3NHNA

Crystal structure of the src-family kinase hck sh3-sh2-linker regulatory region
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
163
structure length
163
Chain Sequence
DIIVVALYDYEAIHHEDLSFQKGDQMVVLEESGEWWKARSLATRKEGYIPSNYVARVDSLETEEWFFKGISRKDAERQLLAPGNMLGSFMIRDSETTKGSYSLSVRDYDPRQGDTVKHYKIRTLDNGGFYISPRSTFSTLQELVDHYKKGNDGLCQKLSVPCM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tyrosine-protein kinase HCK
publication title Crystal Structure of the Src Family Kinase Hck SH3-SH2 Linker Regulatory Region Supports an SH3-dominant Activation Mechanism.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 31
structure length 163
sequence length 163
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2010-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00017 SH2 SH2 domain
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 3nhnA01
3.30.505.10 Alpha Beta 2-Layer Sandwich SHC Adaptor Protein SH2 domain 3nhnA02
1H8KA 1NEBA 2PNAA 1IJRA 2LJ0A 1QKWA 1UE9A 3VGOA 4A4CA 3R6NA 4OHLA 2K9GA 4U1PA 1O42A 2OI3A 2IIMA 2IUIA 2VIFA 1A07A 2JMAA 2B86A 4LN2A 2W0ZA 2FPFA 2QDLA 4EIKA 2K6DA 3PS5A 5GJHA 1E6GA 2DCRA 4X1VA 4AFZC 2L3TA 4D8DA 4OHHA 1BB9A 3EG3A 1A0NB 1Z9QA 1AD5A 1A1CA 1U06A 2CSIA 4RTYA 3EG2A 2O9VA 5HKZA 1QG1E 3PSKA 1SHFA 1K9AA 4RTUA 2L3SA 2RF0A 2J6OA 2EL8A 1O4IA 4DEXA 2K79B 3C0CA 1GCPA 2YUQA 1O4RA 3OV1A 3VS3A 2KK6A 4ROJA 2FPEA 4P9ZA 4F5BA 1LUKA 2J06A 1X27A 2DILA 2F2WA 1CWDL 2KXDA 4JE4A 5IH2A 3VS1A 2VVKA 4AFSC 5ECAA 2EKXA 2KNBB 3H0IA 1A1BA 5IHKA 5KAZA 2V1QA 4DEYA 1WDXA 2JYQA 1WIEA 3OVEA 2HEQA 2LZ6B 1D1ZA 2EPDA 1NZLA 1RI9A 2AZVA 4H34A 1G2BA 4GL9E 4J9DA 1OPKA 1IO6A 2KEAA 3PE0A 1RJAA 4QSYA 2LNXA 1CSKA 2NUZA 1LCJA 1YNZA 1CSYA 2NWMA 2YSQA 2YT6A 1NEGA 1TUDA 2PZ1A 1R1QA 1X2KA 1O4JA 2RMOA 1R1PA 2FRWA 1BHHA 3GBQA 2LCSA 4IIMA 3U23A 1WYXA 4J9EA 2DLPA 3TKZA 2JMCA 1HCTB 2PLEA 4EY0A 1PKTA 2FRYA 1D4WA 2BZYA 2D0NA 1JYUA 2AUGA 3HHMB 1TUCA 1F1WA 2RVFA 2MC1A 1ZBJA 1O4NA 2DBKA 2HSPA 1D4TA 3M0RA 2AOAA 2E5KA 4OMQA 2LP5A 1QCFA 4K44A 1TCEA 2DL5A 1B07A 2FO0A 1OO4A 2ECDA 4K2RA 3S8LA 2O9SA 4ESRA 1YVHA 3M0QA 3UATA 2J6KA 2YU7A 4HVUA 2RQVA 3IQLA 2CT3A 2D1XA 3NMZC 1K0XA 3EG1A 2KGTA 3PVQA 1JWOA 5HKWA 1WXUA 1AOUF 2CBLA 2K7AA 1X69A 4RTVA 1K4US 2EVRA 1GRIA 2DNUA 2GNCA 3VRYA 2P4RA 3ZNIA 2O31A 2KT8A 1SSHA 1ZUYA 1RPYA 3EACA 1E6HA 1SKJA 4A4BA 5GJWB 2SHPA 1X6CA 2H5KA 5GJIA 2CIAA 3MXYA 3MXCA 2EGAA 4ORZA 4Y92A 3MAZA 3JV3A 1YP5A 1KFZA 5AULA 1UECA 4OHIA 4F14A 1T0JA 3N84A 1BHFA 2ECZA 4CC4B 1VA7A 1O47A 1H92A 1O4QA 3VROA 1MILA 4R0KA 2DYBA 1O49A 2IUHA 1O4DA 3PLFB 2YUPA 3M0SA 1AYDA 1X6GA 5EHPA 4OHDA 3QWYA 1SRLA 2DX1A 3IMJA 4AG1C 1JO8A 2K3BA 1O43A 1X2QA 1AWOA 1T3SA 2KXCA 4HCKA 2EO3A 1OPLA 1QKXA 2L0AA 1O4HA 1FHSA 1SHAA 4JZ3A 1AWXA 1SPRA 1GCQC 1KSWA 1Y57A 2LJ3A 4RTXA 1ABQA 1BU1A 1E7OA 3CBLA 1BFJA 3NGPA 4JJDA 1JQQA 3EHQA 1AEYA 1IS0A 3BKBA 1U3OA 3VRRA 2K79A 2K2MA 2PNIA 1A81A 1YN8A 5IXFA 2EW3A 2RSYA 1RLQC 1WXBA 1BG1A 1JYRA 1YCSB 2DMOA 2EBPA 2DA9A 4NWFA 1UGVA 2JXBA 2X3XD 3REAB 3CWGA 4KRTA 1QWEA 3TSWA 3BUXB 1M27C 1LUNA 1PICA 3M0UA 4X6SA 5I11A 1AYBA 2L3PA 1N5ZA 1UFFA 2LQWA 4J9IA 1BK2A 3H41A 2GSBA 1LKKA 1RLPC 2FG0A 4OMPA 4CC7A 4Z89A 2A37A 2CS0A 2DL7A 1AVZC 2RN8A 4J9GA 1GL5A 2L6KA 1CKBA 3BUMB 1GFCA 4JPBW 1PRLC 1KA6A 2GE9A 3UF4A 4DGXA 1GCQA 2JT4A 5EC7A 1CJ1A 5EG3B 2RMXA 1BFIA 1UHCA 4AFUC 4OMOA 2KE9A 2F2VA 3H0FA 2LJ1A 1ARKA 3I5RA 1ZSGA 2GGRA 2J7IA 3TSZA 5EELA 3VRQA 1M3AA 4TZIA 2PLDA 3THKA 5EHRA 2CH4W 1F2FA 2DL4A 1MW4A 1SHGA 2HCKA 4Z88A 1WLPB 2I0NA 4GBQA 2ABLA 2CSQA 2BTTA 3KFJA 1AYCA 2KR3A 5I6VA 5DC4A 3HIZB 5DC9A 1O4AA 1UG1A 5BO4A 1NLOC 2GBQA 2A36A 3PFVA 1UUEA 1A09A 1M30A 1BKMA 3EG0A 1K0SA 1NG2A 2AK5A 3KFVA 4QT7A 3PQZA 1PNJA 1I07A 2LMJA 1O4PA 1WQUA 4FBNA 4JJBA 1WA7A 3OB1B 2DBMA 1CWEA 3PJPA 2J6FA 2DM0A 2BZXA 2JM8A 1JU5C 4GLMA 2SRCA 4H1OA 4J9CA 1W1FA 1FMKA 3VS5A 1ZUUA 4P9VA 1HD3A 3OP0A 3SEMA 1A08A 4FL3A 2BBUA 2YUNA 1M8MA 4RTWA 2CDTA 3EAZA 2A28A 2O2OA 5EEQA 4OMLA 1U5SA 2SEMA 3UYOA 1UDLA 2Y3AB 3VRZA 1B3QA 1BMBA 1KA7A 1K76A 2F2XA 1GHUA 1O4BA 2XP1A 1BLJA 3O5ZA 4FL2A 3RNJA 5CDWA 3CXLA 1AZEA 1XA6A 3H0HA 2D8HA 4JJCA 1I1JA 5IHNA 2AKLA 2L2PA 2IUGA 1X6BA 1MUZA 2LNHB 5GJVB 4RUGA 1H9OA 4E6RA 4J9HA 1G83A 1SPSA 2QMSA 3GQIB 2OJ2A 1GBQA 1I0CA 1CSZA 2O88A 2CR4A 2PNBA 2C9WA 1Z3KA 2YUOA 1BBZA 1VYTA 2GTJA 2FEIA 1ZFPE 2CUBA 4HXJA 4K45A 1LCKA 3OB2B 2X3WD 1UUSA 4WWQA 2EOBA 2J05A 2HUWA 1WX6A 1WI7A 4LE9A 4M4ZA 1JU5A 1FBZA 4LNPA 2GTOA 3VRPA 1OEBA 5L23A 5DF6A 3VS7A 1QADA 3T04A 3GXXA 2L3QA 3I35A 3VS6A 2JS0A 1VYUA 2AOBA 2DM1A 1O48A 2RQWA 1CKAA 4XZ0A 5IBSA 1Y0MA 3C7IA 2D8JA 1OO3A 2GQIA 2OQ1A 1AYAA 1VYVA 2ROLA 2DVJA 3IMDA 5IBMA 2EYZA 1TG0A 4CC2A 2KRMA 2AKKA 2DJQA 2KYBA 2KYMA 4AG2C 2MQIA 3EGUA 2L4KA 2DRMA 2JW4A 1RUWA 2RQUA 4JGHA 1OV3A 1K1ZA 1X43A 4L1BB 1M3CA 1B47A 1J3TA 1FU6A 2DL8A 1EFNA 3S9KA 1I3ZA 2MIOA 1A1EA 4FSSA 1O44A 2MRJA 2M51A 2JTEA 3FJ5A 4GPLB 4GWFA 2AZSA 3VRNA 3BUOB 4XZ1A 1SHDA 4AFQC 1SPKA 1HJDA 2ROTA 4F59A 1O4OA 2MK2A 1MV0B 4RTTA 1JXOA 2EYXA 3N7YA 4EIHA 1YWOA 3QWXX 5IHIA 5FW9A 3IN7A 1HSQA 2KRSA 2VKNA 1WXTA 2FPDA 1LUIA 1YWPA 5FWBA 3VS0A 2JM9A 3CQTA 1AWWA 1ZLMA 1JYQA 2Y1NA 3CD3A 3BUWB 3VS2A 1W70A 2RQRA 4F16A 1AZGB 2DF6A 4IIOA 1ZUKA 3UA6A 2CI8A 2HDXA 2EQIA 2MCNA 1O4KA 2CH4A 2CUDA 1YVLA 2LX7A 4A63B 1O4GA 2KRNA 2EKHA 2DL3A 2EU0A 1QLYA 3EHRA 2FCIA 3PSJA 1PWTA 1T0HA 4LUEA 2RNAA 1O4MA 1FYRA 3S8NA 2KNOA 1NZVA 3TL0A 2EGCA 1KIKA 1M27A 3SHWA 2PTKA 2CRHA 2VWFA 1KC2A 2ETZA 1RQQC 3A98A 1FU5A 1LKLA 2BZ8A 1BKLA 2V1RA 5IXBA 2C0TA 4CC3A 3NPFA 5FWCA 1O4EA 4U17A 4WCIA 1UTIA 1LUMA 2HDVA 1R1SA 1W6XA 5J3XA 3UA7A 1SEMA 1HCSB 1T3LA 3RBBB 3ULRB 1Y1UA 2DE0X 2Y1MA 1PKSA 2KT1A 2OAWA 1AWJA 4HVWA 4J9FA 1ABOA 1O45A 3PVLA 2B3OA 1JEGA 1A1AA 3WA4A 1AB2A 1PRMC 1Z9ZA 2CT4A 2DX0A 2OZOA 1GBRA 2A08A 4JZ4A 5D0JA 3REBB 2EYWA 2DRKA 4RTZA 1TZEE 3S8OA 3M0TA 3BUNB 2W10A 1O4CA 1JXMA 1O46A 3HCKA 1UJYA 2LNWA 4F5AA 2KBTA 1NLPC 4DGPA 4E68A 4HVVA 2ED0A 4K11A 2H46E 1SRMA 1WFWA 2EYYA 4OHEA 1O4FA 1FYNA 4J9BA 1UJ0A 1M61A 2CREA 1BHHB 1FBVA 3US4A 1UURA 3I9QA 3M0PA 2EYVA 5HKYA 3GXWA 3TVTA 1H3HA 1AOJA 5I22A 2YDLA 1NYFA 1NYGA 3K2MA 3ZL7C 2HMHA 2LCTA 2ESWA 5DC0B 1GFDA 2DLZA 2JS2A 1M3BA 2MOXA 1PHTA 2M0YA 3N8MA 1UHFA 4JEGA 1XOVA 5HCKA 2XMFA 4D8KA 1O41A 1MV3A 1P13A 2EGEA 3NHNA 4ZNXA 1BM2A 3I5SA 4Z8AA 1ZX6A 3IN8A 1V1CA 2ED1A 1S1NA 4OMMA 1SHBA 1NM7A 2HBWA 2CI9A 2G6FX 1X0NA 2RQTA 2LQNA 2K7AB 2RPNA 2IZVA 2DLYA 3VS4A 2RORA 4E93A 3LH5A 1QWFA 4LUDA 3M7FA 1AOTF 2HDAA 2EO6A 1OOTA 4F17A 2MRKA 1BF5A 2H8HA 1O4LA 1KJWA 4OMNA 2ENMA 2YSXA 1NRVA 4NWGA 2C0OA 1BLKA 5AXIA 2KROA 2C0IA
chains in the Genus database with same CATH superfamily
4ZGEB 2LJ0A 3VGOA 1W2BA 3G1JA 3O8VA 4WF2A 2HAXA 1JRIA 3CCET 2P0QA 2IUIA 3RKXA 1A07A 1G3TA 4LN2A 2FPFA 4PJOG 4EIKA 3PS5A 1E6GA 4QQGA 5D6WA 4OHHA 3G6ET 1M90R 3OYGA 4KT0E 1YITA 3CBPA 3EG2A 2O9VA 4RTYA 5HKZA 4OF1A 3CPWA 2EAYA 1K73R 1QG1E 2WSFE 1K8AR 2A7YA 1WJRA 2PVDB 3CCQQ 3EH1A 3OYIA 2KDSA 2RF0A 1O4IA 3QKJA 3P8HA 3CMAA 1WJQA 3VS3A 4ROJA 3CCJA 2HNIA 2PQWA 1LUKA 1X27A 5IH2A 1VOMA 5GAOn 2DXBA 2VVKA 4AFSC 5D7UA 1NBEB 2KNBB 3P8DA 4ZN1A 5IHKA 1VQLQ 3DB4A 5CKEA 4OP0A 2RJDA 2HEQA 1D1ZA 1N8RC 2EPDA 3J7AF 1RI9A 4FM4B 4QVCA 2YWWA 1ZSZC 1IO6A 4F7UA 2LNXA 1LCJA 2NUZA 1CSYA 1NJIU 4IKFA 2OTJQ 2DPPB 1R1PA 3G7ZA 4M77A 1WYXA 2DERA 4J9EA 5HK0A 2M9UA 1HYOA 4EY0A 3HRSA 1YBYA 1F1WA 2NUPB 2E6NA 1M1FA 2AT1B 1D4TA 3M0RA 2AOAA 2MF2A 1TCEA 5DLQE 3X24B 2FO0A 4A4EA 1OO4A 1MMDA 1YVHA 2YU7A 3ZEHA 2QGFB 3IQLA 1VQ7A 2P0PA 3PVQA 1X69A 2EVRA 5GANe 2FVUA 2DNUA 4HT9A 1SSHA 1WHJA 4J7IA 3EACA 2ZAEA 1BIBA 4C5IA 4B6MA 5GJWB 4E7KA 5GJIA 1D0XA 3JV3A 1YP5A 2RO0A 5AULA 1UECA 4OHIA 2MI6A 1HXDA 1T0JA 5KH6A 1O4QA 2DYBA 2IUHA 1WHKA 4XTVA 4M7AA 3OSSC 4C8QG 4M7DD 4XU1A 1VUBA 2K3BA 1AWOA 2OTLQ 3JCMh 1K8AU 1OPLA 1O4HA 2MWOA 2GCXA 1SHAA 2RHIA 4JZ3A 1SPRA 1KSWA 3CCRT 4FU6A 5LJ5e 1BU1A 4BACA 5CKDA 2MPXC 3BKBA 2K2MA 4M7DF 1D0YA 4GY5A 5IXFA 1VQOQ 1RLQC 2CP3A 1YCSB 2E41A 4X9DA 5LJ3e 3OYAA 2X3XD 3QDRB 1PSEA 1LUNA 1PICA 3M0UA 1G3YA 1AYBA 2L3PA 2LQWA 2RJFA 4J9IA 4EMKC 4CC7A 2A37A 5L8RE 1I8FA 1Q81C 1CKBA 2HMAA 3BUMB 1GFCA 4DBRA 2GE9A 3UF4A 4DGXA 1GCQA 2QGGA 2DXUA 4PJNA 3FIFA 2GQVA 4AFUC 2F2VA 1M1KC 1ARKA 3VV0A 2GGRA 3CCMT 1W4SA 5GANj 1I4K1 4TZIA 3THKA 4DOVA 5EHRA 5GAMf 4RKUE 5KYUB 1F2FA 1MW4A 2XKOC 3NTKA 1KC8C 2BTTA 1UB4A 1AYCA 3QUIA 5I6VA 3GP8A 3HIZB 4KH0B 1O4AA 1UG1A 1DJ7B 1WJSA 2A36A 4XTUA 2AK5A 3H8ZA 5KYYB 1N8RR 1PNJA 1I07A 3VU3C 3ER0A 2X4YA 3OB1B 2DZCA 3CCQT 1JU5C 4J6XA 4N4HA 3CC2A 1ZUUA 4P9VA 4FL3A 1QVGP 1M8MA 5EEQA 1OQKA 4OMLA 4OVAA 1B3QA 3C95A 2F2XA 1GHUA 5LJ3j 3O5ZA 3RDVA 3RNJA 2CYZB 3CXLA 1M5Q1 2LTOA 4JJCA 1B34B 1I1JA 1TWBA 4C5HA 3H9NA 2LNHB 2QQSA 2ZGWA 3E1SA 4JRKA 1I0CA 2E70A 2O88A 2DXCA 1VQ9Q 2FEIA 1ZFPE 5GAMh 2X3WD 2J05A 4LDUA 2OTJT 2RI5A 4M75C 4LE9A 2JVVA 2PVOB 5GAN5 3VYGA 3BE3A 2KAFA 5KE2A 4BI3A 1QADA 2L3QA 3I35A 3VS6A 2JS0A 1ZA2B 2DM1A 5GAOl 1O48A 2KGYA 2RJCA 1CKAA 2JUFA 4QQ6A 3JCMg 3C7IA 3FJPA 2ROLA 5D6YA 3CCUA 2RHUA 1TG0A 4CC2A 3A8OB 2KRMA 2MQIA 2DRMA 4C0FA 4JGHA 2H3EB 1M3CA 4E47A 1J3TA 3S9KA 2D9TA 1A1EA 1F1BB 1M2VA 3CCSQ 3G71Q 3FJ5A 8ATCB 2A3LA 1X6OA 1D1BA 4XZ1A 4C92E 4F59A 4JLGA 2CS7A 2MK2A 4RMOA 2LDMA 2DO3A 2CKKA 1YWOA 2PUOB 2LQ8A 5FW9A 5GAOp 3IN7A 2KRSA 1WXTA 5FWBA 2A0FB 2JM9A 2JTMA 3TREA 1ZLMA 1TXQA 4QVDA 5IT9E 3BUWB 1W70A 2RQRA 1FMVA 3QO3A 3UA6A 3MEAA 4XTWA 2MCNA 2CI8A 3NTHA 2NUPA 1UGSB 1O4GA 1KQSP 2EU0A 1Q81R 1QLYA 3EHRA 2FCIA 3PSJA 1Q82C 2RNAA 1FYRA 4LD6A 2F1LA 3CCVA 3RESA 2X4JA 1JJ2P 2ETZA 3QZ5B 1FU5A 1M1KR 5IXBA 3CD6Q 4CC3A 1LUMA 1W6XA 4OB0B 1SEMA 1HCSB 4C92D 5KE3A 2HQEA 5KCOA 2ZPFB 2Y1MA 4L59A 2BIVA 2OAWA 1AWJA 2QQAA 2RK1A 1KC8R 4XTZA 1O45A 2DTHA 5KCHA 2FZCB 1WHGA 1R8OB 1JEGA 2R58A 3FEOA 1Z9ZA 2CT4A 2XIDA 1BKBA 3E9GA 2OZOA 3QZ9B 2DEUA 4X9CA 3QJ6A 3CC2Q 3M0TA 4PJOC 3I56T 2XDBA 4IUQA 1C0MA 1UGRB 2COYA 4F7UB 4DGPA 2EYQA 3JCMb 2ED0A 4K11A 2QYZA 1Y71A 2YHTA 1FYNA 4FYWB 4KGXB 4M77B 3PGGA 2RJEA 4M77G 4M78B 3V8LA 3TVTA 1H3HA 1AOJA 2HMHA 2LCTA 4WTOB 2DYIA 1GFDA 1QVGS 1WPYA 2K5IA 1EX4A 3OA6A 2VB6A 2BE7D 5GAMg 2XMFA 4D8KA 1MV3A 3NHNA 2E6ZA 4ZNXA 3I5SA 1ACMB 4Z8AA 3JCMQ 1ZX6A 4OMMA 1TH7A 4QQDA 1V1CA 1JBMA 3X25B 5HKCA 1NM7A 3CMEQ 1C6VX 2HKQB 5CIUA 3OYLA 1HK9A 1RABB 4LXCA 2E1HA 3H6ZA 1QQJA 2R57A 1BF5A 3NTIA 3OYKA 2C0OA 4NWGA 1RAAB 2DD4A 2F5TX 3SFMA 4O5VA 1NEBA 2PNAA 4BE1A 4A4CA 5FROA 3R6NA 2VGNA 4M7AB 4OHLA 4A53A 5AYFA 4U1PA 2IIMA 2VXFA 3EFOA 2VIFA 2JMAA 2VUBA 1VQNQ 3PMIA 4FIBA 5GAMe 4X1VA 2DCRA 1A0NB 3EG3A 1Z9QA 3G4SQ 2JOYA 1VQ9T 4HA8A 2DTOA 4RTUA 1V29B 2L3SA 4HCCA 1FXXA 4DEXA 2PUKB 1O4RA 3A8HB 1KD1C 4QVZA 2FPEA 4P9ZA 5CR2A 2ZCFB 5GMKe 1WQWA 2F2WA 4JE4A 4P5NA 3ZBDA 2MAMA 4C92A 3H0IA 3FB9A 4C8QC 2JYQA 1FMWA 3OVEA 2LZ6B 3FLGA 4BB7A 1NZLA 4ZTFA 3EGDA 1IHWA 1N9RA 4XU2A 2YXYA 3PE0A 1CSKA 3AHUA 2NWMA 4YTLA 1B34A 1BYMA 2XDPA 4MZMA 1VQ8A 2PZ1A 1Q82R 4KUDK 1X2KA 3CCST 2X51A 3G71T 2RMOA 1OI1A 1BHHA 1EIFA 4E7LA 3U23A 2DLPA 2FHDA 1KQSS 1VQ6Q 1HCTB 1PKTA 2BZYA 4HCZA 1JYUA 2RVFA 1ZBJA 2DBKA 2VGMA 1JJ2S 4OMQA 3MEWA 3C12A 1YJ9A 2ECDA 2O9SA 2BUDA 4M78D 4ESRA 2J6KA 3CCLA 1QCNA 2CT3A 3NMZC 3EG1A 2KGTA 4BDYA 1AOUF 2CBLA 1P92A 4C0GA 4F7UF 2C06A 3VYHB 5A0GA 1ZUYA 1RPYA 1D3BA 4BE2A 5IN1A 2EGAA 1QVFA 3CD6T 1UGPB 4FT4A 2ECZA 4M78F 4CC4B 1O47A 1H92A 2YUPA 2LNVA 1X6GA 3LX7A 5EHPA 3QWYA 4OB3B 1VQPQ 1G3SA 1O43A 1X2QA 3LLRA 2CP7A 2O4XA 4J83A 2EJGA 2EO3A 2L0AA 1SG5A 2EQJA 3SWNA 4M7DG 4M7AD 1G3WA 3OMCA 4A4GA 2QEXQ 3CBLA 3PFSA 3CC2T 2XI9A 1JQQA 3JCMP 3EHQA 1K9MC 4M75E 2K79A 2QTXA 3I55Q 3CC4Q 2EW3A 2EQKA 2RSYA 1YI2A 4IUVA 4B9WA 2EBPA 2DIQA 2GFUA 1VQ4A 3CWGA 1QWEA 4M7AF 1BK2A 3H41A 1PG5B 4JRPA 2GSBA 4OMPA 2FG0A 4HKEA 2RN8A 4J9GA 1OYXA 1GL5A 1ZA1B 2P84A 3QXEB 2L6KA 3X28B 3MO8A 2RI3A 1PRLC 1KA6A 3A5ZB 2LRQA 4LDXA 1BFIA 3CMET 3R6OA 2LJ1A 5DM7R 4A4HA 2J7IA 1KQ1A 1I5OB 3EGXA 1YHQQ 1YJNA 1M2VB 3CXCA 3L42A 2CH4W 5GANd 2DL4A 2FB7A 1SHGA 1KD1R 2ATCB 3C4SA 4GBQA 2ABLA 3JCMf 3UPUA 1XJWB 1PD1A 2YRVA 5DC9A 4Z02A 3TU4K 3PFVA 4M78A 8AT1B 1VQNT 5CAIA 1NG2A 3VUBA 4E7HA 1WQUA 3G4ST 1WA7A 1PM3A 1YCYA 2BZXA 2JM8A 2CGHA 2SRCA 4ANJA 1W1FA 2DK3A 5LJ5d 3UT1A 2K5LA 1U5SA 2SEMA 1EZZB 3VRZA 1KA7A 1YJ9Q 5CO7A 3M9QA 3X20B 1M2OA 5GAN3 3CC7Q 4MZPA 1XA6A 3H0HA 2D8HA 2RD1A 5LJ3d 5IHNA 1MUZA 2QMSA 4RUGA 2OJ2A 4PJOE 2C9WA 1MGQA 1BBZA 1VYTA 2CZ7B 4HXJA 1YJWA 2DAQA 3MCAB 4K45A 3M56A 1M90U 1UUSA 2CP6A 2KQWA 4RG8A 4XAXB 2QA4A 1K73U 2DTIA 4M4ZA 1JU5A 4LNPA 2GTOA 3MP1A 1VQ6T 3VS7A 3GXXA 4OB2B 3LYVA 3M57A 1S72Q 1VYUA 3V8KA 2MMPA 1Y0MA 3F70A 1OO3A 2DEQA 4N0AA 2EYZA 5GAN8 5J39A 2AKKA 2DJQA 2KYBA 4II1A 4PLLA 4AG2C 3GIBA 1I5LA 1RUWA 1OV3A 4PFOA 5CK9A 1I3ZA 2MRJA 1SKUB 2L5QA 1K9MR 3LH0A 2AZSA 4OMFB 1YITQ 3K2TA 4M75A 1O4OA 4AMCA 3EFRA 3AT1B 3OYYA 1IZ6A 1MV0B 1N9SA 4RTTA 1VQKA 5IHIA 4MMKA 4KGZB 1HSQA 3CMAQ 5KYWA 2CZ6B 1VQPT 2V8JA 2L3RA 4M77C 1AWWA 5FU7B 3CCJQ 2RHXA 1JYQA 3VS2A 3LGLA 4F16A 1AZGB 3HP9A 2EKHA 3EFOB 2FZKB 3M55A 2QEXT 4PNOA 5GAN7 1O4MA 1NZVA 2E64A 1MMGA 1KIKA 3URGA 1M27A 2PTKA 1Y96B 2CP5A 3SB2A 3C94A 3I55T 3CC4T 1KC2A 2LVMA 4B9XA 2VXEA 2BZ8A 1BKLA 1BI1A 2NLUA 1VQMA 2C0TA 4U17A 1Q86C 2L8DA 2HDVA 3UA7A 3OBYA 1Q7YC 3ULRB 2DZ9A 3A8GB 3PIOA 4C8QE 1PKSA 4HVWA 4A54A 5LJ5j 4J9FA 2WSCE 1R77A 3VUZA 1A1AA 4C92B 1RI0A 2DX0A 2ZPGB 1KK7A 5D0JA 2EYWA 2DRKA 4MMLA 2E4HA 1TZEE 4FCYA 2F69A 3BUNB 2X4WA 1OULA 2W10A 3MPUB 1VQLT 2QDYB 3A8LB 3EGDB 1O46A 1VQ7Q 3JB9J 5A0DA 1VQ5A 2CP2A 3DLMA 2H46E 1YHQT 3QBYA 3FC3A 4OHEA 1IRXA 1M61A 2CREA 1BHHB 4XTYA 3CCEA 1RAFB 1UURA 4F04B 5GAOr 5CKFA 2EYVA 5HKYA 3GXWA 2YDLA 4J6WA 4OGCA 3G6EA 4ZTJA 3ZL7C 3ZFJA 4C8QD 2XK0A 2X9HA 2DLZA 3OQ5A 3N8MA 1PHTA 2AHJB 1K9MU 1UHFA 2QXFA 4C0ZA 3A1PA 3L2QA 3L2RA 4XK8E 3OYEA 1BM2A 4OB1B 2EQUA 3PNWC 2HBWA 2GF7A 2LQNA 2XG8D 4E7JA 4PJOA 2DLYA 3RIRA 3VS4A 2QK0A 4J8OA 1QWFA 4LUDA 1D3BB 2E5QA 2EO6A 4F17A 2H8HA 1KJWA 2ENMA 2YSXA 1NRVA 4C5EA 5AXIA 2KROA 2VC8A 5KYXA 3OYBA 1H8KA 1YJ9T 1QKWA 1UE9A 2K9GA 1O42A 2OI3A 3CC7T 4J7FA 3TQ7P 2K6DA 2RH2A 2O4XB 4D8DA 2D0QB 1BB9A 1W2BP 5FRNA 2CSIA 4N4GA 3SWNB 3JCMe 1N8RU 3PSKA 5LL6S 3HKSA 2K3YA 3V8JA 2OTLT 2J6OA 2OX7A 2EL8A 2K79B 3C0CA 1GCPA 3OV1A 3CPWP 4F5BA 3LGFA 2J06A 1S72T 3V7RA 3VKIA 4BY6B 3PMTA 1CWDL 3VS1A 5ECAA 2V1QA 1VQOT 2Z0WA 4DEYA 5I21A 1WIEA 5J3BA 3QYGB 1U8RA 1G2BA 4J9DA 1OPKA 4PJMA 1RJAA 4QSYA 3PTAA 1BCOA 4M7DC 1YNZA 2YSQA 2YT6A 3OYHA 4PJJA 1R1QA 4L5GA 4IIMA 1YITT 2JMCA 2PLEA 3BFMA 2DVEA 2LT1A 3EGXB 5A2QE 3HHMB 1TUCA 1Q86R 4V2SA 2MC1A 3CCRA 4C92F 2QASA 1O4NA 3QDFA 4DA4A 5FU6B 1Q7YR 2MK5A 3CMAT 2E5KA 2LP5A 1QCFA 4K44A 2QG9B 1PD0A 2DL5A 4LDVA 3CCJT 1B07A 4F7UG 1PC0A 4K2RA 3M0QA 4HVUA 4DOWA 4C8QA 1NPRA 2Y4XA 2V26A 1JWOA 1RAGB 3JCMJ 2K7AA 3E2UA 4RTVA 1K4US 2EFIA 4EMKB 1GRIA 2GNCA 3T9NA 3VRYA 4PKCC 4DBFA 2KT8A 6AT1B 1NZ9A 4M78G 3DLLA 3X26B 2SHPA 3HRTA 2CIAA 3MXYA 3DKMA 4ORZA 3GNFB 3MAZA 1TU0B 1KFZA 3QHSA 3PT9A 5GAMd 3N84A 1BHFA 1VA7A 3KUFA 2LQKA 3M0SA 2EIFA 1AYDA 2DX1A 3IMJA 2DFUA 2E3HA 3CPFA 1JO8A 3CEYA 1T3SA 5J26A 2QTVA 3JCMW 1KHCA 1QKXA 1FHSA 2OAUA 4EDUA 2LT4A 1Y57A 4KGVB 3CCMA 4RTXA 1ABQA 1FWZA 1WHLA 1BFJA 1YIJA 4O6JA 3NGPA 5GANf 3CCUQ 1LOJA 4UC4A 1IS0A 1Q81U 2KMTA 1U3OA 1VQ7T 3VRRA 2PNIA 1A81A 3OYNA 1YN8A 4M7AG 1BG1A 1JYRA 7AT1B 5D6XA 4NWFA 3L2ZA 2JXBA 1M1KU 3HSBA 1U1TA 1Y96A 1K8AC 2DD5A 1N6AA 3OW2S 1N5ZA 1PSFA 1LKKA 3BDLA 3M4YA 3SDZA 2DL7A 1XNIA 1KC8U 1H3ZA 3CCQA 2CP0A 4JS5A 4JPBW 3V7CA 4NL3A 2HL3A 4JRQA 5EC7A 3LWHA 1CJ1A 1UHCA 2KE9A 2JNGA 4ZN3A 2FL7A 1TS9A 3TSZA 4ATOA 1D1AA 2RA2A 5EELA 3HHTB 5LJ3f 2PLDA 1W2BS 2LCCA 2LC4A 4CI0C 4EMHA 3CCVQ 3QSUA 1WLPB 1Y07A 4M75B 5A0LA 1MMNA 3KFJA 4M77E 2KR3A 1WZOA 1PCXA 5GANh 5DC4A 3CBOA 3BDUA 5BO4A 1NLOC 2GBQA 1ZQ1A 5KYWB 2MWPA 3CPWS 1M30A 2XD0A 2OTJA 2XHCA 3PQZA 1O4PA 2QQRA 3JB9H 4XU3A 1QVGA 1MHNA 2QQ9A 2J6FA 4GLMA 2LX9A 4H1OA 1IXDA 4RG2A 1WNLA 4J9CA 2XICA 3VS5A 1HD3A 2E3IA 3OP0A 3SEMA 2BBUA 2YUNA 4RTWA 2CDTA 3CCRQ 2HD0A 3UYOA 4A4KA 1BMBA 1ZSZA 2M1HA 1K76A 4BI8B 1O4BA 2XP1A 2KVQG 1G8XA 5LJ5h 2HQHA 5GAMj 4BI4A 2V8KA 1BI2A 5CQXA 2B8AA 3OS5A 5I2MA 5GJVB 3RKYA 4J9HA 1G83A 1CSZA 5FU7C 4TVRA 1QMCA 2EWNA 5LJ3h 4ELYC 1QP3A 2CUBA 3OB2B 4WWQA 2CZ1B 2NUTA 1ZHIA 5GMKj 1WI7A 2WSEE 2HZYA 4N4IA 1NE8A 4CRIA 2M0OA 4LDYA 2KY9A 2EKOA 2AOBA 1RAEB 4XZ0A 3MP6A 4FYYB 3HL8A 2OQ1A 2BKDN 1AYAA 1TSFA 1VYVA 2DVJA 1OX8A 3IMDA 3QJYA 1YIJQ 3KBGA 4A4FA 3JB9D 2HL5C 2L4KA 4QW2A 1KHIA 1LVKA 4L1BB 1B47A 1FU6A 2DL8A 3DB3A 2MIOA 4FSSA 1O44A 2M51A 2P4TA 2JTEA 1RACB 1X75C 3SD4A 1Q82U 4GPLB 5IAYA 3VRNA 2LCLA 3KXTA 3L2VA 4PJOB 4AFQC 1SPKA 2DETA 2K57A 3OY9A 2COWA 2ZPEB 3JB9F 1JXOA 2EYXA 3N7YA 4EIHA 3QWXX 1KQSA 5KYXB 2VKNA 2JN0A 5M9OA 1LUIA 3S3OA 4JRIA 5FRMA 3VS0A 5HK3A 3META 4M75D 2Y4YA 5EG2A 3I56A 4IIOA 2HDXA 1O4KA 1JJ2A 2CZ0B 2F5KA 2LX7A 4A63B 3HRUA 2RM4A 2G3RA 3S6WA 3A8MB 1PWTA 4LUEA 3CCUT 3S8NA 3M53A 3TL0A 1RADB 3LW5E 3TEEA 2R5AA 3MEUA 1LKLA 4EMKA 4M75F 3FRNA 1O4EA 2X4XA 4WCIA 1UTIA 1VQ8Q 3OYJA 4X34A 1T3LA 4Q5WA 5GANg 4MDWA 1XQHA 1WGSA 1ABOA 1IGQA 3PVLA 4NOYA 3OYCA 1AB2A 1PRMC 1MMAA 4ZGDB 4R56A 4MDXA 2IPOB 4NL2A 4XU0A 4JZ4A 3ME9A 3REBB 4M7DE 3S8OA 1O4CA 4KH1B 1JXMA 3HCKA 1UJYA 3CCLQ 2LNWA 4F5AA 2YLCA 4NS5A 1QVPA 2PVGB 3MP8A 3SWNC 1O4FA 2PU9B 1UJ0A 3OB9A 1JB0E 3US4A 2XU8A 1U1SA 5CQYA 3CCVT 3I9QA 5LJ5g 3M0PA 5AT1B 3HPWA 5CVIA 2ZPBB 1IHVA 1AT1B 1NYFA 1NYGA 1VIEA 3VJPA 3K2MA 3J80E 4BY6C 1VQ9A 5DC0B 2MOXA 5GMKl 4JEGA 5LJ3g 2DIGA 4VUBA 1XOVA 3J81E 2EGEA 4C8QB 4BUGA 1KQ2A 1Q95G 3IN8A 5KYNA 3S3MA 2EJ9A 2G6FX 1X0NA 2RQTA 2K7AB 2RPNA 2IZVA 5HY6A 3RUXA 2HSEB 4BD3A 3LH5A 2HBPA 3M7FA 1AOTF 1LPLA 3BW1A 3CBMA 4OMNA 3OYDA 1QP2A 4ELZC 3LWIA 2YRDA 1YI2Q 1IJRA 4PJOD 4ME7A 1KD1U 5GAN4 3N5BB 1VQ4Q 5GMKi 3M58A 4PJLA 2B86A 5FU6C 4JJNK 3GPLA 2VASA 2W0ZA 2QDLA 3G71A 3CCSA 1B7TA 5GJHA 1AHJB 4AFZC 2L3TA 2LRAA 3BY7A 1AD5A 4D6WA 2KK4A 1A1CA 1U06A 1SHFA 1K9AA 5C6SA 3JSCA 3MHXA 3EG9B 4PJOF 1WHMA 1BI0A 4M78C 1H641 1RAIB 2K3XA 2ZZDA 2YUQA 4C0DB 2KK6A 2HQXA 2DILA 2KXDA 3WVEB 3I56Q 2EKXA 4FW2A 1TUGB 1A1BA 2GFAA 1YJNQ 5KAZA 4DBQA 1WDXA 4MZTA 1M4ZA 1YIJT 4Y28E 1D0ZA 5CKHA 2QQBA 2WACA 2AZVA 4GL9E 2I2LA 2M16A 2KEAA 1O9SA 3CD6A 1D09B 1NEGA 1TUDA 1GXIE 1O4JA 2FRWA 3GBQA 2LCSA 3INZA 4C92G 3TKZA 3UWNA 4M7AC 2FRYA 3RMSA 1D4WA 1ZBXA 2D0NA 3WVDB 2AUGA 1M8VA 4OGEA 2K5FA 2X35A 3RKWA 2COZA 2KSSA 2HSPA 1M1GA 3QG1A 1IGUA 3S8LA 3RERA 4HT8A 3UATA 4PK4A 2RQVA 2AIRB 1V76A 2D1XA 1K0XA 4E7ZA 1WHHA 4KBMB 1WXUA 5DY9A 5HKWA 1TTHB 3TCJA 1SSFA 2P0KA 3L1AA 4HCBA 2P4RA 3ZNIA 2O31A 3WXMB 4DQ2A 4N0AC 1E6HA 1SKJA 4A4BA 4M7DA 1X6CA 4FYVB 4KUIA 2H5KA 3MXCA 4Y92A 2H3JA 4F14A 2D6FA 1YJWQ 1VQ8T 3VROA 4J6YA 4R0KA 1MILA 5GMKm 4E7SA 1O49A 1O4DA 5FLXE 4IUUA 3PLFB 3JCMd 2QA4Q 4OHDA 1SRLA 3HFOA 2E12A 3OW2P 1QVFP 4ZGJB 4AG1C 3OS2A 3GOXA 1ZSZB 2KXCA 4HCKA 4BDZA 1N27A 4XQ3A 3CMEA 2E10A 4C8QF 3MEVA 1AWXA 1GCQC 3GF5A 2LJ3A 1E7OA 3PIPA 4Y91A 4JJDA 4J5YA 1AEYA 3CCLT 5GMKh 2DXTA 1OZ2A 1WXBA 2DMOA 2KI7A 4XTXA 2DA9A 2NUTB 1UGVA 3QPHA 4R55A 2XDDA 3REAB 3RR6A 4KRTA 3TSWA 2IG0A 4FSXA 3BUXB 1M27C 4LD9K 1VQNA 5I11A 4X6SA 2HKNA 3OYMA 1UFFA 3G4SA 1RLPC 3ASKA 4Z89A 2CS0A 1OX9A 1AVZC 3JB9I 1VQKQ 1LJOA 3EH2A 4AT1B 4LDWA 1UGQB 4FW1A 2JT4A 5EG3B 4JDSA 5C0MA 2RB6A 2RMXA 4OMOA 3H0FA 1UEBA 1BI3A 2K4YA 2E65A 1ZSGA 3I5RA 2DJZA 3VRQA 1M3AA 3GLXA 3NFCA 2HCKA 3V7SA 4FL6A 4Z88A 2I0NA 3QIIA 2CSQA 1YI2T 3OSVA 2L89A 1BIAA 1VQMQ 2M02A 1VQ4T 2YLBA 4PFPA 3CXCP 1UUEA 1A09A 9ATCB 3EG0A 1BKMA 5I2SA 1RAHB 1K0SA 3KFVA 4QKUA 4QT7A 3RMQA 2LMJA 3M5AA 3L2UA 4FBNA 4FT2A 4JJBA 5CKBA 2DBMA 1CWEA 1VQ6A 3PJPA 2DM0A 3M59A 4L6V5 1MNEA 3EFSA 1FMKA 1NJIC 4EPCA 1VIFA 4PL6A 1A08A 4FYXB 3JCMV 3EAZA 1KG1A 2A28A 2O2OA 1UDLA 1VQ5Q 1SF9A 2MYSA 2Y3AB 1BLJA 2ZPIB 4FL2A 1YJNT 5CCAA 2EJFA 5CDWA 2RHYA 1AZEA 3CCEQ 3HTRA 2IUGA 2AKLA 2L2PA 2V8IA 2RHZA 1X6BA 1H9OA 1SPSA 4E6RA 3GQIB 1Y7XA 1GBQA 2CR4A 1QW1A 3G6EQ 3JRZA 3OS1A 2PNBA 1Z3KA 2YUOA 2GTJA 2IVWA 1LCKA 1M9SA 2EOBA 2HUWA 1WX6A 1YFNA 3JCMX 2O01E 1FBZA 2YRCA 3VRPA 1WQ7A 1VQPA 1OEBA 5L23A 5DF6A 3T04A 2QI2A 1OU8A 3EG9A 3MKDA 5GAOq 1R0CB 2RQWA 5IBSA 5GAOm 3FDRA 2D8JA 2GQIA 1MNDA 2QEXA 3OBWA 5IBMA 4PLIA 1M90C 2KYMA 3I55A 3CC4A 3EGUA 1K73C 2JW4A 2EQMA 2RQUA 1OZ3A 3MJXA 5DLOA 1K1ZA 1X43A 1QVFS 1I81A 4JUVA 1EFNA 3D7SB 2FYKA 2FZGB 3JB9G 4IUPA 3S3NA 5KYUA 4E2FB 4GWFA 3BUOB 1SHDA 1LNXA 1YJWT 3Q1JA 1G5VA 2ROTA 1HJDA 5LJ5f 3GNGA 2QA4T 3JCMc 1FX7A 2BE9B 2FPDA 1Q86U 1YWPA 4GLKA 2Y1NA 3CQTA 5KYYA 3CD3A 4RCCA 4H34A 1Q7YU 2DF6A 1ZUKA 4F7UE 1VQLA 2EQIA 4IUTA 2CH4A 2CUDA 1YVLA 4JS4A 2KRNA 2DL3A 1T0HA 4C5GA 1YHQA 2KNOA 4M75G 1XTDA 2EGCA 2ZPHB 3SHWA 2VYTA 2CRHA 2VWFA 4M78E 1RQQC 3A98A 2Y90A 2V1RA 4JLIA 3NPFA 5FWCA 1R1SA 5J3XA 2JJ9A 4IURA 3RBBB 1Y1UA 2DE0X 2VV5A 1IB8A 2KT1A 5GAN6 2NYSA 2B3OA 3WA4A 2QAZA 1TOVA 3M54A 1VQKT 1GBRA 2A08A 4RTZA 1BCMA 2K2VA 3JAME 1C1AA 2KBTA 3OYFA 3CXCS 1NLPC 4E68A 3LYIA 4M77D 4HVVA 4EMGA 1SRMA 4M7AE 2RI2A 1WFWA 2EYYA 1OU9A 3OMGA 4J9BA 4PFZA 1NJIR 1FBVA 3CC7A 2RK2A 4KULA 1QCOA 1O75A 3E9FA 5GAN2 4DBHA 2DKGA 5I22A 1VQMT 4C0DC 3E19A 3OS0A 2ESWA 3OW2A 4M77F 1RL2A 1IREB 1M3BA 2JS2A 3UDCA 2M0YA 2JTFA 2OTLA 3EAEA 5HCKA 1X01A 1O41A 1P13A 4BE0A 2ED1A 1S1NA 2JZ2A 1SHBA 3QYHB 1R0BG 2CI9A 1S72A 3HFNA 3CCMQ 2R5MA 2RORA 4E93A 1D1CA 2HDAA 4E7IA 1OOTA 1NPPA 4M7DB 2MRKA 3L2WA 1O4LA 1VQOA 3M4GA 4RCBA 1BLKA 3P8BB 4C92C 1VQ5T 2C0IA
chains in the Genus database with same CATH topology
1H8KA 1NEBA 2PNAA 1IJRA 2LJ0A 1QKWA 1UE9A 3VGOA 4A4CA 3R6NA 4OHLA 2K9GA 4U1PA 1O42A 2OI3A 2IIMA 2IUIA 2VIFA 1A07A 2JMAA 2B86A 4LN2A 2W0ZA 2FPFA 2QDLA 4EIKA 2K6DA 3PS5A 5GJHA 1E6GA 2DCRA 4X1VA 4AFZC 2L3TA 4D8DA 4OHHA 1BB9A 3EG3A 1A0NB 1Z9QA 1AD5A 1A1CA 1U06A 2CSIA 4RTYA 3EG2A 2O9VA 5HKZA 1QG1E 3PSKA 1SHFA 1K9AA 4RTUA 2L3SA 2RF0A 2J6OA 2EL8A 1O4IA 4DEXA 2K79B 3C0CA 1GCPA 2YUQA 1O4RA 3OV1A 3VS3A 2KK6A 4ROJA 2FPEA 4P9ZA 4F5BA 1LUKA 2J06A 1X27A 2DILA 2F2WA 1CWDL 2KXDA 4JE4A 5IH2A 3VS1A 2VVKA 4AFSC 5ECAA 2EKXA 2KNBB 3H0IA 1A1BA 5IHKA 5KAZA 2V1QA 4DEYA 1WDXA 2JYQA 1WIEA 3OVEA 2HEQA 2LZ6B 1D1ZA 2EPDA 1NZLA 1RI9A 2AZVA 4H34A 1G2BA 4GL9E 4J9DA 1OPKA 1IO6A 2KEAA 3PE0A 1RJAA 4QSYA 2LNXA 1CSKA 2NUZA 1LCJA 1YNZA 1CSYA 2NWMA 2YSQA 2YT6A 1NEGA 1TUDA 2PZ1A 1R1QA 1X2KA 1O4JA 2RMOA 1R1PA 2FRWA 1BHHA 3GBQA 2LCSA 4IIMA 3U23A 1WYXA 4J9EA 2DLPA 3TKZA 2JMCA 1HCTB 2PLEA 4EY0A 1PKTA 2FRYA 1D4WA 2BZYA 2D0NA 1JYUA 2AUGA 3HHMB 1TUCA 1F1WA 2RVFA 2MC1A 1ZBJA 1O4NA 2DBKA 2HSPA 1D4TA 3M0RA 2AOAA 2E5KA 4OMQA 2LP5A 1QCFA 4K44A 1TCEA 2DL5A 1B07A 2FO0A 1OO4A 2ECDA 4K2RA 3S8LA 2O9SA 4ESRA 1YVHA 3M0QA 3UATA 2J6KA 2YU7A 4HVUA 2RQVA 3IQLA 2CT3A 2D1XA 3NMZC 1K0XA 3EG1A 2KGTA 3PVQA 1JWOA 5HKWA 1WXUA 1AOUF 2CBLA 2K7AA 1X69A 4RTVA 1K4US 2EVRA 1GRIA 2DNUA 2GNCA 3VRYA 2P4RA 3ZNIA 2O31A 2KT8A 1SSHA 1ZUYA 1RPYA 3EACA 1E6HA 1SKJA 4A4BA 5GJWB 2SHPA 1X6CA 2H5KA 5GJIA 2CIAA 3MXYA 3MXCA 2EGAA 4ORZA 4Y92A 3MAZA 3JV3A 1YP5A 1KFZA 5AULA 1UECA 4OHIA 4F14A 1T0JA 3N84A 1BHFA 2ECZA 4CC4B 1VA7A 1O47A 1H92A 1O4QA 3VROA 1MILA 4R0KA 2DYBA 1O49A 2IUHA 1O4DA 3PLFB 2YUPA 3M0SA 1AYDA 1X6GA 5EHPA 4OHDA 3QWYA 1SRLA 2DX1A 3IMJA 4AG1C 1JO8A 2K3BA 1O43A 1X2QA 1AWOA 1T3SA 2KXCA 4HCKA 2EO3A 1OPLA 1QKXA 2L0AA 1O4HA 1FHSA 1SHAA 4JZ3A 1AWXA 1SPRA 1GCQC 1KSWA 1Y57A 2LJ3A 4RTXA 1ABQA 1BU1A 1E7OA 3CBLA 1BFJA 3NGPA 4JJDA 1JQQA 3EHQA 1AEYA 1IS0A 3BKBA 1U3OA 3VRRA 2K79A 2K2MA 2PNIA 1A81A 1YN8A 5IXFA 2EW3A 2RSYA 1RLQC 1WXBA 1BG1A 1JYRA 1YCSB 2DMOA 2EBPA 2DA9A 4NWFA 1UGVA 2JXBA 2X3XD 3REAB 3CWGA 4KRTA 1QWEA 3TSWA 3BUXB 1M27C 1LUNA 1PICA 3M0UA 4X6SA 5I11A 1AYBA 2L3PA 1N5ZA 1UFFA 2LQWA 4J9IA 1BK2A 3H41A 2GSBA 1LKKA 1RLPC 2FG0A 4OMPA 4CC7A 4Z89A 2A37A 2CS0A 2DL7A 1AVZC 2RN8A 4J9GA 1GL5A 2L6KA 1CKBA 3BUMB 1GFCA 4JPBW 1PRLC 1KA6A 2GE9A 3UF4A 4DGXA 1GCQA 2JT4A 5EC7A 1CJ1A 5EG3B 2RMXA 1BFIA 1UHCA 4AFUC 4OMOA 2KE9A 2F2VA 3H0FA 2LJ1A 1ARKA 3I5RA 1ZSGA 2GGRA 2J7IA 3TSZA 5EELA 3VRQA 1M3AA 4TZIA 2PLDA 3THKA 5EHRA 2CH4W 1F2FA 2DL4A 1MW4A 1SHGA 2HCKA 4Z88A 1WLPB 2I0NA 4GBQA 2ABLA 2CSQA 2BTTA 3KFJA 1AYCA 2KR3A 5I6VA 5DC4A 3HIZB 5DC9A 1O4AA 1UG1A 5BO4A 1NLOC 2GBQA 2A36A 3PFVA 1UUEA 1A09A 1M30A 1BKMA 3EG0A 1K0SA 1NG2A 2AK5A 3KFVA 4QT7A 3PQZA 1PNJA 1I07A 2LMJA 1O4PA 1WQUA 4FBNA 4JJBA 1WA7A 3OB1B 2DBMA 1CWEA 3PJPA 2J6FA 2DM0A 2BZXA 2JM8A 1JU5C 4GLMA 2SRCA 4H1OA 4J9CA 1W1FA 1FMKA 3VS5A 1ZUUA 4P9VA 1HD3A 3OP0A 3SEMA 1A08A 4FL3A 2BBUA 2YUNA 1M8MA 4RTWA 2CDTA 3EAZA 2A28A 2O2OA 5EEQA 4OMLA 1U5SA 2SEMA 3UYOA 1UDLA 2Y3AB 3VRZA 1B3QA 1BMBA 1KA7A 1K76A 2F2XA 1GHUA 1O4BA 2XP1A 1BLJA 3O5ZA 4FL2A 3RNJA 5CDWA 3CXLA 1AZEA 1XA6A 3H0HA 2D8HA 4JJCA 1I1JA 5IHNA 2AKLA 2L2PA 2IUGA 1X6BA 1MUZA 2LNHB 5GJVB 4RUGA 1H9OA 4E6RA 4J9HA 1G83A 1SPSA 2QMSA 3GQIB 2OJ2A 1GBQA 1I0CA 1CSZA 2O88A 2CR4A 2PNBA 2C9WA 1Z3KA 2YUOA 1BBZA 1VYTA 2GTJA 2FEIA 1ZFPE 2CUBA 4HXJA 4K45A 1LCKA 3OB2B 2X3WD 1UUSA 4WWQA 2EOBA 2J05A 2HUWA 1WX6A 1WI7A 4LE9A 4M4ZA 1JU5A 1FBZA 4LNPA 2GTOA 3VRPA 1OEBA 5L23A 5DF6A 3VS7A 1QADA 3T04A 3GXXA 2L3QA 3I35A 3VS6A 2JS0A 1VYUA 2AOBA 2DM1A 1O48A 2RQWA 1CKAA 4XZ0A 5IBSA 1Y0MA 3C7IA 2D8JA 1OO3A 2GQIA 2OQ1A 1AYAA 1VYVA 2ROLA 2DVJA 3IMDA 5IBMA 2EYZA 1TG0A 4CC2A 2KRMA 2AKKA 2DJQA 2KYBA 2KYMA 4AG2C 2MQIA 3EGUA 2L4KA 2DRMA 2JW4A 1RUWA 2RQUA 4JGHA 1OV3A 1K1ZA 1X43A 4L1BB 1M3CA 1B47A 1J3TA 1FU6A 2DL8A 1EFNA 3S9KA 1I3ZA 2MIOA 1A1EA 4FSSA 1O44A 2MRJA 2M51A 2JTEA 3FJ5A 4GPLB 4GWFA 2AZSA 3VRNA 3BUOB 4XZ1A 1SHDA 4AFQC 1SPKA 1HJDA 2ROTA 4F59A 1O4OA 2MK2A 1MV0B 4RTTA 1JXOA 2EYXA 3N7YA 4EIHA 1YWOA 3QWXX 5IHIA 5FW9A 3IN7A 1HSQA 2KRSA 2VKNA 1WXTA 2FPDA 1LUIA 1YWPA 5FWBA 3VS0A 2JM9A 3CQTA 1AWWA 1ZLMA 1JYQA 2Y1NA 3CD3A 3BUWB 3VS2A 1W70A 2RQRA 4F16A 1AZGB 2DF6A 4IIOA 1ZUKA 3UA6A 2CI8A 2HDXA 2EQIA 2MCNA 1O4KA 2CH4A 2CUDA 1YVLA 2LX7A 4A63B 1O4GA 2KRNA 2EKHA 2DL3A 2EU0A 1QLYA 3EHRA 2FCIA 3PSJA 1PWTA 1T0HA 4LUEA 2RNAA 1O4MA 1FYRA 3S8NA 2KNOA 1NZVA 3TL0A 2EGCA 1KIKA 1M27A 3SHWA 2PTKA 2CRHA 2VWFA 1KC2A 2ETZA 1RQQC 3A98A 1FU5A 1LKLA 2BZ8A 1BKLA 2V1RA 5IXBA 2C0TA 4CC3A 3NPFA 5FWCA 1O4EA 4U17A 4WCIA 1UTIA 1LUMA 2HDVA 1R1SA 1W6XA 5J3XA 3UA7A 1SEMA 1HCSB 1T3LA 3RBBB 3ULRB 1Y1UA 2DE0X 2Y1MA 1PKSA 2KT1A 2OAWA 1AWJA 4HVWA 4J9FA 1ABOA 1O45A 3PVLA 2B3OA 1JEGA 1A1AA 3WA4A 1AB2A 1PRMC 1Z9ZA 2CT4A 2DX0A 2OZOA 1GBRA 2A08A 4JZ4A 5D0JA 3REBB 2EYWA 2DRKA 4RTZA 1TZEE 3S8OA 3M0TA 3BUNB 2W10A 1O4CA 1JXMA 1O46A 3HCKA 1UJYA 2LNWA 4F5AA 2KBTA 1NLPC 4DGPA 4E68A 4HVVA 2ED0A 4K11A 2H46E 1SRMA 1WFWA 2EYYA 4OHEA 1O4FA 1FYNA 4J9BA 1UJ0A 1M61A 2CREA 1BHHB 1FBVA 3US4A 1UURA 3I9QA 3M0PA 2EYVA 5HKYA 3GXWA 3TVTA 1H3HA 1AOJA 5I22A 2YDLA 1NYFA 1NYGA 3K2MA 3ZL7C 2HMHA 2LCTA 2ESWA 5DC0B 1GFDA 2DLZA 2JS2A 1M3BA 2MOXA 1PHTA 2M0YA 3N8MA 1UHFA 4JEGA 1XOVA 5HCKA 2XMFA 4D8KA 1O41A 1MV3A 1P13A 2EGEA 3NHNA 4ZNXA 1BM2A 3I5SA 4Z8AA 1ZX6A 3IN8A 1V1CA 2ED1A 1S1NA 4OMMA 1SHBA 1NM7A 2HBWA 2CI9A 2G6FX 1X0NA 2RQTA 2LQNA 2K7AB 2RPNA 2IZVA 2DLYA 3VS4A 2RORA 4E93A 3LH5A 1QWFA 4LUDA 3M7FA 1AOTF 2HDAA 2EO6A 1OOTA 4F17A 2MRKA 1BF5A 2H8HA 1O4LA 1KJWA 4OMNA 2ENMA 2YSXA 1NRVA 4NWGA 2C0OA 1BLKA 5AXIA 2KROA 2C0IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1H8K A;  1NEB A;  2PNA A;  1IJR A;  2LJ0 A;  1QKW A;  1UE9 A;  3VGO A;  4A4C A;  3R6N A;  4OHL A;  2K9G A;  4U1P A;  1O42 A;  2OI3 A;  2IIM A;  2IUI A;  2VIF A;  1A07 A;  2JMA A;  2B86 A;  4LN2 A;  2W0Z A;  2FPF A;  2QDL A;  4EIK A;  2K6D A;  3PS5 A;  5GJH A;  1E6G A;  2DCR A;  4X1V A;  4AFZ C;  2L3T A;  4D8D A;  4OHH A;  1BB9 A;  3EG3 A;  1A0N B;  1Z9Q A;  1AD5 A;  1A1C A;  1U06 A;  2CSI A;  4RTY A;  3EG2 A;  2O9V A;  5HKZ A;  1QG1 E;  3PSK A;  1SHF A;  1K9A A;  4RTU A;  2L3S A;  2RF0 A;  2J6O A;  2EL8 A;  1O4I A;  4DEX A;  2K79 B;  3C0C A;  1GCP A;  2YUQ A;  1O4R A;  3OV1 A;  3VS3 A;  2KK6 A;  4ROJ A;  2FPE A;  4P9Z A;  4F5B A;  1LUK A;  2J06 A;  1X27 A;  2DIL A;  2F2W A;  1CWD L;  2KXD A;  4JE4 A;  5IH2 A;  3VS1 A;  2VVK A;  4AFS C;  5ECA A;  2EKX A;  2KNB B;  3H0I A;  1A1B A;  5IHK A;  5KAZ A;  2V1Q A;  4DEY A;  1WDX A;  2JYQ A;  1WIE A;  3OVE A;  2HEQ A;  2LZ6 B;  1D1Z A;  2EPD A;  1NZL A;  1RI9 A;  2AZV A;  4H34 A;  1G2B A;  4GL9 E;  4J9D A;  1OPK A;  1IO6 A;  2KEA A;  3PE0 A;  1RJA A;  4QSY A;  2LNX A;  1CSK A;  2NUZ A;  1LCJ A;  1YNZ A;  1CSY A;  2NWM A;  2YSQ A;  2YT6 A;  1NEG A;  1TUD A;  2PZ1 A;  1R1Q A;  1X2K A;  1O4J A;  2RMO A;  1R1P A;  2FRW A;  1BHH A;  3GBQ A;  2LCS A;  4IIM A;  3U23 A;  1WYX A;  4J9E A;  2DLP A;  3TKZ A;  2JMC A;  1HCT B;  2PLE A;  4EY0 A;  1PKT A;  2FRY A;  1D4W A;  2BZY A;  2D0N A;  1JYU A;  2AUG A;  3HHM B;  1TUC A;  1F1W A;  2RVF A;  2MC1 A;  1ZBJ A;  1O4N A;  2DBK A;  2HSP A;  1D4T A;  3M0R A;  2AOA A;  2E5K A;  4OMQ A;  2LP5 A;  1QCF A;  4K44 A;  1TCE A;  2DL5 A;  1B07 A;  2FO0 A;  1OO4 A;  2ECD A;  4K2R A;  3S8L A;  2O9S A;  4ESR A;  1YVH A;  3M0Q A;  3UAT A;  2J6K A;  2YU7 A;  4HVU A;  2RQV A;  3IQL A;  2CT3 A;  2D1X A;  3NMZ C;  1K0X A;  3EG1 A;  2KGT A;  3PVQ A;  1JWO A;  5HKW A;  1WXU A;  1AOU F;  2CBL A;  2K7A A;  1X69 A;  4RTV A;  1K4U S;  2EVR A;  1GRI A;  2DNU A;  2GNC A;  3VRY A;  2P4R A;  3ZNI A;  2O31 A;  2KT8 A;  1SSH A;  1ZUY A;  1RPY A;  3EAC A;  1E6H A;  1SKJ A;  4A4B A;  5GJW B;  2SHP A;  1X6C A;  2H5K A;  5GJI A;  2CIA A;  3MXY A;  3MXC A;  2EGA A;  4ORZ A;  4Y92 A;  3MAZ A;  3JV3 A;  1YP5 A;  1KFZ A;  5AUL A;  1UEC A;  4OHI A;  4F14 A;  1T0J A;  3N84 A;  1BHF A;  2ECZ A;  4CC4 B;  1VA7 A;  1O47 A;  1H92 A;  1O4Q A;  3VRO A;  1MIL A;  4R0K A;  2DYB A;  1O49 A;  2IUH A;  1O4D A;  3PLF B;  2YUP A;  3M0S A;  1AYD A;  1X6G A;  5EHP A;  4OHD A;  3QWY A;  1SRL A;  2DX1 A;  3IMJ A;  4AG1 C;  1JO8 A;  2K3B A;  1O43 A;  1X2Q A;  1AWO A;  1T3S A;  2KXC A;  4HCK A;  2EO3 A;  1OPL A;  1QKX A;  2L0A A;  1O4H A;  1FHS A;  1SHA A;  4JZ3 A;  1AWX A;  1SPR A;  1GCQ C;  1KSW A;  1Y57 A;  2LJ3 A;  4RTX A;  1ABQ A;  1BU1 A;  1E7O A;  3CBL A;  1BFJ A;  3NGP A;  4JJD A;  1JQQ A;  3EHQ A;  1AEY A;  1IS0 A;  3BKB A;  1U3O A;  3VRR A;  2K79 A;  2K2M A;  2PNI A;  1A81 A;  1YN8 A;  5IXF A;  2EW3 A;  2RSY A;  1RLQ C;  1WXB A;  1BG1 A;  1JYR A;  1YCS B;  2DMO A;  2EBP A;  2DA9 A;  4NWF A;  1UGV A;  2JXB A;  2X3X D;  3REA B;  3CWG A;  4KRT A;  1QWE A;  3TSW A;  3BUX B;  1M27 C;  1LUN A;  1PIC A;  3M0U A;  4X6S A;  5I11 A;  1AYB A;  2L3P A;  1N5Z A;  1UFF A;  2LQW A;  4J9I A;  1BK2 A;  3H41 A;  2GSB A;  1LKK A;  1RLP C;  2FG0 A;  4OMP A;  4CC7 A;  4Z89 A;  2A37 A;  2CS0 A;  2DL7 A;  1AVZ C;  2RN8 A;  4J9G A;  1GL5 A;  2L6K A;  1CKB A;  3BUM B;  1GFC A;  4JPB W;  1PRL C;  1KA6 A;  2GE9 A;  3UF4 A;  4DGX A;  1GCQ A;  2JT4 A;  5EC7 A;  1CJ1 A;  5EG3 B;  2RMX A;  1BFI A;  1UHC A;  4AFU C;  4OMO A;  2KE9 A;  2F2V A;  3H0F A;  2LJ1 A;  1ARK A;  3I5R A;  1ZSG A;  2GGR A;  2J7I A;  3TSZ A;  5EEL A;  3VRQ A;  1M3A A;  4TZI A;  2PLD A;  3THK A;  5EHR A;  2CH4 W;  1F2F A;  2DL4 A;  1MW4 A;  1SHG A;  2HCK A;  4Z88 A;  1WLP B;  2I0N A;  4GBQ A;  2ABL A;  2CSQ A;  2BTT A;  3KFJ A;  1AYC A;  2KR3 A;  5I6V A;  5DC4 A;  3HIZ B;  5DC9 A;  1O4A A;  1UG1 A;  5BO4 A;  1NLO C;  2GBQ A;  2A36 A;  3PFV A;  1UUE A;  1A09 A;  1M30 A;  1BKM A;  3EG0 A;  1K0S A;  1NG2 A;  2AK5 A;  3KFV A;  4QT7 A;  3PQZ A;  1PNJ A;  1I07 A;  2LMJ A;  1O4P A;  1WQU A;  4FBN A;  4JJB A;  1WA7 A;  3OB1 B;  2DBM A;  1CWE A;  3PJP A;  2J6F A;  2DM0 A;  2BZX A;  2JM8 A;  1JU5 C;  4GLM A;  2SRC A;  4H1O A;  4J9C A;  1W1F A;  1FMK A;  3VS5 A;  1ZUU A;  4P9V A;  1HD3 A;  3OP0 A;  3SEM A;  1A08 A;  4FL3 A;  2BBU A;  2YUN A;  1M8M A;  4RTW A;  2CDT A;  3EAZ A;  2A28 A;  2O2O A;  5EEQ A;  4OML A;  1U5S A;  2SEM A;  3UYO A;  1UDL A;  2Y3A B;  3VRZ A;  1B3Q A;  1BMB A;  1KA7 A;  1K76 A;  2F2X A;  1GHU A;  1O4B A;  2XP1 A;  1BLJ A;  3O5Z A;  4FL2 A;  3RNJ A;  5CDW A;  3CXL A;  1AZE A;  1XA6 A;  3H0H A;  2D8H A;  4JJC A;  1I1J A;  5IHN A;  2AKL A;  2L2P A;  2IUG A;  1X6B A;  1MUZ A;  2LNH B;  5GJV B;  4RUG A;  1H9O A;  4E6R A;  4J9H A;  1G83 A;  1SPS A;  2QMS A;  3GQI B;  2OJ2 A;  1GBQ A;  1I0C A;  1CSZ A;  2O88 A;  2CR4 A;  2PNB A;  2C9W A;  1Z3K A;  2YUO A;  1BBZ A;  1VYT A;  2GTJ A;  2FEI A;  1ZFP E;  2CUB A;  4HXJ A;  4K45 A;  1LCK A;  3OB2 B;  2X3W D;  1UUS A;  4WWQ A;  2EOB A;  2J05 A;  2HUW A;  1WX6 A;  1WI7 A;  4LE9 A;  4M4Z A;  1JU5 A;  1FBZ A;  4LNP A;  2GTO A;  3VRP A;  1OEB A;  5L23 A;  5DF6 A;  3VS7 A;  1QAD A;  3T04 A;  3GXX A;  2L3Q A;  3I35 A;  3VS6 A;  2JS0 A;  1VYU A;  2AOB A;  2DM1 A;  1O48 A;  2RQW A;  1CKA A;  4XZ0 A;  5IBS A;  1Y0M A;  3C7I A;  2D8J A;  1OO3 A;  2GQI A;  2OQ1 A;  1AYA A;  1VYV A;  2ROL A;  2DVJ A;  3IMD A;  5IBM A;  2EYZ A;  1TG0 A;  4CC2 A;  2KRM A;  2AKK A;  2DJQ A;  2KYB A;  2KYM A;  4AG2 C;  2MQI A;  3EGU A;  2L4K A;  2DRM A;  2JW4 A;  1RUW A;  2RQU A;  4JGH A;  1OV3 A;  1K1Z A;  1X43 A;  4L1B B;  1M3C A;  1B47 A;  1J3T A;  1FU6 A;  2DL8 A;  1EFN A;  3S9K A;  1I3Z A;  2MIO A;  1A1E A;  4FSS A;  1O44 A;  2MRJ A;  2M51 A;  2JTE A;  3FJ5 A;  4GPL B;  4GWF A;  2AZS A;  3VRN A;  3BUO B;  4XZ1 A;  1SHD A;  4AFQ C;  1SPK A;  1HJD A;  2ROT A;  4F59 A;  1O4O A;  2MK2 A;  1MV0 B;  4RTT A;  1JXO A;  2EYX A;  3N7Y A;  4EIH A;  1YWO A;  3QWX X;  5IHI A;  5FW9 A;  3IN7 A;  1HSQ A;  2KRS A;  2VKN A;  1WXT A;  2FPD A;  1LUI A;  1YWP A;  5FWB A;  3VS0 A;  2JM9 A;  3CQT A;  1AWW A;  1ZLM A;  1JYQ A;  2Y1N A;  3CD3 A;  3BUW B;  3VS2 A;  1W70 A;  2RQR A;  4F16 A;  1AZG B;  2DF6 A;  4IIO A;  1ZUK A;  3UA6 A;  2CI8 A;  2HDX A;  2EQI A;  2MCN A;  1O4K A;  2CH4 A;  2CUD A;  1YVL A;  2LX7 A;  4A63 B;  1O4G A;  2KRN A;  2EKH A;  2DL3 A;  2EU0 A;  1QLY A;  3EHR A;  2FCI A;  3PSJ A;  1PWT A;  1T0H A;  4LUE A;  2RNA A;  1O4M A;  1FYR A;  3S8N A;  2KNO A;  1NZV A;  3TL0 A;  2EGC A;  1KIK A;  1M27 A;  3SHW A;  2PTK A;  2CRH A;  2VWF A;  1KC2 A;  2ETZ A;  1RQQ C;  3A98 A;  1FU5 A;  1LKL A;  2BZ8 A;  1BKL A;  2V1R A;  5IXB A;  2C0T A;  4CC3 A;  3NPF A;  5FWC A;  1O4E A;  4U17 A;  4WCI A;  1UTI A;  1LUM A;  2HDV A;  1R1S A;  1W6X A;  5J3X A;  3UA7 A;  1SEM A;  1HCS B;  1T3L A;  3RBB B;  3ULR B;  1Y1U A;  2DE0 X;  2Y1M A;  1PKS A;  2KT1 A;  2OAW A;  1AWJ A;  4HVW A;  4J9F A;  1ABO A;  1O45 A;  3PVL A;  2B3O A;  1JEG A;  1A1A A;  3WA4 A;  1AB2 A;  1PRM C;  1Z9Z A;  2CT4 A;  2DX0 A;  2OZO A;  1GBR A;  2A08 A;  4JZ4 A;  5D0J A;  3REB B;  2EYW A;  2DRK A;  4RTZ A;  1TZE E;  3S8O A;  3M0T A;  3BUN B;  2W10 A;  1O4C A;  1JXM A;  1O46 A;  3HCK A;  1UJY A;  2LNW A;  4F5A A;  2KBT A;  1NLP C;  4DGP A;  4E68 A;  4HVV A;  2ED0 A;  4K11 A;  2H46 E;  1SRM A;  1WFW A;  2EYY A;  4OHE A;  1O4F A;  1FYN A;  4J9B A;  1UJ0 A;  1M61 A;  2CRE A;  1BHH B;  1FBV A;  3US4 A;  1UUR A;  3I9Q A;  3M0P A;  2EYV A;  5HKY A;  3GXW A;  3TVT A;  1H3H A;  1AOJ A;  5I22 A;  2YDL A;  1NYF A;  1NYG A;  3K2M A;  3ZL7 C;  2HMH A;  2LCT A;  2ESW A;  5DC0 B;  1GFD A;  2DLZ A;  2JS2 A;  1M3B A;  2MOX A;  1PHT A;  2M0Y A;  3N8M A;  1UHF A;  4JEG A;  1XOV A;  5HCK A;  2XMF A;  4D8K A;  1O41 A;  1MV3 A;  1P13 A;  2EGE A;  3NHN A;  4ZNX A;  1BM2 A;  3I5S A;  4Z8A A;  1ZX6 A;  3IN8 A;  1V1C A;  2ED1 A;  1S1N A;  4OMM A;  1SHB A;  1NM7 A;  2HBW A;  2CI9 A;  2G6F X;  1X0N A;  2RQT A;  2LQN A;  2K7A B;  2RPN A;  2IZV A;  2DLY A;  3VS4 A;  2ROR A;  4E93 A;  3LH5 A;  1QWF A;  4LUD A;  3M7F A;  1AOT F;  2HDA A;  2EO6 A;  1OOT A;  4F17 A;  2MRK A;  1BF5 A;  2H8H A;  1O4L A;  1KJW A;  4OMN A;  2ENM A;  2YSX A;  1NRV A;  4NWG A;  2C0O A;  1BLK A;  5AXI A;  2KRO A;  2C0I A; 
#chains in the Genus database with same CATH topology
 4ZGE B;  2LJ0 A;  3VGO A;  1W2B A;  3G1J A;  3O8V A;  4WF2 A;  2HAX A;  1JRI A;  3CCE T;  2P0Q A;  2IUI A;  3RKX A;  1A07 A;  1G3T A;  4LN2 A;  2FPF A;  4PJO G;  4EIK A;  3PS5 A;  1E6G A;  4QQG A;  5D6W A;  4OHH A;  3G6E T;  1M90 R;  3OYG A;  4KT0 E;  1YIT A;  3CBP A;  3EG2 A;  2O9V A;  4RTY A;  5HKZ A;  4OF1 A;  3CPW A;  2EAY A;  1K73 R;  1QG1 E;  2WSF E;  1K8A R;  2A7Y A;  1WJR A;  2PVD B;  3CCQ Q;  3EH1 A;  3OYI A;  2KDS A;  2RF0 A;  1O4I A;  3QKJ A;  3P8H A;  3CMA A;  1WJQ A;  3VS3 A;  4ROJ A;  3CCJ A;  2HNI A;  2PQW A;  1LUK A;  1X27 A;  5IH2 A;  1VOM A;  5GAO n;  2DXB A;  2VVK A;  4AFS C;  5D7U A;  1NBE B;  2KNB B;  3P8D A;  4ZN1 A;  5IHK A;  1VQL Q;  3DB4 A;  5CKE A;  4OP0 A;  2RJD A;  2HEQ A;  1D1Z A;  1N8R C;  2EPD A;  3J7A F;  1RI9 A;  4FM4 B;  4QVC A;  2YWW A;  1ZSZ C;  1IO6 A;  4F7U A;  2LNX A;  1LCJ A;  2NUZ A;  1CSY A;  1NJI U;  4IKF A;  2OTJ Q;  2DPP B;  1R1P A;  3G7Z A;  4M77 A;  1WYX A;  2DER A;  4J9E A;  5HK0 A;  2M9U A;  1HYO A;  4EY0 A;  3HRS A;  1YBY A;  1F1W A;  2NUP B;  2E6N A;  1M1F A;  2AT1 B;  1D4T A;  3M0R A;  2AOA A;  2MF2 A;  1TCE A;  5DLQ E;  3X24 B;  2FO0 A;  4A4E A;  1OO4 A;  1MMD A;  1YVH A;  2YU7 A;  3ZEH A;  2QGF B;  3IQL A;  1VQ7 A;  2P0P A;  3PVQ A;  1X69 A;  2EVR A;  5GAN e;  2FVU A;  2DNU A;  4HT9 A;  1SSH A;  1WHJ A;  4J7I A;  3EAC A;  2ZAE A;  1BIB A;  4C5I A;  4B6M A;  5GJW B;  4E7K A;  5GJI A;  1D0X A;  3JV3 A;  1YP5 A;  2RO0 A;  5AUL A;  1UEC A;  4OHI A;  2MI6 A;  1HXD A;  1T0J A;  5KH6 A;  1O4Q A;  2DYB A;  2IUH A;  1WHK A;  4XTV A;  4M7A A;  3OSS C;  4C8Q G;  4M7D D;  4XU1 A;  1VUB A;  2K3B A;  1AWO A;  2OTL Q;  3JCM h;  1K8A U;  1OPL A;  1O4H A;  2MWO A;  2GCX A;  1SHA A;  2RHI A;  4JZ3 A;  1SPR A;  1KSW A;  3CCR T;  4FU6 A;  5LJ5 e;  1BU1 A;  4BAC A;  5CKD A;  2MPX C;  3BKB A;  2K2M A;  4M7D F;  1D0Y A;  4GY5 A;  5IXF A;  1VQO Q;  1RLQ C;  2CP3 A;  1YCS B;  2E41 A;  4X9D A;  5LJ3 e;  3OYA A;  2X3X D;  3QDR B;  1PSE A;  1LUN A;  1PIC A;  3M0U A;  1G3Y A;  1AYB A;  2L3P A;  2LQW A;  2RJF A;  4J9I A;  4EMK C;  4CC7 A;  2A37 A;  5L8R E;  1I8F A;  1Q81 C;  1CKB A;  2HMA A;  3BUM B;  1GFC A;  4DBR A;  2GE9 A;  3UF4 A;  4DGX A;  1GCQ A;  2QGG A;  2DXU A;  4PJN A;  3FIF A;  2GQV A;  4AFU C;  2F2V A;  1M1K C;  1ARK A;  3VV0 A;  2GGR A;  3CCM T;  1W4S A;  5GAN j;  1I4K 1;  4TZI A;  3THK A;  4DOV A;  5EHR A;  5GAM f;  4RKU E;  5KYU B;  1F2F A;  1MW4 A;  2XKO C;  3NTK A;  1KC8 C;  2BTT A;  1UB4 A;  1AYC A;  3QUI A;  5I6V A;  3GP8 A;  3HIZ B;  4KH0 B;  1O4A A;  1UG1 A;  1DJ7 B;  1WJS A;  2A36 A;  4XTU A;  2AK5 A;  3H8Z A;  5KYY B;  1N8R R;  1PNJ A;  1I07 A;  3VU3 C;  3ER0 A;  2X4Y A;  3OB1 B;  2DZC A;  3CCQ T;  1JU5 C;  4J6X A;  4N4H A;  3CC2 A;  1ZUU A;  4P9V A;  4FL3 A;  1QVG P;  1M8M A;  5EEQ A;  1OQK A;  4OML A;  4OVA A;  1B3Q A;  3C95 A;  2F2X A;  1GHU A;  5LJ3 j;  3O5Z A;  3RDV A;  3RNJ A;  2CYZ B;  3CXL A;  1M5Q 1;  2LTO A;  4JJC A;  1B34 B;  1I1J A;  1TWB A;  4C5H A;  3H9N A;  2LNH B;  2QQS A;  2ZGW A;  3E1S A;  4JRK A;  1I0C A;  2E70 A;  2O88 A;  2DXC A;  1VQ9 Q;  2FEI A;  1ZFP E;  5GAM h;  2X3W D;  2J05 A;  4LDU A;  2OTJ T;  2RI5 A;  4M75 C;  4LE9 A;  2JVV A;  2PVO B;  5GAN 5;  3VYG A;  3BE3 A;  2KAF A;  5KE2 A;  4BI3 A;  1QAD A;  2L3Q A;  3I35 A;  3VS6 A;  2JS0 A;  1ZA2 B;  2DM1 A;  5GAO l;  1O48 A;  2KGY A;  2RJC A;  1CKA A;  2JUF A;  4QQ6 A;  3JCM g;  3C7I A;  3FJP A;  2ROL A;  5D6Y A;  3CCU A;  2RHU A;  1TG0 A;  4CC2 A;  3A8O B;  2KRM A;  2MQI A;  2DRM A;  4C0F A;  4JGH A;  2H3E B;  1M3C A;  4E47 A;  1J3T A;  3S9K A;  2D9T A;  1A1E A;  1F1B B;  1M2V A;  3CCS Q;  3G71 Q;  3FJ5 A;  8ATC B;  2A3L A;  1X6O A;  1D1B A;  4XZ1 A;  4C92 E;  4F59 A;  4JLG A;  2CS7 A;  2MK2 A;  4RMO A;  2LDM A;  2DO3 A;  2CKK A;  1YWO A;  2PUO B;  2LQ8 A;  5FW9 A;  5GAO p;  3IN7 A;  2KRS A;  1WXT A;  5FWB A;  2A0F B;  2JM9 A;  2JTM A;  3TRE A;  1ZLM A;  1TXQ A;  4QVD A;  5IT9 E;  3BUW B;  1W70 A;  2RQR A;  1FMV A;  3QO3 A;  3UA6 A;  3MEA A;  4XTW A;  2MCN A;  2CI8 A;  3NTH A;  2NUP A;  1UGS B;  1O4G A;  1KQS P;  2EU0 A;  1Q81 R;  1QLY A;  3EHR A;  2FCI A;  3PSJ A;  1Q82 C;  2RNA A;  1FYR A;  4LD6 A;  2F1L A;  3CCV A;  3RES A;  2X4J A;  1JJ2 P;  2ETZ A;  3QZ5 B;  1FU5 A;  1M1K R;  5IXB A;  3CD6 Q;  4CC3 A;  1LUM A;  1W6X A;  4OB0 B;  1SEM A;  1HCS B;  4C92 D;  5KE3 A;  2HQE A;  5KCO A;  2ZPF B;  2Y1M A;  4L59 A;  2BIV A;  2OAW A;  1AWJ A;  2QQA A;  2RK1 A;  1KC8 R;  4XTZ A;  1O45 A;  2DTH A;  5KCH A;  2FZC B;  1WHG A;  1R8O B;  1JEG A;  2R58 A;  3FEO A;  1Z9Z A;  2CT4 A;  2XID A;  1BKB A;  3E9G A;  2OZO A;  3QZ9 B;  2DEU A;  4X9C A;  3QJ6 A;  3CC2 Q;  3M0T A;  4PJO C;  3I56 T;  2XDB A;  4IUQ A;  1C0M A;  1UGR B;  2COY A;  4F7U B;  4DGP A;  2EYQ A;  3JCM b;  2ED0 A;  4K11 A;  2QYZ A;  1Y71 A;  2YHT A;  1FYN A;  4FYW B;  4KGX B;  4M77 B;  3PGG A;  2RJE A;  4M77 G;  4M78 B;  3V8L A;  3TVT A;  1H3H A;  1AOJ A;  2HMH A;  2LCT A;  4WTO B;  2DYI A;  1GFD A;  1QVG S;  1WPY A;  2K5I A;  1EX4 A;  3OA6 A;  2VB6 A;  2BE7 D;  5GAM g;  2XMF A;  4D8K A;  1MV3 A;  3NHN A;  2E6Z A;  4ZNX A;  3I5S A;  1ACM B;  4Z8A A;  3JCM Q;  1ZX6 A;  4OMM A;  1TH7 A;  4QQD A;  1V1C A;  1JBM A;  3X25 B;  5HKC A;  1NM7 A;  3CME Q;  1C6V X;  2HKQ B;  5CIU A;  3OYL A;  1HK9 A;  1RAB B;  4LXC A;  2E1H A;  3H6Z A;  1QQJ A;  2R57 A;  1BF5 A;  3NTI A;  3OYK A;  2C0O A;  4NWG A;  1RAA B;  2DD4 A;  2F5T X;  3SFM A;  4O5V A;  1NEB A;  2PNA A;  4BE1 A;  4A4C A;  5FRO A;  3R6N A;  2VGN A;  4M7A B;  4OHL A;  4A53 A;  5AYF A;  4U1P A;  2IIM A;  2VXF A;  3EFO A;  2VIF A;  2JMA A;  2VUB A;  1VQN Q;  3PMI A;  4FIB A;  5GAM e;  4X1V A;  2DCR A;  1A0N B;  3EG3 A;  1Z9Q A;  3G4S Q;  2JOY A;  1VQ9 T;  4HA8 A;  2DTO A;  4RTU A;  1V29 B;  2L3S A;  4HCC A;  1FXX A;  4DEX A;  2PUK B;  1O4R A;  3A8H B;  1KD1 C;  4QVZ A;  2FPE A;  4P9Z A;  5CR2 A;  2ZCF B;  5GMK e;  1WQW A;  2F2W A;  4JE4 A;  4P5N A;  3ZBD A;  2MAM A;  4C92 A;  3H0I A;  3FB9 A;  4C8Q C;  2JYQ A;  1FMW A;  3OVE A;  2LZ6 B;  3FLG A;  4BB7 A;  1NZL A;  4ZTF A;  3EGD A;  1IHW A;  1N9R A;  4XU2 A;  2YXY A;  3PE0 A;  1CSK A;  3AHU A;  2NWM A;  4YTL A;  1B34 A;  1BYM A;  2XDP A;  4MZM A;  1VQ8 A;  2PZ1 A;  1Q82 R;  4KUD K;  1X2K A;  3CCS T;  2X51 A;  3G71 T;  2RMO A;  1OI1 A;  1BHH A;  1EIF A;  4E7L A;  3U23 A;  2DLP A;  2FHD A;  1KQS S;  1VQ6 Q;  1HCT B;  1PKT A;  2BZY A;  4HCZ A;  1JYU A;  2RVF A;  1ZBJ A;  2DBK A;  2VGM A;  1JJ2 S;  4OMQ A;  3MEW A;  3C12 A;  1YJ9 A;  2ECD A;  2O9S A;  2BUD A;  4M78 D;  4ESR A;  2J6K A;  3CCL A;  1QCN A;  2CT3 A;  3NMZ C;  3EG1 A;  2KGT A;  4BDY A;  1AOU F;  2CBL A;  1P92 A;  4C0G A;  4F7U F;  2C06 A;  3VYH B;  5A0G A;  1ZUY A;  1RPY A;  1D3B A;  4BE2 A;  5IN1 A;  2EGA A;  1QVF A;  3CD6 T;  1UGP B;  4FT4 A;  2ECZ A;  4M78 F;  4CC4 B;  1O47 A;  1H92 A;  2YUP A;  2LNV A;  1X6G A;  3LX7 A;  5EHP A;  3QWY A;  4OB3 B;  1VQP Q;  1G3S A;  1O43 A;  1X2Q A;  3LLR A;  2CP7 A;  2O4X A;  4J83 A;  2EJG A;  2EO3 A;  2L0A A;  1SG5 A;  2EQJ A;  3SWN A;  4M7D G;  4M7A D;  1G3W A;  3OMC A;  4A4G A;  2QEX Q;  3CBL A;  3PFS A;  3CC2 T;  2XI9 A;  1JQQ A;  3JCM P;  3EHQ A;  1K9M C;  4M75 E;  2K79 A;  2QTX A;  3I55 Q;  3CC4 Q;  2EW3 A;  2EQK A;  2RSY A;  1YI2 A;  4IUV A;  4B9W A;  2EBP A;  2DIQ A;  2GFU A;  1VQ4 A;  3CWG A;  1QWE A;  4M7A F;  1BK2 A;  3H41 A;  1PG5 B;  4JRP A;  2GSB A;  4OMP A;  2FG0 A;  4HKE A;  2RN8 A;  4J9G A;  1OYX A;  1GL5 A;  1ZA1 B;  2P84 A;  3QXE B;  2L6K A;  3X28 B;  3MO8 A;  2RI3 A;  1PRL C;  1KA6 A;  3A5Z B;  2LRQ A;  4LDX A;  1BFI A;  3CME T;  3R6O A;  2LJ1 A;  5DM7 R;  4A4H A;  2J7I A;  1KQ1 A;  1I5O B;  3EGX A;  1YHQ Q;  1YJN A;  1M2V B;  3CXC A;  3L42 A;  2CH4 W;  5GAN d;  2DL4 A;  2FB7 A;  1SHG A;  1KD1 R;  2ATC B;  3C4S A;  4GBQ A;  2ABL A;  3JCM f;  3UPU A;  1XJW B;  1PD1 A;  2YRV A;  5DC9 A;  4Z02 A;  3TU4 K;  3PFV A;  4M78 A;  8AT1 B;  1VQN T;  5CAI A;  1NG2 A;  3VUB A;  4E7H A;  1WQU A;  3G4S T;  1WA7 A;  1PM3 A;  1YCY A;  2BZX A;  2JM8 A;  2CGH A;  2SRC A;  4ANJ A;  1W1F A;  2DK3 A;  5LJ5 d;  3UT1 A;  2K5L A;  1U5S A;  2SEM A;  1EZZ B;  3VRZ A;  1KA7 A;  1YJ9 Q;  5CO7 A;  3M9Q A;  3X20 B;  1M2O A;  5GAN 3;  3CC7 Q;  4MZP A;  1XA6 A;  3H0H A;  2D8H A;  2RD1 A;  5LJ3 d;  5IHN A;  1MUZ A;  2QMS A;  4RUG A;  2OJ2 A;  4PJO E;  2C9W A;  1MGQ A;  1BBZ A;  1VYT A;  2CZ7 B;  4HXJ A;  1YJW A;  2DAQ A;  3MCA B;  4K45 A;  3M56 A;  1M90 U;  1UUS A;  2CP6 A;  2KQW A;  4RG8 A;  4XAX B;  2QA4 A;  1K73 U;  2DTI A;  4M4Z A;  1JU5 A;  4LNP A;  2GTO A;  3MP1 A;  1VQ6 T;  3VS7 A;  3GXX A;  4OB2 B;  3LYV A;  3M57 A;  1S72 Q;  1VYU A;  3V8K A;  2MMP A;  1Y0M A;  3F70 A;  1OO3 A;  2DEQ A;  4N0A A;  2EYZ A;  5GAN 8;  5J39 A;  2AKK A;  2DJQ A;  2KYB A;  4II1 A;  4PLL A;  4AG2 C;  3GIB A;  1I5L A;  1RUW A;  1OV3 A;  4PFO A;  5CK9 A;  1I3Z A;  2MRJ A;  1SKU B;  2L5Q A;  1K9M R;  3LH0 A;  2AZS A;  4OMF B;  1YIT Q;  3K2T A;  4M75 A;  1O4O A;  4AMC A;  3EFR A;  3AT1 B;  3OYY A;  1IZ6 A;  1MV0 B;  1N9S A;  4RTT A;  1VQK A;  5IHI A;  4MMK A;  4KGZ B;  1HSQ A;  3CMA Q;  5KYW A;  2CZ6 B;  1VQP T;  2V8J A;  2L3R A;  4M77 C;  1AWW A;  5FU7 B;  3CCJ Q;  2RHX A;  1JYQ A;  3VS2 A;  3LGL A;  4F16 A;  1AZG B;  3HP9 A;  2EKH A;  3EFO B;  2FZK B;  3M55 A;  2QEX T;  4PNO A;  5GAN 7;  1O4M A;  1NZV A;  2E64 A;  1MMG A;  1KIK A;  3URG A;  1M27 A;  2PTK A;  1Y96 B;  2CP5 A;  3SB2 A;  3C94 A;  3I55 T;  3CC4 T;  1KC2 A;  2LVM A;  4B9X A;  2VXE A;  2BZ8 A;  1BKL A;  1BI1 A;  2NLU A;  1VQM A;  2C0T A;  4U17 A;  1Q86 C;  2L8D A;  2HDV A;  3UA7 A;  3OBY A;  1Q7Y C;  3ULR B;  2DZ9 A;  3A8G B;  3PIO A;  4C8Q E;  1PKS A;  4HVW A;  4A54 A;  5LJ5 j;  4J9F A;  2WSC E;  1R77 A;  3VUZ A;  1A1A A;  4C92 B;  1RI0 A;  2DX0 A;  2ZPG B;  1KK7 A;  5D0J A;  2EYW A;  2DRK A;  4MML A;  2E4H A;  1TZE E;  4FCY A;  2F69 A;  3BUN B;  2X4W A;  1OUL A;  2W10 A;  3MPU B;  1VQL T;  2QDY B;  3A8L B;  3EGD B;  1O46 A;  1VQ7 Q;  3JB9 J;  5A0D A;  1VQ5 A;  2CP2 A;  3DLM A;  2H46 E;  1YHQ T;  3QBY A;  3FC3 A;  4OHE A;  1IRX A;  1M61 A;  2CRE A;  1BHH B;  4XTY A;  3CCE A;  1RAF B;  1UUR A;  4F04 B;  5GAO r;  5CKF A;  2EYV A;  5HKY A;  3GXW A;  2YDL A;  4J6W A;  4OGC A;  3G6E A;  4ZTJ A;  3ZL7 C;  3ZFJ A;  4C8Q D;  2XK0 A;  2X9H A;  2DLZ A;  3OQ5 A;  3N8M A;  1PHT A;  2AHJ B;  1K9M U;  1UHF A;  2QXF A;  4C0Z A;  3A1P A;  3L2Q A;  3L2R A;  4XK8 E;  3OYE A;  1BM2 A;  4OB1 B;  2EQU A;  3PNW C;  2HBW A;  2GF7 A;  2LQN A;  2XG8 D;  4E7J A;  4PJO A;  2DLY A;  3RIR A;  3VS4 A;  2QK0 A;  4J8O A;  1QWF A;  4LUD A;  1D3B B;  2E5Q A;  2EO6 A;  4F17 A;  2H8H A;  1KJW A;  2ENM A;  2YSX A;  1NRV A;  4C5E A;  5AXI A;  2KRO A;  2VC8 A;  5KYX A;  3OYB A;  1H8K A;  1YJ9 T;  1QKW A;  1UE9 A;  2K9G A;  1O42 A;  2OI3 A;  3CC7 T;  4J7F A;  3TQ7 P;  2K6D A;  2RH2 A;  2O4X B;  4D8D A;  2D0Q B;  1BB9 A;  1W2B P;  5FRN A;  2CSI A;  4N4G A;  3SWN B;  3JCM e;  1N8R U;  3PSK A;  5LL6 S;  3HKS A;  2K3Y A;  3V8J A;  2OTL T;  2J6O A;  2OX7 A;  2EL8 A;  2K79 B;  3C0C A;  1GCP A;  3OV1 A;  3CPW P;  4F5B A;  3LGF A;  2J06 A;  1S72 T;  3V7R A;  3VKI A;  4BY6 B;  3PMT A;  1CWD L;  3VS1 A;  5ECA A;  2V1Q A;  1VQO T;  2Z0W A;  4DEY A;  5I21 A;  1WIE A;  5J3B A;  3QYG B;  1U8R A;  1G2B A;  4J9D A;  1OPK A;  4PJM A;  1RJA A;  4QSY A;  3PTA A;  1BCO A;  4M7D C;  1YNZ A;  2YSQ A;  2YT6 A;  3OYH A;  4PJJ A;  1R1Q A;  4L5G A;  4IIM A;  1YIT T;  2JMC A;  2PLE A;  3BFM A;  2DVE A;  2LT1 A;  3EGX B;  5A2Q E;  3HHM B;  1TUC A;  1Q86 R;  4V2S A;  2MC1 A;  3CCR A;  4C92 F;  2QAS A;  1O4N A;  3QDF A;  4DA4 A;  5FU6 B;  1Q7Y R;  2MK5 A;  3CMA T;  2E5K A;  2LP5 A;  1QCF A;  4K44 A;  2QG9 B;  1PD0 A;  2DL5 A;  4LDV A;  3CCJ T;  1B07 A;  4F7U G;  1PC0 A;  4K2R A;  3M0Q A;  4HVU A;  4DOW A;  4C8Q A;  1NPR A;  2Y4X A;  2V26 A;  1JWO A;  1RAG B;  3JCM J;  2K7A A;  3E2U A;  4RTV A;  1K4U S;  2EFI A;  4EMK B;  1GRI A;  2GNC A;  3T9N A;  3VRY A;  4PKC C;  4DBF A;  2KT8 A;  6AT1 B;  1NZ9 A;  4M78 G;  3DLL A;  3X26 B;  2SHP A;  3HRT A;  2CIA A;  3MXY A;  3DKM A;  4ORZ A;  3GNF B;  3MAZ A;  1TU0 B;  1KFZ A;  3QHS A;  3PT9 A;  5GAM d;  3N84 A;  1BHF A;  1VA7 A;  3KUF A;  2LQK A;  3M0S A;  2EIF A;  1AYD A;  2DX1 A;  3IMJ A;  2DFU A;  2E3H A;  3CPF A;  1JO8 A;  3CEY A;  1T3S A;  5J26 A;  2QTV A;  3JCM W;  1KHC A;  1QKX A;  1FHS A;  2OAU A;  4EDU A;  2LT4 A;  1Y57 A;  4KGV B;  3CCM A;  4RTX A;  1ABQ A;  1FWZ A;  1WHL A;  1BFJ A;  1YIJ A;  4O6J A;  3NGP A;  5GAN f;  3CCU Q;  1LOJ A;  4UC4 A;  1IS0 A;  1Q81 U;  2KMT A;  1U3O A;  1VQ7 T;  3VRR A;  2PNI A;  1A81 A;  3OYN A;  1YN8 A;  4M7A G;  1BG1 A;  1JYR A;  7AT1 B;  5D6X A;  4NWF A;  3L2Z A;  2JXB A;  1M1K U;  3HSB A;  1U1T A;  1Y96 A;  1K8A C;  2DD5 A;  1N6A A;  3OW2 S;  1N5Z A;  1PSF A;  1LKK A;  3BDL A;  3M4Y A;  3SDZ A;  2DL7 A;  1XNI A;  1KC8 U;  1H3Z A;  3CCQ A;  2CP0 A;  4JS5 A;  4JPB W;  3V7C A;  4NL3 A;  2HL3 A;  4JRQ A;  5EC7 A;  3LWH A;  1CJ1 A;  1UHC A;  2KE9 A;  2JNG A;  4ZN3 A;  2FL7 A;  1TS9 A;  3TSZ A;  4ATO A;  1D1A A;  2RA2 A;  5EEL A;  3HHT B;  5LJ3 f;  2PLD A;  1W2B S;  2LCC A;  2LC4 A;  4CI0 C;  4EMH A;  3CCV Q;  3QSU A;  1WLP B;  1Y07 A;  4M75 B;  5A0L A;  1MMN A;  3KFJ A;  4M77 E;  2KR3 A;  1WZO A;  1PCX A;  5GAN h;  5DC4 A;  3CBO A;  3BDU A;  5BO4 A;  1NLO C;  2GBQ A;  1ZQ1 A;  5KYW B;  2MWP A;  3CPW S;  1M30 A;  2XD0 A;  2OTJ A;  2XHC A;  3PQZ A;  1O4P A;  2QQR A;  3JB9 H;  4XU3 A;  1QVG A;  1MHN A;  2QQ9 A;  2J6F A;  4GLM A;  2LX9 A;  4H1O A;  1IXD A;  4RG2 A;  1WNL A;  4J9C A;  2XIC A;  3VS5 A;  1HD3 A;  2E3I A;  3OP0 A;  3SEM A;  2BBU A;  2YUN A;  4RTW A;  2CDT A;  3CCR Q;  2HD0 A;  3UYO A;  4A4K A;  1BMB A;  1ZSZ A;  2M1H A;  1K76 A;  4BI8 B;  1O4B A;  2XP1 A;  2KVQ G;  1G8X A;  5LJ5 h;  2HQH A;  5GAM j;  4BI4 A;  2V8K A;  1BI2 A;  5CQX A;  2B8A A;  3OS5 A;  5I2M A;  5GJV B;  3RKY A;  4J9H A;  1G83 A;  1CSZ A;  5FU7 C;  4TVR A;  1QMC A;  2EWN A;  5LJ3 h;  4ELY C;  1QP3 A;  2CUB A;  3OB2 B;  4WWQ A;  2CZ1 B;  2NUT A;  1ZHI A;  5GMK j;  1WI7 A;  2WSE E;  2HZY A;  4N4I A;  1NE8 A;  4CRI A;  2M0O A;  4LDY A;  2KY9 A;  2EKO A;  2AOB A;  1RAE B;  4XZ0 A;  3MP6 A;  4FYY B;  3HL8 A;  2OQ1 A;  2BKD N;  1AYA A;  1TSF A;  1VYV A;  2DVJ A;  1OX8 A;  3IMD A;  3QJY A;  1YIJ Q;  3KBG A;  4A4F A;  3JB9 D;  2HL5 C;  2L4K A;  4QW2 A;  1KHI A;  1LVK A;  4L1B B;  1B47 A;  1FU6 A;  2DL8 A;  3DB3 A;  2MIO A;  4FSS A;  1O44 A;  2M51 A;  2P4T A;  2JTE A;  1RAC B;  1X75 C;  3SD4 A;  1Q82 U;  4GPL B;  5IAY A;  3VRN A;  2LCL A;  3KXT A;  3L2V A;  4PJO B;  4AFQ C;  1SPK A;  2DET A;  2K57 A;  3OY9 A;  2COW A;  2ZPE B;  3JB9 F;  1JXO A;  2EYX A;  3N7Y A;  4EIH A;  3QWX X;  1KQS A;  5KYX B;  2VKN A;  2JN0 A;  5M9O A;  1LUI A;  3S3O A;  4JRI A;  5FRM A;  3VS0 A;  5HK3 A;  3MET A;  4M75 D;  2Y4Y A;  5EG2 A;  3I56 A;  4IIO A;  2HDX A;  1O4K A;  1JJ2 A;  2CZ0 B;  2F5K A;  2LX7 A;  4A63 B;  3HRU A;  2RM4 A;  2G3R A;  3S6W A;  3A8M B;  1PWT A;  4LUE A;  3CCU T;  3S8N A;  3M53 A;  3TL0 A;  1RAD B;  3LW5 E;  3TEE A;  2R5A A;  3MEU A;  1LKL A;  4EMK A;  4M75 F;  3FRN A;  1O4E A;  2X4X A;  4WCI A;  1UTI A;  1VQ8 Q;  3OYJ A;  4X34 A;  1T3L A;  4Q5W A;  5GAN g;  4MDW A;  1XQH A;  1WGS A;  1ABO A;  1IGQ A;  3PVL A;  4NOY A;  3OYC A;  1AB2 A;  1PRM C;  1MMA A;  4ZGD B;  4R56 A;  4MDX A;  2IPO B;  4NL2 A;  4XU0 A;  4JZ4 A;  3ME9 A;  3REB B;  4M7D E;  3S8O A;  1O4C A;  4KH1 B;  1JXM A;  3HCK A;  1UJY A;  3CCL Q;  2LNW A;  4F5A A;  2YLC A;  4NS5 A;  1QVP A;  2PVG B;  3MP8 A;  3SWN C;  1O4F A;  2PU9 B;  1UJ0 A;  3OB9 A;  1JB0 E;  3US4 A;  2XU8 A;  1U1S A;  5CQY A;  3CCV T;  3I9Q A;  5LJ5 g;  3M0P A;  5AT1 B;  3HPW A;  5CVI A;  2ZPB B;  1IHV A;  1AT1 B;  1NYF A;  1NYG A;  1VIE A;  3VJP A;  3K2M A;  3J80 E;  4BY6 C;  1VQ9 A;  5DC0 B;  2MOX A;  5GMK l;  4JEG A;  5LJ3 g;  2DIG A;  4VUB A;  1XOV A;  3J81 E;  2EGE A;  4C8Q B;  4BUG A;  1KQ2 A;  1Q95 G;  3IN8 A;  5KYN A;  3S3M A;  2EJ9 A;  2G6F X;  1X0N A;  2RQT A;  2K7A B;  2RPN A;  2IZV A;  5HY6 A;  3RUX A;  2HSE B;  4BD3 A;  3LH5 A;  2HBP A;  3M7F A;  1AOT F;  1LPL A;  3BW1 A;  3CBM A;  4OMN A;  3OYD A;  1QP2 A;  4ELZ C;  3LWI A;  2YRD A;  1YI2 Q;  1IJR A;  4PJO D;  4ME7 A;  1KD1 U;  5GAN 4;  3N5B B;  1VQ4 Q;  5GMK i;  3M58 A;  4PJL A;  2B86 A;  5FU6 C;  4JJN K;  3GPL A;  2VAS A;  2W0Z A;  2QDL A;  3G71 A;  3CCS A;  1B7T A;  5GJH A;  1AHJ B;  4AFZ C;  2L3T A;  2LRA A;  3BY7 A;  1AD5 A;  4D6W A;  2KK4 A;  1A1C A;  1U06 A;  1SHF A;  1K9A A;  5C6S A;  3JSC A;  3MHX A;  3EG9 B;  4PJO F;  1WHM A;  1BI0 A;  4M78 C;  1H64 1;  1RAI B;  2K3X A;  2ZZD A;  2YUQ A;  4C0D B;  2KK6 A;  2HQX A;  2DIL A;  2KXD A;  3WVE B;  3I56 Q;  2EKX A;  4FW2 A;  1TUG B;  1A1B A;  2GFA A;  1YJN Q;  5KAZ A;  4DBQ A;  1WDX A;  4MZT A;  1M4Z A;  1YIJ T;  4Y28 E;  1D0Z A;  5CKH A;  2QQB A;  2WAC A;  2AZV A;  4GL9 E;  2I2L A;  2M16 A;  2KEA A;  1O9S A;  3CD6 A;  1D09 B;  1NEG A;  1TUD A;  1GXI E;  1O4J A;  2FRW A;  3GBQ A;  2LCS A;  3INZ A;  4C92 G;  3TKZ A;  3UWN A;  4M7A C;  2FRY A;  3RMS A;  1D4W A;  1ZBX A;  2D0N A;  3WVD B;  2AUG A;  1M8V A;  4OGE A;  2K5F A;  2X35 A;  3RKW A;  2COZ A;  2KSS A;  2HSP A;  1M1G A;  3QG1 A;  1IGU A;  3S8L A;  3RER A;  4HT8 A;  3UAT A;  4PK4 A;  2RQV A;  2AIR B;  1V76 A;  2D1X A;  1K0X A;  4E7Z A;  1WHH A;  4KBM B;  1WXU A;  5DY9 A;  5HKW A;  1TTH B;  3TCJ A;  1SSF A;  2P0K A;  3L1A A;  4HCB A;  2P4R A;  3ZNI A;  2O31 A;  3WXM B;  4DQ2 A;  4N0A C;  1E6H A;  1SKJ A;  4A4B A;  4M7D A;  1X6C A;  4FYV B;  4KUI A;  2H5K A;  3MXC A;  4Y92 A;  2H3J A;  4F14 A;  2D6F A;  1YJW Q;  1VQ8 T;  3VRO A;  4J6Y A;  4R0K A;  1MIL A;  5GMK m;  4E7S A;  1O49 A;  1O4D A;  5FLX E;  4IUU A;  3PLF B;  3JCM d;  2QA4 Q;  4OHD A;  1SRL A;  3HFO A;  2E12 A;  3OW2 P;  1QVF P;  4ZGJ B;  4AG1 C;  3OS2 A;  3GOX A;  1ZSZ B;  2KXC A;  4HCK A;  4BDZ A;  1N27 A;  4XQ3 A;  3CME A;  2E10 A;  4C8Q F;  3MEV A;  1AWX A;  1GCQ C;  3GF5 A;  2LJ3 A;  1E7O A;  3PIP A;  4Y91 A;  4JJD A;  4J5Y A;  1AEY A;  3CCL T;  5GMK h;  2DXT A;  1OZ2 A;  1WXB A;  2DMO A;  2KI7 A;  4XTX A;  2DA9 A;  2NUT B;  1UGV A;  3QPH A;  4R55 A;  2XDD A;  3REA B;  3RR6 A;  4KRT A;  3TSW A;  2IG0 A;  4FSX A;  3BUX B;  1M27 C;  4LD9 K;  1VQN A;  5I11 A;  4X6S A;  2HKN A;  3OYM A;  1UFF A;  3G4S A;  1RLP C;  3ASK A;  4Z89 A;  2CS0 A;  1OX9 A;  1AVZ C;  3JB9 I;  1VQK Q;  1LJO A;  3EH2 A;  4AT1 B;  4LDW A;  1UGQ B;  4FW1 A;  2JT4 A;  5EG3 B;  4JDS A;  5C0M A;  2RB6 A;  2RMX A;  4OMO A;  3H0F A;  1UEB A;  1BI3 A;  2K4Y A;  2E65 A;  1ZSG A;  3I5R A;  2DJZ A;  3VRQ A;  1M3A A;  3GLX A;  3NFC A;  2HCK A;  3V7S A;  4FL6 A;  4Z88 A;  2I0N A;  3QII A;  2CSQ A;  1YI2 T;  3OSV A;  2L89 A;  1BIA A;  1VQM Q;  2M02 A;  1VQ4 T;  2YLB A;  4PFP A;  3CXC P;  1UUE A;  1A09 A;  9ATC B;  3EG0 A;  1BKM A;  5I2S A;  1RAH B;  1K0S A;  3KFV A;  4QKU A;  4QT7 A;  3RMQ A;  2LMJ A;  3M5A A;  3L2U A;  4FBN A;  4FT2 A;  4JJB A;  5CKB A;  2DBM A;  1CWE A;  1VQ6 A;  3PJP A;  2DM0 A;  3M59 A;  4L6V 5;  1MNE A;  3EFS A;  1FMK A;  1NJI C;  4EPC A;  1VIF A;  4PL6 A;  1A08 A;  4FYX B;  3JCM V;  3EAZ A;  1KG1 A;  2A28 A;  2O2O A;  1UDL A;  1VQ5 Q;  1SF9 A;  2MYS A;  2Y3A B;  1BLJ A;  2ZPI B;  4FL2 A;  1YJN T;  5CCA A;  2EJF A;  5CDW A;  2RHY A;  1AZE A;  3CCE Q;  3HTR A;  2IUG A;  2AKL A;  2L2P A;  2V8I A;  2RHZ A;  1X6B A;  1H9O A;  1SPS A;  4E6R A;  3GQI B;  1Y7X A;  1GBQ A;  2CR4 A;  1QW1 A;  3G6E Q;  3JRZ A;  3OS1 A;  2PNB A;  1Z3K A;  2YUO A;  2GTJ A;  2IVW A;  1LCK A;  1M9S A;  2EOB A;  2HUW A;  1WX6 A;  1YFN A;  3JCM X;  2O01 E;  1FBZ A;  2YRC A;  3VRP A;  1WQ7 A;  1VQP A;  1OEB A;  5L23 A;  5DF6 A;  3T04 A;  2QI2 A;  1OU8 A;  3EG9 A;  3MKD A;  5GAO q;  1R0C B;  2RQW A;  5IBS A;  5GAO m;  3FDR A;  2D8J A;  2GQI A;  1MND A;  2QEX A;  3OBW A;  5IBM A;  4PLI A;  1M90 C;  2KYM A;  3I55 A;  3CC4 A;  3EGU A;  1K73 C;  2JW4 A;  2EQM A;  2RQU A;  1OZ3 A;  3MJX A;  5DLO A;  1K1Z A;  1X43 A;  1QVF S;  1I81 A;  4JUV A;  1EFN A;  3D7S B;  2FYK A;  2FZG B;  3JB9 G;  4IUP A;  3S3N A;  5KYU A;  4E2F B;  4GWF A;  3BUO B;  1SHD A;  1LNX A;  1YJW T;  3Q1J A;  1G5V A;  2ROT A;  1HJD A;  5LJ5 f;  3GNG A;  2QA4 T;  3JCM c;  1FX7 A;  2BE9 B;  2FPD A;  1Q86 U;  1YWP A;  4GLK A;  2Y1N A;  3CQT A;  5KYY A;  3CD3 A;  4RCC A;  4H34 A;  1Q7Y U;  2DF6 A;  1ZUK A;  4F7U E;  1VQL A;  2EQI A;  4IUT A;  2CH4 A;  2CUD A;  1YVL A;  4JS4 A;  2KRN A;  2DL3 A;  1T0H A;  4C5G A;  1YHQ A;  2KNO A;  4M75 G;  1XTD A;  2EGC A;  2ZPH B;  3SHW A;  2VYT A;  2CRH A;  2VWF A;  4M78 E;  1RQQ C;  3A98 A;  2Y90 A;  2V1R A;  4JLI A;  3NPF A;  5FWC A;  1R1S A;  5J3X A;  2JJ9 A;  4IUR A;  3RBB B;  1Y1U A;  2DE0 X;  2VV5 A;  1IB8 A;  2KT1 A;  5GAN 6;  2NYS A;  2B3O A;  3WA4 A;  2QAZ A;  1TOV A;  3M54 A;  1VQK T;  1GBR A;  2A08 A;  4RTZ A;  1BCM A;  2K2V A;  3JAM E;  1C1A A;  2KBT A;  3OYF A;  3CXC S;  1NLP C;  4E68 A;  3LYI A;  4M77 D;  4HVV A;  4EMG A;  1SRM A;  4M7A E;  2RI2 A;  1WFW A;  2EYY A;  1OU9 A;  3OMG A;  4J9B A;  4PFZ A;  1NJI R;  1FBV A;  3CC7 A;  2RK2 A;  4KUL A;  1QCO A;  1O75 A;  3E9F A;  5GAN 2;  4DBH A;  2DKG A;  5I22 A;  1VQM T;  4C0D C;  3E19 A;  3OS0 A;  2ESW A;  3OW2 A;  4M77 F;  1RL2 A;  1IRE B;  1M3B A;  2JS2 A;  3UDC A;  2M0Y A;  2JTF A;  2OTL A;  3EAE A;  5HCK A;  1X01 A;  1O41 A;  1P13 A;  4BE0 A;  2ED1 A;  1S1N A;  2JZ2 A;  1SHB A;  3QYH B;  1R0B G;  2CI9 A;  1S72 A;  3HFN A;  3CCM Q;  2R5M A;  2ROR A;  4E93 A;  1D1C A;  2HDA A;  4E7I A;  1OOT A;  1NPP A;  4M7D B;  2MRK A;  3L2W A;  1O4L A;  1VQO A;  3M4G A;  4RCB A;  1BLK A;  3P8B B;  4C92 C;  1VQ5 T;  2C0I A; 
#chains in the Genus database with same CATH homology
 1H8K A;  1NEB A;  2PNA A;  1IJR A;  2LJ0 A;  1QKW A;  1UE9 A;  3VGO A;  4A4C A;  3R6N A;  4OHL A;  2K9G A;  4U1P A;  1O42 A;  2OI3 A;  2IIM A;  2IUI A;  2VIF A;  1A07 A;  2JMA A;  2B86 A;  4LN2 A;  2W0Z A;  2FPF A;  2QDL A;  4EIK A;  2K6D A;  3PS5 A;  5GJH A;  1E6G A;  2DCR A;  4X1V A;  4AFZ C;  2L3T A;  4D8D A;  4OHH A;  1BB9 A;  3EG3 A;  1A0N B;  1Z9Q A;  1AD5 A;  1A1C A;  1U06 A;  2CSI A;  4RTY A;  3EG2 A;  2O9V A;  5HKZ A;  1QG1 E;  3PSK A;  1SHF A;  1K9A A;  4RTU A;  2L3S A;  2RF0 A;  2J6O A;  2EL8 A;  1O4I A;  4DEX A;  2K79 B;  3C0C A;  1GCP A;  2YUQ A;  1O4R A;  3OV1 A;  3VS3 A;  2KK6 A;  4ROJ A;  2FPE A;  4P9Z A;  4F5B A;  1LUK A;  2J06 A;  1X27 A;  2DIL A;  2F2W A;  1CWD L;  2KXD A;  4JE4 A;  5IH2 A;  3VS1 A;  2VVK A;  4AFS C;  5ECA A;  2EKX A;  2KNB B;  3H0I A;  1A1B A;  5IHK A;  5KAZ A;  2V1Q A;  4DEY A;  1WDX A;  2JYQ A;  1WIE A;  3OVE A;  2HEQ A;  2LZ6 B;  1D1Z A;  2EPD A;  1NZL A;  1RI9 A;  2AZV A;  4H34 A;  1G2B A;  4GL9 E;  4J9D A;  1OPK A;  1IO6 A;  2KEA A;  3PE0 A;  1RJA A;  4QSY A;  2LNX A;  1CSK A;  2NUZ A;  1LCJ A;  1YNZ A;  1CSY A;  2NWM A;  2YSQ A;  2YT6 A;  1NEG A;  1TUD A;  2PZ1 A;  1R1Q A;  1X2K A;  1O4J A;  2RMO A;  1R1P A;  2FRW A;  1BHH A;  3GBQ A;  2LCS A;  4IIM A;  3U23 A;  1WYX A;  4J9E A;  2DLP A;  3TKZ A;  2JMC A;  1HCT B;  2PLE A;  4EY0 A;  1PKT A;  2FRY A;  1D4W A;  2BZY A;  2D0N A;  1JYU A;  2AUG A;  3HHM B;  1TUC A;  1F1W A;  2RVF A;  2MC1 A;  1ZBJ A;  1O4N A;  2DBK A;  2HSP A;  1D4T A;  3M0R A;  2AOA A;  2E5K A;  4OMQ A;  2LP5 A;  1QCF A;  4K44 A;  1TCE A;  2DL5 A;  1B07 A;  2FO0 A;  1OO4 A;  2ECD A;  4K2R A;  3S8L A;  2O9S A;  4ESR A;  1YVH A;  3M0Q A;  3UAT A;  2J6K A;  2YU7 A;  4HVU A;  2RQV A;  3IQL A;  2CT3 A;  2D1X A;  3NMZ C;  1K0X A;  3EG1 A;  2KGT A;  3PVQ A;  1JWO A;  5HKW A;  1WXU A;  1AOU F;  2CBL A;  2K7A A;  1X69 A;  4RTV A;  1K4U S;  2EVR A;  1GRI A;  2DNU A;  2GNC A;  3VRY A;  2P4R A;  3ZNI A;  2O31 A;  2KT8 A;  1SSH A;  1ZUY A;  1RPY A;  3EAC A;  1E6H A;  1SKJ A;  4A4B A;  5GJW B;  2SHP A;  1X6C A;  2H5K A;  5GJI A;  2CIA A;  3MXY A;  3MXC A;  2EGA A;  4ORZ A;  4Y92 A;  3MAZ A;  3JV3 A;  1YP5 A;  1KFZ A;  5AUL A;  1UEC A;  4OHI A;  4F14 A;  1T0J A;  3N84 A;  1BHF A;  2ECZ A;  4CC4 B;  1VA7 A;  1O47 A;  1H92 A;  1O4Q A;  3VRO A;  1MIL A;  4R0K A;  2DYB A;  1O49 A;  2IUH A;  1O4D A;  3PLF B;  2YUP A;  3M0S A;  1AYD A;  1X6G A;  5EHP A;  4OHD A;  3QWY A;  1SRL A;  2DX1 A;  3IMJ A;  4AG1 C;  1JO8 A;  2K3B A;  1O43 A;  1X2Q A;  1AWO A;  1T3S A;  2KXC A;  4HCK A;  2EO3 A;  1OPL A;  1QKX A;  2L0A A;  1O4H A;  1FHS A;  1SHA A;  4JZ3 A;  1AWX A;  1SPR A;  1GCQ C;  1KSW A;  1Y57 A;  2LJ3 A;  4RTX A;  1ABQ A;  1BU1 A;  1E7O A;  3CBL A;  1BFJ A;  3NGP A;  4JJD A;  1JQQ A;  3EHQ A;  1AEY A;  1IS0 A;  3BKB A;  1U3O A;  3VRR A;  2K79 A;  2K2M A;  2PNI A;  1A81 A;  1YN8 A;  5IXF A;  2EW3 A;  2RSY A;  1RLQ C;  1WXB A;  1BG1 A;  1JYR A;  1YCS B;  2DMO A;  2EBP A;  2DA9 A;  4NWF A;  1UGV A;  2JXB A;  2X3X D;  3REA B;  3CWG A;  4KRT A;  1QWE A;  3TSW A;  3BUX B;  1M27 C;  1LUN A;  1PIC A;  3M0U A;  4X6S A;  5I11 A;  1AYB A;  2L3P A;  1N5Z A;  1UFF A;  2LQW A;  4J9I A;  1BK2 A;  3H41 A;  2GSB A;  1LKK A;  1RLP C;  2FG0 A;  4OMP A;  4CC7 A;  4Z89 A;  2A37 A;  2CS0 A;  2DL7 A;  1AVZ C;  2RN8 A;  4J9G A;  1GL5 A;  2L6K A;  1CKB A;  3BUM B;  1GFC A;  4JPB W;  1PRL C;  1KA6 A;  2GE9 A;  3UF4 A;  4DGX A;  1GCQ A;  2JT4 A;  5EC7 A;  1CJ1 A;  5EG3 B;  2RMX A;  1BFI A;  1UHC A;  4AFU C;  4OMO A;  2KE9 A;  2F2V A;  3H0F A;  2LJ1 A;  1ARK A;  3I5R A;  1ZSG A;  2GGR A;  2J7I A;  3TSZ A;  5EEL A;  3VRQ A;  1M3A A;  4TZI A;  2PLD A;  3THK A;  5EHR A;  2CH4 W;  1F2F A;  2DL4 A;  1MW4 A;  1SHG A;  2HCK A;  4Z88 A;  1WLP B;  2I0N A;  4GBQ A;  2ABL A;  2CSQ A;  2BTT A;  3KFJ A;  1AYC A;  2KR3 A;  5I6V A;  5DC4 A;  3HIZ B;  5DC9 A;  1O4A A;  1UG1 A;  5BO4 A;  1NLO C;  2GBQ A;  2A36 A;  3PFV A;  1UUE A;  1A09 A;  1M30 A;  1BKM A;  3EG0 A;  1K0S A;  1NG2 A;  2AK5 A;  3KFV A;  4QT7 A;  3PQZ A;  1PNJ A;  1I07 A;  2LMJ A;  1O4P A;  1WQU A;  4FBN A;  4JJB A;  1WA7 A;  3OB1 B;  2DBM A;  1CWE A;  3PJP A;  2J6F A;  2DM0 A;  2BZX A;  2JM8 A;  1JU5 C;  4GLM A;  2SRC A;  4H1O A;  4J9C A;  1W1F A;  1FMK A;  3VS5 A;  1ZUU A;  4P9V A;  1HD3 A;  3OP0 A;  3SEM A;  1A08 A;  4FL3 A;  2BBU A;  2YUN A;  1M8M A;  4RTW A;  2CDT A;  3EAZ A;  2A28 A;  2O2O A;  5EEQ A;  4OML A;  1U5S A;  2SEM A;  3UYO A;  1UDL A;  2Y3A B;  3VRZ A;  1B3Q A;  1BMB A;  1KA7 A;  1K76 A;  2F2X A;  1GHU A;  1O4B A;  2XP1 A;  1BLJ A;  3O5Z A;  4FL2 A;  3RNJ A;  5CDW A;  3CXL A;  1AZE A;  1XA6 A;  3H0H A;  2D8H A;  4JJC A;  1I1J A;  5IHN A;  2AKL A;  2L2P A;  2IUG A;  1X6B A;  1MUZ A;  2LNH B;  5GJV B;  4RUG A;  1H9O A;  4E6R A;  4J9H A;  1G83 A;  1SPS A;  2QMS A;  3GQI B;  2OJ2 A;  1GBQ A;  1I0C A;  1CSZ A;  2O88 A;  2CR4 A;  2PNB A;  2C9W A;  1Z3K A;  2YUO A;  1BBZ A;  1VYT A;  2GTJ A;  2FEI A;  1ZFP E;  2CUB A;  4HXJ A;  4K45 A;  1LCK A;  3OB2 B;  2X3W D;  1UUS A;  4WWQ A;  2EOB A;  2J05 A;  2HUW A;  1WX6 A;  1WI7 A;  4LE9 A;  4M4Z A;  1JU5 A;  1FBZ A;  4LNP A;  2GTO A;  3VRP A;  1OEB A;  5L23 A;  5DF6 A;  3VS7 A;  1QAD A;  3T04 A;  3GXX A;  2L3Q A;  3I35 A;  3VS6 A;  2JS0 A;  1VYU A;  2AOB A;  2DM1 A;  1O48 A;  2RQW A;  1CKA A;  4XZ0 A;  5IBS A;  1Y0M A;  3C7I A;  2D8J A;  1OO3 A;  2GQI A;  2OQ1 A;  1AYA A;  1VYV A;  2ROL A;  2DVJ A;  3IMD A;  5IBM A;  2EYZ A;  1TG0 A;  4CC2 A;  2KRM A;  2AKK A;  2DJQ A;  2KYB A;  2KYM A;  4AG2 C;  2MQI A;  3EGU A;  2L4K A;  2DRM A;  2JW4 A;  1RUW A;  2RQU A;  4JGH A;  1OV3 A;  1K1Z A;  1X43 A;  4L1B B;  1M3C A;  1B47 A;  1J3T A;  1FU6 A;  2DL8 A;  1EFN A;  3S9K A;  1I3Z A;  2MIO A;  1A1E A;  4FSS A;  1O44 A;  2MRJ A;  2M51 A;  2JTE A;  3FJ5 A;  4GPL B;  4GWF A;  2AZS A;  3VRN A;  3BUO B;  4XZ1 A;  1SHD A;  4AFQ C;  1SPK A;  1HJD A;  2ROT A;  4F59 A;  1O4O A;  2MK2 A;  1MV0 B;  4RTT A;  1JXO A;  2EYX A;  3N7Y A;  4EIH A;  1YWO A;  3QWX X;  5IHI A;  5FW9 A;  3IN7 A;  1HSQ A;  2KRS A;  2VKN A;  1WXT A;  2FPD A;  1LUI A;  1YWP A;  5FWB A;  3VS0 A;  2JM9 A;  3CQT A;  1AWW A;  1ZLM A;  1JYQ A;  2Y1N A;  3CD3 A;  3BUW B;  3VS2 A;  1W70 A;  2RQR A;  4F16 A;  1AZG B;  2DF6 A;  4IIO A;  1ZUK A;  3UA6 A;  2CI8 A;  2HDX A;  2EQI A;  2MCN A;  1O4K A;  2CH4 A;  2CUD A;  1YVL A;  2LX7 A;  4A63 B;  1O4G A;  2KRN A;  2EKH A;  2DL3 A;  2EU0 A;  1QLY A;  3EHR A;  2FCI A;  3PSJ A;  1PWT A;  1T0H A;  4LUE A;  2RNA A;  1O4M A;  1FYR A;  3S8N A;  2KNO A;  1NZV A;  3TL0 A;  2EGC A;  1KIK A;  1M27 A;  3SHW A;  2PTK A;  2CRH A;  2VWF A;  1KC2 A;  2ETZ A;  1RQQ C;  3A98 A;  1FU5 A;  1LKL A;  2BZ8 A;  1BKL A;  2V1R A;  5IXB A;  2C0T A;  4CC3 A;  3NPF A;  5FWC A;  1O4E A;  4U17 A;  4WCI A;  1UTI A;  1LUM A;  2HDV A;  1R1S A;  1W6X A;  5J3X A;  3UA7 A;  1SEM A;  1HCS B;  1T3L A;  3RBB B;  3ULR B;  1Y1U A;  2DE0 X;  2Y1M A;  1PKS A;  2KT1 A;  2OAW A;  1AWJ A;  4HVW A;  4J9F A;  1ABO A;  1O45 A;  3PVL A;  2B3O A;  1JEG A;  1A1A A;  3WA4 A;  1AB2 A;  1PRM C;  1Z9Z A;  2CT4 A;  2DX0 A;  2OZO A;  1GBR A;  2A08 A;  4JZ4 A;  5D0J A;  3REB B;  2EYW A;  2DRK A;  4RTZ A;  1TZE E;  3S8O A;  3M0T A;  3BUN B;  2W10 A;  1O4C A;  1JXM A;  1O46 A;  3HCK A;  1UJY A;  2LNW A;  4F5A A;  2KBT A;  1NLP C;  4DGP A;  4E68 A;  4HVV A;  2ED0 A;  4K11 A;  2H46 E;  1SRM A;  1WFW A;  2EYY A;  4OHE A;  1O4F A;  1FYN A;  4J9B A;  1UJ0 A;  1M61 A;  2CRE A;  1BHH B;  1FBV A;  3US4 A;  1UUR A;  3I9Q A;  3M0P A;  2EYV A;  5HKY A;  3GXW A;  3TVT A;  1H3H A;  1AOJ A;  5I22 A;  2YDL A;  1NYF A;  1NYG A;  3K2M A;  3ZL7 C;  2HMH A;  2LCT A;  2ESW A;  5DC0 B;  1GFD A;  2DLZ A;  2JS2 A;  1M3B A;  2MOX A;  1PHT A;  2M0Y A;  3N8M A;  1UHF A;  4JEG A;  1XOV A;  5HCK A;  2XMF A;  4D8K A;  1O41 A;  1MV3 A;  1P13 A;  2EGE A;  3NHN A;  4ZNX A;  1BM2 A;  3I5S A;  4Z8A A;  1ZX6 A;  3IN8 A;  1V1C A;  2ED1 A;  1S1N A;  4OMM A;  1SHB A;  1NM7 A;  2HBW A;  2CI9 A;  2G6F X;  1X0N A;  2RQT A;  2LQN A;  2K7A B;  2RPN A;  2IZV A;  2DLY A;  3VS4 A;  2ROR A;  4E93 A;  3LH5 A;  1QWF A;  4LUD A;  3M7F A;  1AOT F;  2HDA A;  2EO6 A;  1OOT A;  4F17 A;  2MRK A;  1BF5 A;  2H8H A;  1O4L A;  1KJW A;  4OMN A;  2ENM A;  2YSX A;  1NRV A;  4NWG A;  2C0O A;  1BLK A;  5AXI A;  2KRO A;  2C0I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...