GQI A;  5FW9 A;  2KT1 A;  3M0P A;  1O4C A;  4OHL A;  2DVJ A;  3R6N A;  2DLY A;  2V1Q A;  2HUW A;  2ENM A;  1S1N A;  5EC7 A;  2L3T A;  2HEQ A;  1LUI A;  1TUD A;  2VVK A;  5I22 A;  2CBL A;  5AUL A;  2NUZ A;  1QKW A;  1WI7 A;  4GPL B;  4F16 A;  2EBP A;  2JMA A;  2JT4 A;  3BUW B;  1O4M A;  2H5K A;  3N84 A;  4RTY A;  1QCF A;  1RI9 A;  2RSY A;  3IQL A;  4RUG A;  3GQI B;  5GJH A;  1OOT A;  4XZ1 A;  2CH4 W;  1WXU A;  5DC0 B;  3VRZ A;  3ZNI A;  1I3Z A;  2RPN A;  3CWG A;  3N7Y A;  2A36 A;  1B47 A;  1TUC A;  2KBT A;  1BFI A;  1KA6 A;  1OO4 A;  1SHF A;  4LN2 A;  5CDW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...