3NHNA

Crystal structure of the src-family kinase hck sh3-sh2-linker regulatory region
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
163
structure length
163
Chain Sequence
DIIVVALYDYEAIHHEDLSFQKGDQMVVLEESGEWWKARSLATRKEGYIPSNYVARVDSLETEEWFFKGISRKDAERQLLAPGNMLGSFMIRDSETTKGSYSLSVRDYDPRQGDTVKHYKIRTLDNGGFYISPRSTFSTLQELVDHYKKGNDGLCQKLSVPCM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the Src Family Kinase Hck SH3-SH2 Linker Regulatory Region Supports an SH3-dominant Activation Mechanism.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Tyrosine-protein kinase HCK
total genus 31
structure length 163
sequence length 163
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2010-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00017 SH2 SH2 domain
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 3nhnA01
3.30.505.10 Alpha Beta 2-Layer Sandwich SHC Adaptor Protein SH2 domain 3nhnA02
3VRNA 1UHFA 2SHPA 2DBKA 2LCSA 2DBMA 2AOBA 4P9VA 1N5ZA 3ZNIA 1GBRA 2A28A 1M8MA 2GQIA 3M7FA 1BM2A 2GGRA 1X6BA 3TSZA 1EFNA 3H41A 1H8KA 3H0HA 1MUZA 3LH5A 2L3TA 3I5RA 2XMFA 2RQUA 1E6GA 4LE9A 1A1BA 1O47A 2K7AA 2HDVA 1FHSA 1QWEA 2KT8A 4ORZA 2EYWA 1D4TA 5I11A 1M3AA 1AWWA 2K79A 4CC2A 2NWMA 4OHDA 2RQVA 2FG0A 3PSKA 5IBMA 2KK6A 1U3OA 2EU0A 2FO0A 2CT3A 4JEGA 4F5AA 3EG3A 2DYBA 1AWJA 2K9GA 1JYQA 3TL0A 2J05A 4JE4A 5CDWA 3MXCA 2HDXA 3HIZB 2JW4A 1SSHA 1GRIA 1ZUYA 2CDTA 2HCKA 3GBQA 2CSIA 2QMSA 2JTEA 5HKWA 2Y1NA 4FSSA 2EGEA 2EKXA 4H1OA 5DC9A 1KSWA 4J9CA 1OOTA 2LNHB 2DX1A 5I22A 1A08A 1BG1A 3RBBB 1O4AA 4X6SA 1UTIA 2VVKA 2DL8A 2ED1A 2ESWA 2V1RA 1MILA 1WI7A 4K11A 4EIKA 2RSYA 1B47A 2F2XA 2MK2A 1I0CA 4X1VA 1IJRA 4NWFA 4TZIA 1OPLA 1PICA 3TVTA 1UHCA 3R6NA 4D8KA 1KJWA 2AZVA 3QWXX 2ECDA 4CC4B 2G6FX 2RPNA 3KFVA 3GXXA 4AG2C 3N84A 2DLZA 2PZ1A 3TSWA 2CI9A 2C9WA 1SRLA 1NG2A 2F2VA 1BHFA 1YWPA 2HSPA 1QCFA 2W0ZA 3PE0A 3RNJA 5GJHA 4D8DA 5BO4A 4GWFA 2EOBA 2K7AB 4DGXA 4CC3A 2L3QA 2ROLA 4OHHA 2YSQA 3MXYA 5FW9A 4DEYA 2LZ6B 3EHRA 3UF4A 1KFZA 1H3HA 1D1ZA 2DLYA 2CUBA 1MV3A 1QADA 5EC7A 3OV1A 2OQ1A 4RTWA 1OV3A 1UJYA 3C0CA 2DNUA 5HKZA 2JMAA 3S8OA 2YUQA 1R1PA 5AXIA 1X6CA 4H34A 1K0SA 2EPDA 2LNXA 2VWFA 2O9VA 1WDXA 1UDLA 1GFCA 2DRKA 2ENMA 4AFSC 2M0YA 5HCKA 3PSJA 4GL9E 1CJ1A 2FRWA 2L4KA 1O4FA 3PVQA 1OO3A 1X2KA 2GBQA 3VRZA 1WFWA 1JU5C 1O49A 1XA6A 4J9EA 3VS2A 1W70A 1GFDA 1AD5A 4ZNXA 5J3XA 2IZVA 2BTTA 1BU1A 4RTVA 4WCIA 2D8HA 1WQUA 4FBNA 4OMOA 1RUWA 2OAWA 1I3ZA 1LKKA 2JXBA 1BKLA 3VS5A 2DM0A 3NGPA 2KNOA 3UYOA 4OMPA 1RI9A 1M27A 2D8JA 4AG1C 3PJPA 1GHUA 1ABQA 2HDAA 2KE9A 1SHBA 2FPDA 1QKWA 3O5ZA 4KRTA 3NPFA 4RTTA 3VS7A 2EVRA 2VIFA 2Y3AB 1CWDL 3S8NA 5EEQA 1YN8A 2AK5A 2BBUA 4F16A 1AB2A 1FU5A 1T3LA 2J6FA 1X69A 1RPYA 4XZ0A 1LCJA 1KA6A 1SKJA 1NRVA 4E6RA 3CD3A 1B07A 1SHGA 3IN8A 1AYAA 1HSQA 2EO3A 5FWCA 1K9AA 1O4PA 3EAZA 4OMQA 2EYZA 1OO4A 4EIHA 1UFFA 1JEGA 1BF5A 4QSYA 1JYRA 1O4JA 3VS0A 2GSBA 2IUGA 1WXTA 1M27C 2BZ8A 1WIEA 2L6KA 2EYYA 2DVJA 2J06A 2M51A 1PHTA 1T0HA 2ECZA 2O2OA 2JS2A 2EYXA 2L0AA 2CH4A 2KROA 1O4LA 5EELA 4JJCA 4HCKA 3VRPA 4ESRA 1GCPA 1SRMA 2OI3A 3UA6A 3M0TA 2EQIA 2LP5A 2LQNA 4JZ3A 1Z3KA 1WXBA 4J9GA 4U1PA 3WA4A 5EHRA 1BHHB 4HXJA 1ZLMA 4K45A 2ETZA 5HKYA 3PVLA 4OHEA 2PNIA 1CKBA 2FEIA 4AFUC 2CS0A 2DL4A 4LNPA 3PFVA 3THKA 2A37A 4OHIA 2DA9A 1F2FA 3PQZA 2ED0A 1NZVA 3CWGA 5L23A 1BFIA 2CREA 2FRYA 2JS0A 2MOXA 2L3PA 1O46A 2DLPA 2I0NA 3C7IA 3GXWA 1NEBA 2MC1A 1QLYA 2GE9A 2DMOA 3QWYA 2YU7A 2BZYA 4J9BA 4Z88A 1RQQC 1Z9QA 2JYQA 1O48A 2FCIA 2GNCA 4A63B 1KA7A 2MRJA 1KIKA 4HVUA 1B3QA 2LX7A 1BKMA 1O4KA 2EW3A 1TUDA 1CSKA 1S1NA 3EACA 4JGHA 1NYFA 1X27A 2KXDA 4M4ZA 3REBB 1Y1UA 4AFQC 4R0KA 1GCQA 2L3SA 1RLPC 3EHQA 2EL8A 3IN7A 3CQTA 1E6HA 3SEMA 3BUNB 1V1CA 2LQWA 1A1EA 2DM1A 2LNWA 1A1AA 1BLJA 2AOAA 1M3BA 1RLQC 3UA7A 1AEYA 1CWEA 4J9FA 5AULA 4GBQA 3A98A 1O4GA 2CUDA 2KGTA 1M61A 1T0JA 2RMXA 1U06A 3U23A 4IIOA 2B3OA 1O4EA 3M0PA 1UE9A 1J3TA 2A36A 1OEBA 1JXOA 4DGPA 1YNZA 2CT4A 1QWFA 3H0FA 4DEXA 1A0NB 1WA7A 1R1SA 4RTZA 1T3SA 2GTOA 2MRKA 1UURA 1E7OA 3BUXB 4L1BB 1AOTF 3M0RA 1O42A 2AUGA 4LUDA 2YSXA 4NWGA 3REAB 1D4WA 1SHDA 1A07A 5IHKA 4A4BA 2AKKA 3IMDA 4FL3A 3NMZC 1UUSA 1TG0A 3EG2A 2BZXA 1X43A 2K6DA 2X3WD 1A09A 1LKLA 1SPRA 1TCEA 1PKTA 2LMJA 1SEMA 4GLMA 3CBLA 3I5SA 4ROJA 1JU5A 1AYBA 1O4HA 2ROTA 1O4OA 4LN2A 2FPFA 2HEQA 2F2WA 1AZGB 1X6GA 1ZFPE 2RORA 1PWTA 5EG3B 2P4RA 1Y0MA 1YVHA 1JO8A 2JT4A 1FBVA 4JJDA 2H5KA 4E68A 2DF6A 1IO6A 2L2PA 2EO6A 2E5KA 2YDLA 1O41A 3N8MA 4EY0A 2XP1A 3IQLA 2SRCA 1ZX6A 4QT7A 1O4BA 2B86A 2MIOA 2PNBA 1KC2A 4F17A 2C0IA 1P13A 1X0NA 3FJ5A 4LUEA 1YVLA 3OP0A 4J9DA 4RTXA 1R1QA 2EYVA 2PNAA 2HBWA 1HCTB 2RMOA 2DL7A 4F14A 1UGVA 4J9IA 5EHPA 1AYCA 1CSZA 1PNJA 1A1CA 3EG1A 1GBQA 1AWOA 2MQIA 3TKZA 4JPBW 5GJVB 4U17A 1WXUA 3I35A 5FWBA 1O4NA 2KR3A 3NHNA 3S8LA 1PKSA 3VS1A 1O4CA 1XOVA 3EG0A 1JWOA 1O4DA 1QG1E 2KRNA 1I07A 1SHFA 1TUCA 1BMBA 3OB2B 3VGOA 3BUMB 2KRSA 3I9QA 2C0OA 3ULRB 3IMJA 1HJDA 1UUEA 3PLFB 5DC4A 1VYUA 1VYTA 2RN8A 2DL3A 2PTKA 3VRQA 3UATA 1NYGA 1WLPB 2AZSA 5D0JA 4F5BA 1O44A 2J7IA 3VS3A 3M0QA 1X2QA 1BFJA 2RQWA 1FYRA 2KRMA 3ZL7C 5DC0B 1JXMA 5KAZA 4JZ4A 2YT6A 1FU6A 2RF0A 2LCTA 4E93A 2PLEA 1H9OA 2AKLA 4WWQA 1AWXA 1AZEA 3MAZA 1FYNA 1Z9ZA 4J9HA 1M3CA 1UJ0A 2IUIA 3VS6A 2H46E 1NEGA 2C0TA 1LCKA 1FBZA 1CSYA 2X3XD 3SHWA 3BUWB 1HD3A 1MW4A 3JV3A 1NZLA 1OPKA 4HVVA 1BBZA 1K76A 5IHNA 1O4QA 4Y92A 1SPKA 1SHAA 1FMKA 2IUHA 2H8HA 3H0IA 3VRRA 2EGCA 2KYMA 1G2BA 3N7YA 3VS4A 5IXFA 1BHHA 1WYXA 1K0XA 2GTJA 2RQRA 1TZEE 5GJIA 1O45A 2O88A 2CH4W 2KYBA 3M0UA 1NLPC 2MCNA 4XZ1A 2RQTA 4RUGA 1SPSA 3OB1B 2K79B 1VYVA 2KXCA 2DILA 4OMLA 2Y1MA 1LUIA 2EBPA 1WX6A 2YUOA 1ZSGA 1K1ZA 4OMMA 2J6KA 5ECAA 1HCSB 4HVWA 1LUKA 2CSQA 1BK2A 2DE0X 1ZUKA 3CXLA 1JQQA 2QDLA 1F1WA 5IH2A 2HMHA 1YWOA 3OVEA 2IIMA 1AYDA 3GQIB 5IBSA 2LJ3A 1Y57A 4RTUA 2PLDA 3S9KA 1M30A 2JMCA 2OZOA 3US4A 3PS5A 1CKAA 2CI8A 4AFZC 3EGUA 1O4IA 2DJQA 2KT1A 1ARKA 1A81A 3BKBA 2W10A 4RTYA 2CRHA 2OJ2A 4F59A 2DX0A 1GCQC 4OMNA 2A08A 1NM7A 2ABLA 5IXBA 1AOJA 1LUNA 2D1XA 4CC7A 5DF6A 4OHLA 1AVZC 1AOUF 1ZBJA 2DL5A 2J6OA 1VA7A 2KBTA 3VROA 2YUPA 2EKHA 1W6XA 1U5SA 4A4CA 1IS0A 2DRMA 5I6VA 1K4US 2HUWA 5GJWB 1BB9A 3HCKA 4GPLB 1LUMA 2CBLA 2LJ1A 2O31A 2KNBB 2VKNA 1ABOA 1G83A 3HHMB 3K2MA 1I1JA 1QKXA 4FL2A 4Z89A 1PRLC 2JM8A 4IIMA 2YUNA 2D0NA 1ZUUA 3M0SA 1UG1A 2CR4A 1GL5A 2FPEA 2K3BA 2NUZA 2CIAA 4P9ZA 2EGAA 1JYUA 1H92A 1RJAA 2K2MA 4JJBA 4K2RA 4K44A 2O9SA 2LJ0A 2SEMA 3T04A 4Z8AA 1NLOC 1PRMC 1O4RA 1W1FA 2V1QA 2RVFA 3VRYA 3BUOB 5IHIA 2RNAA 1YCSB 1O43A 2DCRA 1YP5A 1BLKA 1UECA 3KFJA 1O4MA 1MV0B 2KEAA 2JM9A
chains in the Genus database with same CATH superfamily
1UHFA 4A4EA 4QVCA 2LCSA 2SHPA 2RA2A 2HKQB 4P9VA 2LRQA 4KULA 1BM2A 2GGRA 3H41A 3H0HA 1I5OB 2DKGA 3VU3C 3I5RA 5KYYB 3ZEHA 2RQUA 3X26B 3BE3A 3OYMA 2KT8A 2X9HA 3CC4Q 2YXYA 1YJ9T 1XTDA 4PJOD 1JRIA 4IUVA 5LL6S 3CD6A 4RCBA 4OHDA 2RQVA 7AT1B 1N27A 3HTRA 1OQKA 2FG0A 5IBMA 4MZMA 4A54A 4M77G 2EU0A 2K9GA 3PNWC 3TL0A 4XU3A 4E7IA 3MXCA 2VV5A 3HIZB 3OW2S 2PVGB 2WSFE 2PU9B 2CDTA 2HCKA 3OBWA 4PJOC 2QQBA 4DOWA 4FSSA 3A5ZB 1VQLA 2EGEA 1Q7YU 5DC9A 5FROA 1OOTA 4C8QG 2RHYA 2YRCA 4E2FB 2VGMA 1EX4A 2VVKA 3P8BB 1BI3A 2ESWA 3QBYA 3SD4A 4EIKA 5DY9A 2RHIA 1VQNT 3GNGA 1IJRA 3I56A 3SWNB 4D6WA 2EQKA 3TVTA 1M2VA 3R6NA 4D8KA 1C6VX 1Y96B 2XD0A 3G4ST 2AZVA 4J6YA 4PLLA 2EIFA 2G3RA 3KFVA 5AYFA 3HPWA 2CI9A 2C9WA 3I56T 3V7SA 1G3TA 1BHFA 1YWPA 3MCAB 3OYHA 3FJPA 2EOBA 4PK4A 2K7AB 2ROLA 1QVFA 1QADA 3OS5A 3OV1A 4M77E 4RTWA 1UJYA 3C0CA 1VQ8Q 3S8OA 2YUQA 1NPRA 2VXFA 3OYJA 4H34A 4PJMA 2LNXA 8ATCB 1D09B 2GQVA 5HCKA 1BI1A 3C12A 1D1BA 3UWNA 2GBQA 1WFWA 1O49A 3HKSA 5GAN2 4PJLA 4PJOE 1W70A 1D1CA 3G7ZA 1SF9A 1KC8C 1WQUA 3JCMW 2CP3A 2COYA 5LJ3d 3UYOA 2D6FA 1QCNA 2D8JA 4AG1C 4BDZA 1M27A 2HDAA 5KYXB 2FPDA 2BE9B 1QKWA 5GAN4 1BIBA 1M1KR 1CWDL 4R55A 1VQMA 5EEQA 4DBHA 1MMDA 2PUKB 3G71T 1RPYA 2HAXA 1SKJA 4E6RA 3CD3A 1SHGA 1KQSA 3EAZA 1IRXA 4JS5A 3CC7A 1Q86R 4HKEA 2L5QA 4M78C 4OMQA 1W4SA 1YI2Q 3AT1B 2GSBA 3QYGB 2BZ8A 2E10A 1WIEA 2CP0A 3PT9A 3NTIA 1YJWA 2XK0A 4XTXA 1JJ2S 2J06A 2M51A 2ECZA 4M7DF 2L0AA 2CH4A 1O4LA 1YI2A 5FU6B 4BI4A 3CCMT 1SRMA 4C0DC 3M0TA 2DXTA 3O8VA 2PVOB 3I55A 4U1PA 1Z3KA 3M56A 4AT1B 1BHHB 1JB0E 1R0BG 1D0YA 3JB9I 2CZ6B 3PVLA 4PKCC 2PNIA 1K73R 2FEIA 5CKEA 4FYYB 1VQMQ 3THKA 2DXCA 3JB9F 4OHIA 4BE0A 1OZ2A 5L23A 1BFIA 1ACMB 3QDFA 2JTFA 1NEBA 3GIBA 1QLYA 1X75C 3QWYA 1Z9QA 1KHIA 2R57A 1UB4A 1FMVA 4C8QE 3EGXB 4PJOA 4O6JA 1I5LA 1CSKA 1X27A 4OB1B 2MF2A 2EQJA 1RLPC 2EL8A 3EG9B 1C1AA 3IN7A 4J5YA 4OP0A 3T9NA 3BUNB 1V1CA 1A1EA 2DM1A 1BLJA 2H3JA 5KYWA 3OSSC 4FCYA 4GBQA 3OYDA 1I81A 2CUDA 2EJGA 1O4GA 2P0QA 1T0JA 2DZ9A 3U23A 1O4EA 4Q5WA 3M0PA 1J3TA 2RI3A 1QWFA 4P5NA 1YI2T 1WA7A 2ZPIB 3M53A 3CPWP 1R1SA 1UURA 2RM4A 1ZA1B 1W2BP 3RIRA 3M0RA 4M78A 2QA4T 2ZPGB 1K9MC 3M54A 3J80E 3IMDA 1VQOA 1TG0A 3KXTA 3JCMd 4GLMA 1SEMA 1WHGA 3C95A 2NLUA 1AYBA 3CCEA 5GAMe 5C6SA 2QA4A 2OTLQ 2QGGA 1AZGB 1ZFPE 4YTLA 1Y0MA 1VQLT 2GFUA 4E68A 4JJDA 5LJ3e 5I2SA 1IB8A 1IO6A 4WF2A 3EFOA 1WJSA 2EO6A 2F1LA 3IQLA 1RADB 4QT7A 2LNVA 1O4BA 4RKUE 3LGFA 4CRIA 1M2VB 4ZGDB 3VYGA 3CMEA 1P13A 1X0NA 4XU0A 1YVLA 4RTXA 3MEVA 5LJ5d 2EKOA 4IUPA 4J9IA 2MMPA 1AYCA 4V2SA 1CSZA 1ZHIA 1A1CA 3EG1A 1Y71A 3TKZA 4U17A 5GJVB 1TOVA 4C8QA 4Y28E 1O4NA 3NHNA 2DERA 1BMBA 2EAYA 2QK0A 3I9QA 1IZ6A 3IMJA 3PLFB 2DL3A 3VRQA 3UATA 2AZSA 2K3XA 3M58A 1XJWB 3VS3A 1R77A 1X2QA 1YJNT 4RG8A 2RQWA 2KRMA 1JXMA 4BD3A 2RF0A 1VQKT 2LCTA 4A4FA 2PLEA 4AMCA 4M7AB 3OS1A 3BY7A 4XAXB 4WWQA 3MAZA 1M3CA 3MKDA 2V8IA 4L59A 3OB9A 3JV3A 1O9SA 1K76A 5IHNA 3HFNA 1SPKA 1SHAA 1FMKA 2QI2A 4ZN1A 2EGCA 2E70A 1YIJA 2DEQA 5CKBA 2CH4W 2Y4YA 2E5QA 1NLPC 3VJPA 4BE1A 5CQYA 2RQTA 4RUGA 1SPSA 3EGXA 3P8HA 3M59A 4N4HA 1UGQB 3EFRA 1Q82U 1K8AU 1VQNQ 2WSCE 1M1KU 1OU9A 4OMMA 2OTJA 2J6KA 4MMKA 3QSUA 4C0DB 2M0OA 3H6ZA 4A53A 1D1AA 1JQQA 1F1WA 1EZZB 3OVEA 1BCMA 5IBSA 2LJ3A 5GMKh 2JMCA 3RUXA 3PS5A 1CKAA 2CI8A 2A7YA 3JCMV 3WVDB 2HQHA 1O4IA 2KT1A 2W10A 4M7AC 4F59A 4M78B 2A08A 5GMKm 2ABLA 4RG2A 2DIQA 2D1XA 3TQ7P 4M75G 5CO7A 3HHTB 2KBTA 1U5SA 1MNDA 2KDSA 3QZ5B 2QDYB 5I6VA 3RKYA 4M75A 1VQ9A 5GJWB 3HCKA 4GPLB 3EFSA 1NPPA 4OVAA 4B9WA 3CBOA 4MDXA 2RK2A 3CEYA 3HHMB 3K2MA 1BI0A 3QUIA 4FL2A 1IXDA 3JAME 4IIMA 2KY9A 1Q81U 1I8FA 2NUZA 1JYUA 3G4SA 3S3OA 2K2MA 3BW1A 3CBPA 2VC8A 1VQ7A 4GY5A 2JVVA 3T04A 3X28B 1O4RA 4J6WA 1O4MA 4N4GA 1MV0B 5GANf 1VQPT 1D0XA 3OMCA 2DBMA 2E41A 1N5ZA 3ZNIA 1GBRA 1SSFA 3M57A 1X6BA 5GAN7 1G3YA 1H8KA 1MUZA 3RESA 1Q95G 1R0CB 2XI9A 4C5GA 4EPCA 3GOXA 1A1BA 2CP6A 1X6OA 5L8RE 2K7AA 4NOYA 1P92A 1RAGB 3OYIA 1NBEB 4C92G 1AWWA 3GF5A 3CMEQ 4F7UA 3MO8A 2NWMA 2KQWA 4M75D 3QIIA 3ER0A 2EJ9A 1WHKA 1HYOA 2HKNA 2VYTA 3SWNA 2FO0A 1K73U 2CT3A 2MWOA 1KK7A 1AWJA 2J05A 4JE4A 5CDWA 2OTLA 2V8JA 5CKFA 3CCRQ 4TVRA 1K9MU 3JB9G 4XTVA 2JW4A 2ZCFB 4JDSA 1G3WA 2QMSA 4J7FA 2EYQA 2GFAA 2JTEA 2Y1NA 3MP6A 4J9CA 2LNHB 1BG1A 5EG2A 5CCAA 3RBBB 4PJOF 3VUZA 5KYXA 1F1BB 4X6SA 2ATCB 4QQDA 2V1RA 4K11A 2RSYA 3VUBA 2E4HA 3CC2A 4KH0B 4TZIA 4C0GA 1PICA 1M1GA 1KJWA 2JZ2A 4KUIA 2G6FX 2JN0A 1OU8A 2RPNA 2PZ1A 1SRLA 1NG2A 1PD0A 3QPHA 2F2VA 1V76A 2LVMA 2QYZA 1WQWA 5BO4A 1WJRA 2L3QA 4PFOA 5HKCA 2DEUA 4M77F 5FU6C 4OHHA 3JB9J 4DEYA 1Q82C 1K8AC 3TEEA 2CUBA 1WHJA 3DLLA 4X9CA 1R1PA 1X6CA 2O9VA 1UDLA 4E7KA 1KG1A 2CZ1B 4XQ3A 2M0YA 3PSJA 1X01A 1OULA 4GL9E 2XU8A 3LWHA 3L42A 1O4FA 2LQ8A 2QAZA 1WGSA 1JU5C 4L6V5 1XA6A 3BDLA 1GFDA 1AD5A 4ANJA 5J3XA 2BTTA 4WCIA 2D8HA 1UGPB 1VOMA 4FU6A 1RUWA 2OAWA 2KNOA 2JXBA 2KVQG 3VS5A 2DM0A 3NGPA 1PD1A 4OMPA 4OB3B 3PJPA 1TXQA 3CXCS 2KE9A 2XIDA 1RI0A 4RTTA 3A8OB 3NPFA 3OYLA 1BIAA 2Y3AB 2K2VA 2MI6A 3X25B 5KCHA 2J6FA 1KA6A 1ZSZA 1NRVA 3CPFA 1AYAA 1HSQA 4KBMB 3IN8A 2ZPFB 1OO4A 1BF5A 1JYRA 1NJIR 2Z0WA 5J3BA 1WXTA 1MHNA 5GAMf 5FRMA 1BKBA 3CCUT 2EFIA 2OAUA 1M9SA 5CAIA 4PJNA 1N9SA 2JS2A 5GANd 2YLBA 4HCKA 2QASA 4ESRA 2LCLA 3G71A 1GCPA 2OI3A 3UA6A 2KMTA 2F5KA 4J9GA 2WACA 5EHRA 3JCMX 4HXJA 4BI3A 5M9OA 3GLXA 4QKUA 4ZN3A 9ATCB 3F70A 2RJEA 3FLGA 2FL7A 4LXCA 2ED0A 3VYHB 1NZVA 3PQZA 4XK8E 2JS0A 1O46A 3SWNC 2DLPA 1MMAA 3DLMA 2GE9A 5J26A 2JYQA 4Z02A 2E6ZA 2GNCA 2MRJA 3QJYA 2LX7A 4M7DD 1BKMA 1O4KA 2EW3A 2E64A 3QXEB 4R0KA 2K5FA 2L3SA 3EHQA 4IUUA 2LQWA 1KD1U 2L3RA 2QTXA 2AOAA 1M3BA 1RLQC 5AULA 4M75C 1VQ5T 1AEYA 4FW1A 2FZGB 3A98A 5IAYA 1Y7XA 1M61A 2RMXA 3LYIA 3JCMP 5LJ5j 4LD9K 4DGPA 1QVGS 4M7DC 2CT4A 3H0FA 3OMGA 2ZAEA 1YITQ 1OYXA 2MRKA 2GTOA 2QQ9A 1E7OA 2R58A 3JCMc 3BUXB 2HQXA 4Y91A 2LRAA 5DLQE 2V26A 3REAB 5IT9E 2EQMA 1VQLQ 1D4WA 4N4IA 5IHKA 1I4K1 1QVGP 4J83A 1SHDA 4A4BA 4RCCA 1UUSA 2BZXA 1LKLA 1A09A 2RK1A 2EWNA 1K9MR 2AT1B 4FYVB 1JU5A 3LYVA 1D3BA 3CCLQ 4OMFB 2RORA 1PWTA 1FBVA 4NL2A 2YDLA 1O41A 4EY0A 3OQ5A 3ZBDA 2MIOA 2PNBA 2L8DA 1KC2A 1XNIA 3FIFA 4LUEA 2LQKA 4J9DA 3EH1A 2PNAA 2HBWA 4FYXB 3I55T 1HCTB 5HK3A 3BFMA 4E7HA 4F14A 1UGVA 2CP2A 1PNJA 4VUBA 1GBQA 1AWOA 2A0FB 4C92C 4QQ6A 2O4XA 2P0KA 1XOVA 5FU7C 1JWOA 2COZA 5GAOn 1I07A 1SHFA 1TUCA 2CP7A 3OB2B 3NTHA 1M90U 3BUMB 2LT4A 2C0OA 1IGQA 1HJDA 5DC4A 1YFNA 3WVEB 3G6ET 4F5BA 5GAN6 5J39A 3M0QA 3L2VA 1OX9A 1Q82R 2RI5A 2DTIA 1K8AR 1FYRA 5DC0B 4JZ4A 1AT1B 2AKLA 5GAMh 1AZEA 1NZ9A 1Z9ZA 2IUIA 3OS2A 2H46E 1TTHB 2X3XD 3CCET 2M16A 1BBZA 2RD1A 1O4QA 4PLIA 3JSCA 5GAMg 3H0IA 4ELYC 3VRRA 2KYMA 1U1SA 2YLCA 4MDWA 1LPLA 4OF1A 1R8OB 1LNXA 1G2BA 3MEAA 4EMKC 4E7JA 1K0XA 2RQRA 3OYGA 1O45A 1VQKA 3MHXA 3OS0A 1G3SA 4XZ1A 2V8KA 3OB1B 2KXCA 4JS4A 1VQKQ 2QEXQ 2RHUA 4M77B 1RL2A 1ZSGA 1KQSP 1N6AA 2DE0X 3M9QA 5GAOp 1AYDA 4C8QC 3GQIB 4MZTA 2PLDA 2VASA 4FT2A 5KYYA 5LJ3f 5GANg 2DXBA 3CBMA 4AFZC 2HSEB 2RJCA 2DJQA 4O5VA 2DX0A 1GCQC 4OMNA 3K2TA 2CYZB 3QJ6A 4HCBA 4OHLA 1LVKA 4C0ZA 2EQUA 2BIVA 1S72T 1VA7A 3A8MB 4E7SA 2EKHA 1W6XA 2YWWA 4A4CA 1IS0A 2DRMA 1YJNA 5GAOr 2XDBA 2DVEA 4C92A 1LUMA 3MJXA 2LJ1A 2O31A 2KNBB 4MMLA 3OY9A 4JLGA 1PRLC 2JM8A 4Z89A 3CCVA 2LDMA 2FB7A 1KQ2A 3RMSA 1WHLA 1GL5A 4II1A 2RJFA 4NS5A 2K3BA 2CS7A 3ZFJA 4P9ZA 4M75E 4Z8AA 3BUOB 1YJ9A 5IHIA 2XDPA 1VQOT 3KFJA 2IZVA 1SKUB 3VRNA 2ZZDA 2AOBA 2A28A 1M8MA 1U1TA 3TSZA 1EFNA 4PFPA 1BYMA 4OB2B 5CQXA 3LH5A 1YHQA 1QMCA 4OGCA 5GAMd 3R6OA 1XQHA 1O47A 2HDVA 2Y90A 3V7CA 4M7AF 2X4JA 3TREA 2XICA 3L1AA 1M3AA 4BY6C 4CC2A 1YHQT 1OX8A 4DA4A 1IREB 3QG1A 1N8RR 3PSKA 2KK6A 4PL6A 4E7LA 4F5AA 4FM4B 3JCMe 1M1FA 1JYQA 1WZOA 2HDXA 1SSHA 1GRIA 3JCMh 1W2BS 2WSEE 2AIRB 4C92E 1VQOQ 4H1OA 3LH0A 3CCJT 3CMAQ 1VQ6Q 2DX1A 5I22A 1A08A 1IHWA 4JRIA 6AT1B 3PMIA 1O4AA 1UTIA 2ED1A 4M7DB 2R5AA 2OTLT 5LJ5e 2F2XA 1I0CA 4BB7A 3CCJA 1N9RA 1OPLA 1QVGA 2DAQA 1UHCA 3QWXX 3LX7A 2ECDA 2QXFA 3QZ9B 5D6YA 3CCVT 4J8OA 4AG2C 3N84A 4BI8B 1QVFP 2O4XB 3RNJA 1VIEA 5GAN3 4GWFA 2B8AA 4F7UB 1LJOA 2YSQA 3MXYA 2LZ6B 3EHRA 5GANe 2FCIA 2QQRA 2H3EB 4M78G 2FVUA 2OQ1A 1OV3A 1VQ5Q 1VQMT 3QDRB 5AXIA 4M77C 3CCLT 2EPDA 1K0SA 2VWFA 4XTYA 1WDXA 1GFCA 2DRKA 4OGEA 4UC4A 4AFSC 4LDUA 1CJ1A 2FRWA 2L4KA 4BUGA 3PVQA 3L2WA 2M9UA 3OW2P 1X2KA 1OO3A 1QVFS 4ZNXA 4E7ZA 4C8QD 5FLXE 2NUPA 4A4HA 2X35A 1N8RC 2AHJB 4A4GA 1BKLA 1VQPA 3ME9A 3GPLA 3TU4K 1Q7YR 1ABQA 1Q86C 2ZPHB 1VQ4Q 1WHHA 3EGDB 2MPXC 2LC4A 3VS7A 4LDYA 2MWPA 4JLIA 5CKHA 1ZBXA 4FW2A 1TUGB 1QVPA 2AK5A 3CCMA 2BBUA 5GAOm 4F16A 1AB2A 1QCOA 1FU5A 1T3LA 2RB6A 1X69A 2EO3A 2M02A 2LTOA 1Q81R 3G4SQ 4EIHA 3ASKA 4M75F 4QSYA 3QHSA 5D6XA 3CCQA 2IUGA 4M78E 2L6KA 3PIOA 5FU7B 2FHDA 2NUPB 3OYFA 3OYEA 1T0HA 3CPWS 3CCJQ 3SB2A 3VV0A 3H9NA 2EYXA 2IVWA 4EMKA 5EELA 3CC2T 2X4YA 4XU2A 3A8LB 2QEXT 1KD1R 4DBRA 2EQIA 2LP5A 2LQNA 3EAEA 3WA4A 3KBGA 4HA8A 1VQ6A 5GAOl 4K45A 5HKYA 2K5LA 1CKBA 4FYWB 4LNPA 2E6NA 3PFVA 3I56Q 3CWGA 1MMNA 2CREA 2FRYA 3LWIA 2I0NA 3UPUA 3GXWA 8AT1B 2DO3A 1TSFA 2YU7A 2DTOA 4J9BA 4Z88A 4C5IA 1O48A 5FRNA 1KA7A 4HVUA 1RAIB 1JJ2P 1S1NA 4M4ZA 1OI1A 2BUDA 4N0AC 4F04B 3JCMQ 5A2QE 1TU0B 1WJQA 4AFQC 3PTAA 1GCQA 1YJ9Q 1E6HA 1MNEA 3SEMA 1HK9A 2LNWA 5HK0A 3CCSA 2IPOB 1V29B 1D0ZA 3UA7A 1RACB 1VQ4A 4J9FA 3DB3A 1RAFB 2ZPEB 1KD1C 4PJJA 2B3OA 5CK9A 3JCMf 3CCST 1YNZA 3KUFA 3M5AA 2XHCA 4RTZA 1T3SA 3MEWA 3GP8A 3OYYA 4X34A 1YJWT 3FEOA 2QGFB 1AOTF 4JRQA 1O42A 4LUDA 2YSXA 4NWGA 1A07A 4FL3A 2PQWA 3NMZC 3V8JA 3EG2A 2K6DA 5GMKi 3CMET 2X3WD 1Q81C 1TCEA 1PKTA 2LMJA 3INZA 3I5SA 4E47A 1IHVA 1KHCA 1O4HA 2FZKB 2ROTA 4JRPA 1BCOA 2FPFA 4ZTFA 5LJ5f 1X6GA 3E19A 2P4RA 2JT4A 5CKDA 4KH1B 2DF6A 2KAFA 3L2ZA 2L2PA 4XU1A 4IURA 2XKOC 2XP1A 2SRCA 1ZX6A 1OZ3A 2B86A 2KK4A 4F17A 2L89A 3X24B 3FJ5A 3OYBA 2QEXA 3CD6Q 1R1QA 2EYVA 4RMOA 2RMOA 2DL7A 3CC7T 2K57A 2MQIA 4JPBW 4WTOB 1RAEB 2M1HA 2KR3A 5KYUB 1PKSA 3AHUA 1O4DA 1QG1E 2Y4XA 2KRNA 4CI0C 4N0AA 2FZCB 2KRSA 3MP1A 3ULRB 1UUEA 4A4KA 4L5GA 2QA4Q 2PTKA 1WLPB 5D0JA 5LJ3g 3CMAT 1O44A 2J7IA 4KGXB 4FT4A 4EMGA 1UEBA 2BKDN 1YIJT 3ZL7C 5KAZA 5GAN5 2YT6A 1FU6A 4B6MA 2D9TA 2LT1A 2DTHA 1AWXA 1FYNA 1YHQQ 4J9HA 1NEGA 2C0TA 1LCKA 1FBZA 1CSYA 3M4YA 3BUWB 3HFOA 3QO3A 4HVVA 4Y92A 5GAMj 5KYUA 4M7DG 2H8HA 1EIFA 3SDZA 1VQPQ 3N7YA 3VS4A 5IXFA 5LJ5h 2GTJA 2F69A 4XTWA 2E3IA 3UT1A 2KYBA 2MCNA 4KT0E 1NJIC 2K79B 4B9XA 3J7AF 2DILA 2RO0A 1JJ2A 2Y1MA 3QKJA 3CPWA 1LUIA 5CR2A 1VQ6T 2NYSA 3A8HB 4ME7A 1WX6A 1Q7YC 1K1ZA 4BE2A 5ECAA 1HCSB 1LUKA 1BK2A 1YITT 3CXLA 3FC3A 1KC8R 2QDLA 1KQSS 2DPPB 2HMHA 4JRKA 2IIMA 4F7UE 4RTUA 2DIGA 3S9KA 1M30A 2RI2A 3FB9A 2OZOA 3US4A 3G6EA 4FIBA 3CCSQ 3CCQT 3EGUA 4LDXA 1JBMA 3BKBA 5GMKe 4RTYA 2CRHA 2OJ2A 2MYSA 3CCRT 5KE2A 1NM7A 5IXBA 1AOJA 1BI2A 4KUDK 4JUVA 1AVZC 3LGLA 1AOUF 3CD6T 1ZBJA 2XG8D 3BDUA 2J6OA 3HP9A 2K3YA 1K4US 4QQGA 5GANj 1FX7A 3M4GA 1YCYA 2QTVA 2P0PA 3LLRA 3OBYA 1QP3A 2E1HA 2CBLA 4X9DA 2VKNA 1ABOA 3META 5KCOA 2I2LA 5LJ5g 4ZTJA 1VQ9Q 5GAN8 3PFSA 2D0NA 1ZUUA 3M0SA 1UG1A 3MEUA 2K4YA 4J6XA 3EG9A 2CIAA 5A0DA 3CMAA 2EGAA 4DBQA 2VUBA 5KYNA 3JCMJ 1H92A 2CGHA 1RJAA 4K44A 1N8RU 1M5Q1 1PRMC 2RVFA 1LOJA 1YBYA 2RNAA 1YCSB 1O43A 2DCRA 1UECA 1WHMA 3CXCP 2O01E 2DBKA 2MK5A 3OYAA 2JJ9A 2JUFA 2DK3A 3M7FA 2E65A 2GQIA 2FYKA 4JJNK 3FRNA 2L3TA 1D3BB 2XMFA 3PIPA 3X20B 4PJOG 4C5EA 1E6GA 4LE9A 3OW2A 1FHSA 1QWEA 4ORZA 3CCUA 2MAMA 4KGVB 3RKWA 3OYKA 2EYWA 1D4TA 5I11A 3RDVA 2K79A 2RH2A 1S72A 3L2UA 2DYIA 2P84A 3RR6A 4DBFA 4NL3A 3CC2Q 3FDRA 3CC4T 1U3OA 1QP2A 3CCQQ 4JEGA 3EG3A 2DYBA 5HY6A 4FL6A 4LD6A 2CZ0B 1AHJB 2HZYA 2OTJQ 2GF7A 3HRUA 1ZUYA 3GBQA 2CSIA 3V7RA 5HKWA 3E1SA 5AT1B 2EKXA 2OX7A 1KSWA 3V8KA 4LDWA 1VIFA 3CCRA 5A0GA 2DL8A 3CCVQ 1MILA 1WI7A 2D0QB 1B47A 3CCLA 2MK2A 3V8LA 1UGSB 3RKXA 4X1VA 1B7TA 4NWFA 2X4WA 1DJ7B 5D7UA 3HSBA 1M8VA 1NE8A 3PGGA 1YJNQ 4CC4B 4DOVA 4QW2A 3GXXA 2HMAA 2DLZA 2ZGWA 4IKFA 4BY6B 3TSWA 3I55Q 3MPUB 2HSPA 1QCFA 1ZA2B 2HD0A 2W0ZA 3PE0A 4D8DA 5GJHA 4DGXA 4CC3A 1VQ5A 1RAHB 2NUTA 5FW9A 4F7UF 3UF4A 1KFZA 1D1ZA 1H3HA 2DLYA 1PCXA 1MV3A 5EC7A 1YJWQ 2QQSA 2DNUA 1M2OA 2JMAA 1U8RA 5HKZA 2VGNA 3S6WA 1M90C 2X51A 2ENMA 3CC7Q 3JB9H 2HNIA 2HL5C 3H8ZA 2QQAA 4IUTA 3VRZA 2A3LA 1VQ4T 5A0LA 4J9EA 1O75A 3VS2A 4M77A 1IGUA 1BU1A 1MMGA 4RTVA 4ATOA 5DM7R 3S3NA 3RERA 4FBNA 4OMOA 1I3ZA 2P4TA 4F7UG 1LKKA 2ZPBB 3P8DA 2KGYA 1TWBA 4M7AA 1RI9A 2E12A 1GHUA 1WPYA 2DFUA 1SHBA 4KRTA 3O5ZA 3S3MA 1H3ZA 2EVRA 2VIFA 2C06A 4QVZA 1WNLA 3S8NA 1YN8A 2IG0A 2DJZA 1FMWA 3QYHB 4XZ0A 1LCJA 3HRTA 1B07A 2HQEA 5FWCA 1K9AA 1O4PA 3CCMQ 2EYZA 1QQJA 1UFFA 1JEGA 1O4JA 3VS0A 1VUBA 3OYCA 1M27C 2EYYA 1PM3A 2DVJA 1PHTA 3VKIA 2XDDA 2O2OA 2X4XA 3M55A 4M78F 5I21A 4C8QB 2KROA 4JJCA 5IN1A 3VRPA 3OSVA 1SG5A 1VQNA 4HCCA 3C94A 4JZ3A 2JTMA 1WXBA 2CP5A 4HCZA 5CVIA 1ZLMA 2ETZA 4OHEA 2YRDA 4AFUC 2CS0A 3G71Q 2DL4A 2A37A 3EFOB 2DA9A 1YIJQ 1F2FA 5DLOA 1K73C 4C5HA 2MOXA 2L3PA 4MZPA 3C7IA 2MC1A 3E9GA 4EMKB 1Q86U 4IUQA 2DMOA 2DD5A 1Y07A 2BZYA 1TH7A 1RQQC 4OB0B 4A63B 1KIKA 2BE7D 1B3QA 3EACA 1C0MA 1TUDA 4JGHA 4R56A 1NYFA 2KXDA 3REBB 3JRZA 1Y1UA 2DETA 5KYWB 3CQTA 3NTKA 4M7AE 1VQ7Q 1WQ7A 1A1AA 1RABB 2F5TX 4LDVA 1RAAB 1CWEA 2KI7A 2KGTA 1G8XA 1HXDA 1U06A 4M7DE 1M1KC 4IIOA 1UE9A 1G5VA 2A36A 1OEBA 1JXOA 4DEXA 1A0NB 3OA6A 5LJ3j 3LW5E 4L1BB 2E3HA 3CCUQ 3CXCA 2RHZA 2AUGA 3DKMA 3Q1JA 1UGRB 2AKKA 3NFCA 3URGA 4PJOB 1X43A 1SPRA 5GANh 4ROJA 3CBLA 1VQ8T 4HT9A 1O4OA 4LN2A 1VQ9T 2HEQA 2F2WA 4XTUA 3TCJA 3RMQA 2KSSA 5EG3B 3JCMg 4ZGEB 1YVHA 1JO8A 2H5KA 4KGZB 2E5KA 3N8MA 3E9FA 1MGQA 2PVDB 3JCMb 2C0IA 1B34B 3OP0A 4M7AG 3D7SB 1S72Q 5EHPA 5KH6A 2CKKA 1WXUA 3I35A 5FWBA 4C92D 2QG9B 3UDCA 4PFZA 3S8LA 3VS1A 1O4CA 3EG0A 4C0FA 4GLKA 4EDUA 1FWZA 5I2MA 1VQ8A 3VGOA 2RHXA 1VYUA 1VYTA 2RN8A 1NYGA 4HT8A 3GNFB 2VXEA 4M75B 1VQ7T 1BFJA 2YHTA 3A8GB 5GMKl 4E93A 1KQ1A 3PMTA 4M7DA 1H9OA 3HRSA 3JB9D 4C92F 2JNGA 1TS9A 1KC8U 1UJ0A 3WXMB 3VS6A 3SHWA 1HD3A 3E2UA 1MW4A 1NZLA 1OPKA 4QVDA 2IUHA 1ZSZC 4FSXA 1H641 4C8QF 1BHHA 1WYXA 2EJFA 2PUOB 1TZEE 5GJIA 2DXUA 1PC0A 2O88A 4M7AD 2OTJT 3M0UA 2GCXA 3DB4A 1B34A 1FXXA 1VYVA 5C0MA 2LCCA 2HBPA 4OMLA 1GXIE 3J81E 2EBPA 3CC4A 2YUOA 5GAOq 2DZCA 3L2RA 4HVWA 2COWA 2CSQA 1PSFA 1ZUKA 3OYNA 3G6EQ 5IH2A 1YWOA 5D6WA 2RJDA 1Y57A 3G1JA 4M77D 4BDYA 1W2BA 1Y96A 2DD4A 1ARKA 2YRVA 1A81A 2CZ7B 3L2QA 3EGDA 5KE3A 1LUNA 4BACA 2NUTB 4CC7A 3C4SA 5DF6A 1M90R 4J7IA 2LX9A 2DL5A 4M78D 3MP8A 4XTZA 1YITA 2YUPA 4PNOA 3VROA 2HUWA 1ZSZB 1BB9A 3HL8A 2K5IA 1G83A 1I1JA 1QKXA 3CCEQ 2R5MA 2YUNA 4C92B 5GMKj 2JOYA 3N5BB 4DQ2A 2VB6A 2CR4A 5CIUA 4ZGJB 2HL3A 2FPEA 4JJBA 1M4ZA 1NJIU 4K2RA 2O9SA 2LJ0A 2SEMA 3A1PA 1NLOC 3EH2A 4ELZC 1W1FA 1ZQ1A 1PSEA 2V1QA 1QW1A 3SFMA 3VRYA 4EMHA 1BLKA 1YP5A 1PG5B 2KEAA 5LJ3h 2JM9A
chains in the Genus database with same CATH topology
3VRNA 1UHFA 2SHPA 2DBKA 2LCSA 2DBMA 2AOBA 4P9VA 1N5ZA 3ZNIA 1GBRA 2A28A 1M8MA 2GQIA 3M7FA 1BM2A 2GGRA 1X6BA 3TSZA 1EFNA 3H41A 1H8KA 3H0HA 1MUZA 3LH5A 2L3TA 3I5RA 2XMFA 2RQUA 1E6GA 4LE9A 1A1BA 1O47A 2K7AA 2HDVA 1FHSA 1QWEA 2KT8A 4ORZA 2EYWA 1D4TA 5I11A 1M3AA 1AWWA 2K79A 4CC2A 2NWMA 4OHDA 2RQVA 2FG0A 3PSKA 5IBMA 2KK6A 1U3OA 2EU0A 2FO0A 2CT3A 4JEGA 4F5AA 3EG3A 2DYBA 1AWJA 2K9GA 1JYQA 3TL0A 2J05A 4JE4A 5CDWA 3MXCA 2HDXA 3HIZB 2JW4A 1SSHA 1GRIA 1ZUYA 2CDTA 2HCKA 3GBQA 2CSIA 2QMSA 2JTEA 5HKWA 2Y1NA 4FSSA 2EGEA 2EKXA 4H1OA 5DC9A 1KSWA 4J9CA 1OOTA 2LNHB 2DX1A 5I22A 1A08A 1BG1A 3RBBB 1O4AA 4X6SA 1UTIA 2VVKA 2DL8A 2ED1A 2ESWA 2V1RA 1MILA 1WI7A 4K11A 4EIKA 2RSYA 1B47A 2F2XA 2MK2A 1I0CA 4X1VA 1IJRA 4NWFA 4TZIA 1OPLA 1PICA 3TVTA 1UHCA 3R6NA 4D8KA 1KJWA 2AZVA 3QWXX 2ECDA 4CC4B 2G6FX 2RPNA 3KFVA 3GXXA 4AG2C 3N84A 2DLZA 2PZ1A 3TSWA 2CI9A 2C9WA 1SRLA 1NG2A 2F2VA 1BHFA 1YWPA 2HSPA 1QCFA 2W0ZA 3PE0A 3RNJA 5GJHA 4D8DA 5BO4A 4GWFA 2EOBA 2K7AB 4DGXA 4CC3A 2L3QA 2ROLA 4OHHA 2YSQA 3MXYA 5FW9A 4DEYA 2LZ6B 3EHRA 3UF4A 1KFZA 1H3HA 1D1ZA 2DLYA 2CUBA 1MV3A 1QADA 5EC7A 3OV1A 2OQ1A 4RTWA 1OV3A 1UJYA 3C0CA 2DNUA 5HKZA 2JMAA 3S8OA 2YUQA 1R1PA 5AXIA 1X6CA 4H34A 1K0SA 2EPDA 2LNXA 2VWFA 2O9VA 1WDXA 1UDLA 1GFCA 2DRKA 2ENMA 4AFSC 2M0YA 5HCKA 3PSJA 4GL9E 1CJ1A 2FRWA 2L4KA 1O4FA 3PVQA 1OO3A 1X2KA 2GBQA 3VRZA 1WFWA 1JU5C 1O49A 1XA6A 4J9EA 3VS2A 1W70A 1GFDA 1AD5A 4ZNXA 5J3XA 2IZVA 2BTTA 1BU1A 4RTVA 4WCIA 2D8HA 1WQUA 4FBNA 4OMOA 1RUWA 2OAWA 1I3ZA 1LKKA 2JXBA 1BKLA 3VS5A 2DM0A 3NGPA 2KNOA 3UYOA 4OMPA 1RI9A 1M27A 2D8JA 4AG1C 3PJPA 1GHUA 1ABQA 2HDAA 2KE9A 1SHBA 2FPDA 1QKWA 3O5ZA 4KRTA 3NPFA 4RTTA 3VS7A 2EVRA 2VIFA 2Y3AB 1CWDL 3S8NA 5EEQA 1YN8A 2AK5A 2BBUA 4F16A 1AB2A 1FU5A 1T3LA 2J6FA 1X69A 1RPYA 4XZ0A 1LCJA 1KA6A 1SKJA 1NRVA 4E6RA 3CD3A 1B07A 1SHGA 3IN8A 1AYAA 1HSQA 2EO3A 5FWCA 1K9AA 1O4PA 3EAZA 4OMQA 2EYZA 1OO4A 4EIHA 1UFFA 1JEGA 1BF5A 4QSYA 1JYRA 1O4JA 3VS0A 2GSBA 2IUGA 1WXTA 1M27C 2BZ8A 1WIEA 2L6KA 2EYYA 2DVJA 2J06A 2M51A 1PHTA 1T0HA 2ECZA 2O2OA 2JS2A 2EYXA 2L0AA 2CH4A 2KROA 1O4LA 5EELA 4JJCA 4HCKA 3VRPA 4ESRA 1GCPA 1SRMA 2OI3A 3UA6A 3M0TA 2EQIA 2LP5A 2LQNA 4JZ3A 1Z3KA 1WXBA 4J9GA 4U1PA 3WA4A 5EHRA 1BHHB 4HXJA 1ZLMA 4K45A 2ETZA 5HKYA 3PVLA 4OHEA 2PNIA 1CKBA 2FEIA 4AFUC 2CS0A 2DL4A 4LNPA 3PFVA 3THKA 2A37A 4OHIA 2DA9A 1F2FA 3PQZA 2ED0A 1NZVA 3CWGA 5L23A 1BFIA 2CREA 2FRYA 2JS0A 2MOXA 2L3PA 1O46A 2DLPA 2I0NA 3C7IA 3GXWA 1NEBA 2MC1A 1QLYA 2GE9A 2DMOA 3QWYA 2YU7A 2BZYA 4J9BA 4Z88A 1RQQC 1Z9QA 2JYQA 1O48A 2FCIA 2GNCA 4A63B 1KA7A 2MRJA 1KIKA 4HVUA 1B3QA 2LX7A 1BKMA 1O4KA 2EW3A 1TUDA 1CSKA 1S1NA 3EACA 4JGHA 1NYFA 1X27A 2KXDA 4M4ZA 3REBB 1Y1UA 4AFQC 4R0KA 1GCQA 2L3SA 1RLPC 3EHQA 2EL8A 3IN7A 3CQTA 1E6HA 3SEMA 3BUNB 1V1CA 2LQWA 1A1EA 2DM1A 2LNWA 1A1AA 1BLJA 2AOAA 1M3BA 1RLQC 3UA7A 1AEYA 1CWEA 4J9FA 5AULA 4GBQA 3A98A 1O4GA 2CUDA 2KGTA 1M61A 1T0JA 2RMXA 1U06A 3U23A 4IIOA 2B3OA 1O4EA 3M0PA 1UE9A 1J3TA 2A36A 1OEBA 1JXOA 4DGPA 1YNZA 2CT4A 1QWFA 3H0FA 4DEXA 1A0NB 1WA7A 1R1SA 4RTZA 1T3SA 2GTOA 2MRKA 1UURA 1E7OA 3BUXB 4L1BB 1AOTF 3M0RA 1O42A 2AUGA 4LUDA 2YSXA 4NWGA 3REAB 1D4WA 1SHDA 1A07A 5IHKA 4A4BA 2AKKA 3IMDA 4FL3A 3NMZC 1UUSA 1TG0A 3EG2A 2BZXA 1X43A 2K6DA 2X3WD 1A09A 1LKLA 1SPRA 1TCEA 1PKTA 2LMJA 1SEMA 4GLMA 3CBLA 3I5SA 4ROJA 1JU5A 1AYBA 1O4HA 2ROTA 1O4OA 4LN2A 2FPFA 2HEQA 2F2WA 1AZGB 1X6GA 1ZFPE 2RORA 1PWTA 5EG3B 2P4RA 1Y0MA 1YVHA 1JO8A 2JT4A 1FBVA 4JJDA 2H5KA 4E68A 2DF6A 1IO6A 2L2PA 2EO6A 2E5KA 2YDLA 1O41A 3N8MA 4EY0A 2XP1A 3IQLA 2SRCA 1ZX6A 4QT7A 1O4BA 2B86A 2MIOA 2PNBA 1KC2A 4F17A 2C0IA 1P13A 1X0NA 3FJ5A 4LUEA 1YVLA 3OP0A 4J9DA 4RTXA 1R1QA 2EYVA 2PNAA 2HBWA 1HCTB 2RMOA 2DL7A 4F14A 1UGVA 4J9IA 5EHPA 1AYCA 1CSZA 1PNJA 1A1CA 3EG1A 1GBQA 1AWOA 2MQIA 3TKZA 4JPBW 5GJVB 4U17A 1WXUA 3I35A 5FWBA 1O4NA 2KR3A 3NHNA 3S8LA 1PKSA 3VS1A 1O4CA 1XOVA 3EG0A 1JWOA 1O4DA 1QG1E 2KRNA 1I07A 1SHFA 1TUCA 1BMBA 3OB2B 3VGOA 3BUMB 2KRSA 3I9QA 2C0OA 3ULRB 3IMJA 1HJDA 1UUEA 3PLFB 5DC4A 1VYUA 1VYTA 2RN8A 2DL3A 2PTKA 3VRQA 3UATA 1NYGA 1WLPB 2AZSA 5D0JA 4F5BA 1O44A 2J7IA 3VS3A 3M0QA 1X2QA 1BFJA 2RQWA 1FYRA 2KRMA 3ZL7C 5DC0B 1JXMA 5KAZA 4JZ4A 2YT6A 1FU6A 2RF0A 2LCTA 4E93A 2PLEA 1H9OA 2AKLA 4WWQA 1AWXA 1AZEA 3MAZA 1FYNA 1Z9ZA 4J9HA 1M3CA 1UJ0A 2IUIA 3VS6A 2H46E 1NEGA 2C0TA 1LCKA 1FBZA 1CSYA 2X3XD 3SHWA 3BUWB 1HD3A 1MW4A 3JV3A 1NZLA 1OPKA 4HVVA 1BBZA 1K76A 5IHNA 1O4QA 4Y92A 1SPKA 1SHAA 1FMKA 2IUHA 2H8HA 3H0IA 3VRRA 2EGCA 2KYMA 1G2BA 3N7YA 3VS4A 5IXFA 1BHHA 1WYXA 1K0XA 2GTJA 2RQRA 1TZEE 5GJIA 1O45A 2O88A 2CH4W 2KYBA 3M0UA 1NLPC 2MCNA 4XZ1A 2RQTA 4RUGA 1SPSA 3OB1B 2K79B 1VYVA 2KXCA 2DILA 4OMLA 2Y1MA 1LUIA 2EBPA 1WX6A 2YUOA 1ZSGA 1K1ZA 4OMMA 2J6KA 5ECAA 1HCSB 4HVWA 1LUKA 2CSQA 1BK2A 2DE0X 1ZUKA 3CXLA 1JQQA 2QDLA 1F1WA 5IH2A 2HMHA 1YWOA 3OVEA 2IIMA 1AYDA 3GQIB 5IBSA 2LJ3A 1Y57A 4RTUA 2PLDA 3S9KA 1M30A 2JMCA 2OZOA 3US4A 3PS5A 1CKAA 2CI8A 4AFZC 3EGUA 1O4IA 2DJQA 2KT1A 1ARKA 1A81A 3BKBA 2W10A 4RTYA 2CRHA 2OJ2A 4F59A 2DX0A 1GCQC 4OMNA 2A08A 1NM7A 2ABLA 5IXBA 1AOJA 1LUNA 2D1XA 4CC7A 5DF6A 4OHLA 1AVZC 1AOUF 1ZBJA 2DL5A 2J6OA 1VA7A 2KBTA 3VROA 2YUPA 2EKHA 1W6XA 1U5SA 4A4CA 1IS0A 2DRMA 5I6VA 1K4US 2HUWA 5GJWB 1BB9A 3HCKA 4GPLB 1LUMA 2CBLA 2LJ1A 2O31A 2KNBB 2VKNA 1ABOA 1G83A 3HHMB 3K2MA 1I1JA 1QKXA 4FL2A 4Z89A 1PRLC 2JM8A 4IIMA 2YUNA 2D0NA 1ZUUA 3M0SA 1UG1A 2CR4A 1GL5A 2FPEA 2K3BA 2NUZA 2CIAA 4P9ZA 2EGAA 1JYUA 1H92A 1RJAA 2K2MA 4JJBA 4K2RA 4K44A 2O9SA 2LJ0A 2SEMA 3T04A 4Z8AA 1NLOC 1PRMC 1O4RA 1W1FA 2V1QA 2RVFA 3VRYA 3BUOB 5IHIA 2RNAA 1YCSB 1O43A 2DCRA 1YP5A 1BLKA 1UECA 3KFJA 1O4MA 1MV0B 2KEAA 2JM9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VRN A;  1UHF A;  2SHP A;  2DBK A;  2LCS A;  2DBM A;  2AOB A;  4P9V A;  1N5Z A;  3ZNI A;  1GBR A;  2A28 A;  1M8M A;  2GQI A;  3M7F A;  1BM2 A;  2GGR A;  1X6B A;  3TSZ A;  1EFN A;  3H41 A;  1H8K A;  3H0H A;  1MUZ A;  3LH5 A;  2L3T A;  3I5R A;  2XMF A;  2RQU A;  1E6G A;  4LE9 A;  1A1B A;  1O47 A;  2K7A A;  2HDV A;  1FHS A;  1QWE A;  2KT8 A;  4ORZ A;  2EYW A;  1D4T A;  5I11 A;  1M3A A;  1AWW A;  2K79 A;  4CC2 A;  2NWM A;  4OHD A;  2RQV A;  2FG0 A;  3PSK A;  5IBM A;  2KK6 A;  1U3O A;  2EU0 A;  2FO0 A;  2CT3 A;  4JEG A;  4F5A A;  3EG3 A;  2DYB A;  1AWJ A;  2K9G A;  1JYQ A;  3TL0 A;  2J05 A;  4JE4 A;  5CDW A;  3MXC A;  2HDX A;  3HIZ B;  2JW4 A;  1SSH A;  1GRI A;  1ZUY A;  2CDT A;  2HCK A;  3GBQ A;  2CSI A;  2QMS A;  2JTE A;  5HKW A;  2Y1N A;  4FSS A;  2EGE A;  2EKX A;  4H1O A;  5DC9 A;  1KSW A;  4J9C A;  1OOT A;  2LNH B;  2DX1 A;  5I22 A;  1A08 A;  1BG1 A;  3RBB B;  1O4A A;  4X6S A;  1UTI A;  2VVK A;  2DL8 A;  2ED1 A;  2ESW A;  2V1R A;  1MIL A;  1WI7 A;  4K11 A;  4EIK A;  2RSY A;  1B47 A;  2F2X A;  2MK2 A;  1I0C A;  4X1V A;  1IJR A;  4NWF A;  4TZI A;  1OPL A;  1PIC A;  3TVT A;  1UHC A;  3R6N A;  4D8K A;  1KJW A;  2AZV A;  3QWX X;  2ECD A;  4CC4 B;  2G6F X;  2RPN A;  3KFV A;  3GXX A;  4AG2 C;  3N84 A;  2DLZ A;  2PZ1 A;  3TSW A;  2CI9 A;  2C9W A;  1SRL A;  1NG2 A;  2F2V A;  1BHF A;  1YWP A;  2HSP A;  1QCF A;  2W0Z A;  3PE0 A;  3RNJ A;  5GJH A;  4D8D A;  5BO4 A;  4GWF A;  2EOB A;  2K7A B;  4DGX A;  4CC3 A;  2L3Q A;  2ROL A;  4OHH A;  2YSQ A;  3MXY A;  5FW9 A;  4DEY A;  2LZ6 B;  3EHR A;  3UF4 A;  1KFZ A;  1H3H A;  1D1Z A;  2DLY A;  2CUB A;  1MV3 A;  1QAD A;  5EC7 A;  3OV1 A;  2OQ1 A;  4RTW A;  1OV3 A;  1UJY A;  3C0C A;  2DNU A;  5HKZ A;  2JMA A;  3S8O A;  2YUQ A;  1R1P A;  5AXI A;  1X6C A;  4H34 A;  1K0S A;  2EPD A;  2LNX A;  2VWF A;  2O9V A;  1WDX A;  1UDL A;  1GFC A;  2DRK A;  2ENM A;  4AFS C;  2M0Y A;  5HCK A;  3PSJ A;  4GL9 E;  1CJ1 A;  2FRW A;  2L4K A;  1O4F A;  3PVQ A;  1OO3 A;  1X2K A;  2GBQ A;  3VRZ A;  1WFW A;  1JU5 C;  1O49 A;  1XA6 A;  4J9E A;  3VS2 A;  1W70 A;  1GFD A;  1AD5 A;  4ZNX A;  5J3X A;  2IZV A;  2BTT A;  1BU1 A;  4RTV A;  4WCI A;  2D8H A;  1WQU A;  4FBN A;  4OMO A;  1RUW A;  2OAW A;  1I3Z A;  1LKK A;  2JXB A;  1BKL A;  3VS5 A;  2DM0 A;  3NGP A;  2KNO A;  3UYO A;  4OMP A;  1RI9 A;  1M27 A;  2D8J A;  4AG1 C;  3PJP A;  1GHU A;  1ABQ A;  2HDA A;  2KE9 A;  1SHB A;  2FPD A;  1QKW A;  3O5Z A;  4KRT A;  3NPF A;  4RTT A;  3VS7 A;  2EVR A;  2VIF A;  2Y3A B;  1CWD L;  3S8N A;  5EEQ A;  1YN8 A;  2AK5 A;  2BBU A;  4F16 A;  1AB2 A;  1FU5 A;  1T3L A;  2J6F A;  1X69 A;  1RPY A;  4XZ0 A;  1LCJ A;  1KA6 A;  1SKJ A;  1NRV A;  4E6R A;  3CD3 A;  1B07 A;  1SHG A;  3IN8 A;  1AYA A;  1HSQ A;  2EO3 A;  5FWC A;  1K9A A;  1O4P A;  3EAZ A;  4OMQ A;  2EYZ A;  1OO4 A;  4EIH A;  1UFF A;  1JEG A;  1BF5 A;  4QSY A;  1JYR A;  1O4J A;  3VS0 A;  2GSB A;  2IUG A;  1WXT A;  1M27 C;  2BZ8 A;  1WIE A;  2L6K A;  2EYY A;  2DVJ A;  2J06 A;  2M51 A;  1PHT A;  1T0H A;  2ECZ A;  2O2O A;  2JS2 A;  2EYX A;  2L0A A;  2CH4 A;  2KRO A;  1O4L A;  5EEL A;  4JJC A;  4HCK A;  3VRP A;  4ESR A;  1GCP A;  1SRM A;  2OI3 A;  3UA6 A;  3M0T A;  2EQI A;  2LP5 A;  2LQN A;  4JZ3 A;  1Z3K A;  1WXB A;  4J9G A;  4U1P A;  3WA4 A;  5EHR A;  1BHH B;  4HXJ A;  1ZLM A;  4K45 A;  2ETZ A;  5HKY A;  3PVL A;  4OHE A;  2PNI A;  1CKB A;  2FEI A;  4AFU C;  2CS0 A;  2DL4 A;  4LNP A;  3PFV A;  3THK A;  2A37 A;  4OHI A;  2DA9 A;  1F2F A;  3PQZ A;  2ED0 A;  1NZV A;  3CWG A;  5L23 A;  1BFI A;  2CRE A;  2FRY A;  2JS0 A;  2MOX A;  2L3P A;  1O46 A;  2DLP A;  2I0N A;  3C7I A;  3GXW A;  1NEB A;  2MC1 A;  1QLY A;  2GE9 A;  2DMO A;  3QWY A;  2YU7 A;  2BZY A;  4J9B A;  4Z88 A;  1RQQ C;  1Z9Q A;  2JYQ A;  1O48 A;  2FCI A;  2GNC A;  4A63 B;  1KA7 A;  2MRJ A;  1KIK A;  4HVU A;  1B3Q A;  2LX7 A;  1BKM A;  1O4K A;  2EW3 A;  1TUD A;  1CSK A;  1S1N A;  3EAC A;  4JGH A;  1NYF A;  1X27 A;  2KXD A;  4M4Z A;  3REB B;  1Y1U A;  4AFQ C;  4R0K A;  1GCQ A;  2L3S A;  1RLP C;  3EHQ A;  2EL8 A;  3IN7 A;  3CQT A;  1E6H A;  3SEM A;  3BUN B;  1V1C A;  2LQW A;  1A1E A;  2DM1 A;  2LNW A;  1A1A A;  1BLJ A;  2AOA A;  1M3B A;  1RLQ C;  3UA7 A;  1AEY A;  1CWE A;  4J9F A;  5AUL A;  4GBQ A;  3A98 A;  1O4G A;  2CUD A;  2KGT A;  1M61 A;  1T0J A;  2RMX A;  1U06 A;  3U23 A;  4IIO A;  2B3O A;  1O4E A;  3M0P A;  1UE9 A;  1J3T A;  2A36 A;  1OEB A;  1JXO A;  4DGP A;  1YNZ A;  2CT4 A;  1QWF A;  3H0F A;  4DEX A;  1A0N B;  1WA7 A;  1R1S A;  4RTZ A;  1T3S A;  2GTO A;  2MRK A;  1UUR A;  1E7O A;  3BUX B;  4L1B B;  1AOT F;  3M0R A;  1O42 A;  2AUG A;  4LUD A;  2YSX A;  4NWG A;  3REA B;  1D4W A;  1SHD A;  1A07 A;  5IHK A;  4A4B A;  2AKK A;  3IMD A;  4FL3 A;  3NMZ C;  1UUS A;  1TG0 A;  3EG2 A;  2BZX A;  1X43 A;  2K6D A;  2X3W D;  1A09 A;  1LKL A;  1SPR A;  1TCE A;  1PKT A;  2LMJ A;  1SEM A;  4GLM A;  3CBL A;  3I5S A;  4ROJ A;  1JU5 A;  1AYB A;  1O4H A;  2ROT A;  1O4O A;  4LN2 A;  2FPF A;  2HEQ A;  2F2W A;  1AZG B;  1X6G A;  1ZFP E;  2ROR A;  1PWT A;  5EG3 B;  2P4R A;  1Y0M A;  1YVH A;  1JO8 A;  2JT4 A;  1FBV A;  4JJD A;  2H5K A;  4E68 A;  2DF6 A;  1IO6 A;  2L2P A;  2EO6 A;  2E5K A;  2YDL A;  1O41 A;  3N8M A;  4EY0 A;  2XP1 A;  3IQL A;  2SRC A;  1ZX6 A;  4QT7 A;  1O4B A;  2B86 A;  2MIO A;  2PNB A;  1KC2 A;  4F17 A;  2C0I A;  1P13 A;  1X0N A;  3FJ5 A;  4LUE A;  1YVL A;  3OP0 A;  4J9D A;  4RTX A;  1R1Q A;  2EYV A;  2PNA A;  2HBW A;  1HCT B;  2RMO A;  2DL7 A;  4F14 A;  1UGV A;  4J9I A;  5EHP A;  1AYC A;  1CSZ A;  1PNJ A;  1A1C A;  3EG1 A;  1GBQ A;  1AWO A;  2MQI A;  3TKZ A;  4JPB W;  5GJV B;  4U17 A;  1WXU A;  3I35 A;  5FWB A;  1O4N A;  2KR3 A;  3NHN A;  3S8L A;  1PKS A;  3VS1 A;  1O4C A;  1XOV A;  3EG0 A;  1JWO A;  1O4D A;  1QG1 E;  2KRN A;  1I07 A;  1SHF A;  1TUC A;  1BMB A;  3OB2 B;  3VGO A;  3BUM B;  2KRS A;  3I9Q A;  2C0O A;  3ULR B;  3IMJ A;  1HJD A;  1UUE A;  3PLF B;  5DC4 A;  1VYU A;  1VYT A;  2RN8 A;  2DL3 A;  2PTK A;  3VRQ A;  3UAT A;  1NYG A;  1WLP B;  2AZS A;  5D0J A;  4F5B A;  1O44 A;  2J7I A;  3VS3 A;  3M0Q A;  1X2Q A;  1BFJ A;  2RQW A;  1FYR A;  2KRM A;  3ZL7 C;  5DC0 B;  1JXM A;  5KAZ A;  4JZ4 A;  2YT6 A;  1FU6 A;  2RF0 A;  2LCT A;  4E93 A;  2PLE A;  1H9O A;  2AKL A;  4WWQ A;  1AWX A;  1AZE A;  3MAZ A;  1FYN A;  1Z9Z A;  4J9H A;  1M3C A;  1UJ0 A;  2IUI A;  3VS6 A;  2H46 E;  1NEG A;  2C0T A;  1LCK A;  1FBZ A;  1CSY A;  2X3X D;  3SHW A;  3BUW B;  1HD3 A;  1MW4 A;  3JV3 A;  1NZL A;  1OPK A;  4HVV A;  1BBZ A;  1K76 A;  5IHN A;  1O4Q A;  4Y92 A;  1SPK A;  1SHA A;  1FMK A;  2IUH A;  2H8H A;  3H0I A;  3VRR A;  2EGC A;  2KYM A;  1G2B A;  3N7Y A;  3VS4 A;  5IXF A;  1BHH A;  1WYX A;  1K0X A;  2GTJ A;  2RQR A;  1TZE E;  5GJI A;  1O45 A;  2O88 A;  2CH4 W;  2KYB A;  3M0U A;  1NLP C;  2MCN A;  4XZ1 A;  2RQT A;  4RUG A;  1SPS A;  3OB1 B;  2K79 B;  1VYV A;  2KXC A;  2DIL A;  4OML A;  2Y1M A;  1LUI A;  2EBP A;  1WX6 A;  2YUO A;  1ZSG A;  1K1Z A;  4OMM A;  2J6K A;  5ECA A;  1HCS B;  4HVW A;  1LUK A;  2CSQ A;  1BK2 A;  2DE0 X;  1ZUK A;  3CXL A;  1JQQ A;  2QDL A;  1F1W A;  5IH2 A;  2HMH A;  1YWO A;  3OVE A;  2IIM A;  1AYD A;  3GQI B;  5IBS A;  2LJ3 A;  1Y57 A;  4RTU A;  2PLD A;  3S9K A;  1M30 A;  2JMC A;  2OZO A;  3US4 A;  3PS5 A;  1CKA A;  2CI8 A;  4AFZ C;  3EGU A;  1O4I A;  2DJQ A;  2KT1 A;  1ARK A;  1A81 A;  3BKB A;  2W10 A;  4RTY A;  2CRH A;  2OJ2 A;  4F59 A;  2DX0 A;  1GCQ C;  4OMN A;  2A08 A;  1NM7 A;  2ABL A;  5IXB A;  1AOJ A;  1LUN A;  2D1X A;  4CC7 A;  5DF6 A;  4OHL A;  1AVZ C;  1AOU F;  1ZBJ A;  2DL5 A;  2J6O A;  1VA7 A;  2KBT A;  3VRO A;  2YUP A;  2EKH A;  1W6X A;  1U5S A;  4A4C A;  1IS0 A;  2DRM A;  5I6V A;  1K4U S;  2HUW A;  5GJW B;  1BB9 A;  3HCK A;  4GPL B;  1LUM A;  2CBL A;  2LJ1 A;  2O31 A;  2KNB B;  2VKN A;  1ABO A;  1G83 A;  3HHM B;  3K2M A;  1I1J A;  1QKX A;  4FL2 A;  4Z89 A;  1PRL C;  2JM8 A;  4IIM A;  2YUN A;  2D0N A;  1ZUU A;  3M0S A;  1UG1 A;  2CR4 A;  1GL5 A;  2FPE A;  2K3B A;  2NUZ A;  2CIA A;  4P9Z A;  2EGA A;  1JYU A;  1H92 A;  1RJA A;  2K2M A;  4JJB A;  4K2R A;  4K44 A;  2O9S A;  2LJ0 A;  2SEM A;  3T04 A;  4Z8A A;  1NLO C;  1PRM C;  1O4R A;  1W1F A;  2V1Q A;  2RVF A;  3VRY A;  3BUO B;  5IHI A;  2RNA A;  1YCS B;  1O43 A;  2DCR A;  1YP5 A;  1BLK A;  1UEC A;  3KFJ A;  1O4M A;  1MV0 B;  2KEA A;  2JM9 A; 
#chains in the Genus database with same CATH topology
 1UHF A;  4A4E A;  4QVC A;  2LCS A;  2SHP A;  2RA2 A;  2HKQ B;  4P9V A;  2LRQ A;  4KUL A;  1BM2 A;  2GGR A;  3H41 A;  3H0H A;  1I5O B;  2DKG A;  3VU3 C;  3I5R A;  5KYY B;  3ZEH A;  2RQU A;  3X26 B;  3BE3 A;  3OYM A;  2KT8 A;  2X9H A;  3CC4 Q;  2YXY A;  1YJ9 T;  1XTD A;  4PJO D;  1JRI A;  4IUV A;  5LL6 S;  3CD6 A;  4RCB A;  4OHD A;  2RQV A;  7AT1 B;  1N27 A;  3HTR A;  1OQK A;  2FG0 A;  5IBM A;  4MZM A;  4A54 A;  4M77 G;  2EU0 A;  2K9G A;  3PNW C;  3TL0 A;  4XU3 A;  4E7I A;  3MXC A;  2VV5 A;  3HIZ B;  3OW2 S;  2PVG B;  2WSF E;  2PU9 B;  2CDT A;  2HCK A;  3OBW A;  4PJO C;  2QQB A;  4DOW A;  4FSS A;  3A5Z B;  1VQL A;  2EGE A;  1Q7Y U;  5DC9 A;  5FRO A;  1OOT A;  4C8Q G;  2RHY A;  2YRC A;  4E2F B;  2VGM A;  1EX4 A;  2VVK A;  3P8B B;  1BI3 A;  2ESW A;  3QBY A;  3SD4 A;  4EIK A;  5DY9 A;  2RHI A;  1VQN T;  3GNG A;  1IJR A;  3I56 A;  3SWN B;  4D6W A;  2EQK A;  3TVT A;  1M2V A;  3R6N A;  4D8K A;  1C6V X;  1Y96 B;  2XD0 A;  3G4S T;  2AZV A;  4J6Y A;  4PLL A;  2EIF A;  2G3R A;  3KFV A;  5AYF A;  3HPW A;  2CI9 A;  2C9W A;  3I56 T;  3V7S A;  1G3T A;  1BHF A;  1YWP A;  3MCA B;  3OYH A;  3FJP A;  2EOB A;  4PK4 A;  2K7A B;  2ROL A;  1QVF A;  1QAD A;  3OS5 A;  3OV1 A;  4M77 E;  4RTW A;  1UJY A;  3C0C A;  1VQ8 Q;  3S8O A;  2YUQ A;  1NPR A;  2VXF A;  3OYJ A;  4H34 A;  4PJM A;  2LNX A;  8ATC B;  1D09 B;  2GQV A;  5HCK A;  1BI1 A;  3C12 A;  1D1B A;  3UWN A;  2GBQ A;  1WFW A;  1O49 A;  3HKS A;  5GAN 2;  4PJL A;  4PJO E;  1W70 A;  1D1C A;  3G7Z A;  1SF9 A;  1KC8 C;  1WQU A;  3JCM W;  2CP3 A;  2COY A;  5LJ3 d;  3UYO A;  2D6F A;  1QCN A;  2D8J A;  4AG1 C;  4BDZ A;  1M27 A;  2HDA A;  5KYX B;  2FPD A;  2BE9 B;  1QKW A;  5GAN 4;  1BIB A;  1M1K R;  1CWD L;  4R55 A;  1VQM A;  5EEQ A;  4DBH A;  1MMD A;  2PUK B;  3G71 T;  1RPY A;  2HAX A;  1SKJ A;  4E6R A;  3CD3 A;  1SHG A;  1KQS A;  3EAZ A;  1IRX A;  4JS5 A;  3CC7 A;  1Q86 R;  4HKE A;  2L5Q A;  4M78 C;  4OMQ A;  1W4S A;  1YI2 Q;  3AT1 B;  2GSB A;  3QYG B;  2BZ8 A;  2E10 A;  1WIE A;  2CP0 A;  3PT9 A;  3NTI A;  1YJW A;  2XK0 A;  4XTX A;  1JJ2 S;  2J06 A;  2M51 A;  2ECZ A;  4M7D F;  2L0A A;  2CH4 A;  1O4L A;  1YI2 A;  5FU6 B;  4BI4 A;  3CCM T;  1SRM A;  4C0D C;  3M0T A;  2DXT A;  3O8V A;  2PVO B;  3I55 A;  4U1P A;  1Z3K A;  3M56 A;  4AT1 B;  1BHH B;  1JB0 E;  1R0B G;  1D0Y A;  3JB9 I;  2CZ6 B;  3PVL A;  4PKC C;  2PNI A;  1K73 R;  2FEI A;  5CKE A;  4FYY B;  1VQM Q;  3THK A;  2DXC A;  3JB9 F;  4OHI A;  4BE0 A;  1OZ2 A;  5L23 A;  1BFI A;  1ACM B;  3QDF A;  2JTF A;  1NEB A;  3GIB A;  1QLY A;  1X75 C;  3QWY A;  1Z9Q A;  1KHI A;  2R57 A;  1UB4 A;  1FMV A;  4C8Q E;  3EGX B;  4PJO A;  4O6J A;  1I5L A;  1CSK A;  1X27 A;  4OB1 B;  2MF2 A;  2EQJ A;  1RLP C;  2EL8 A;  3EG9 B;  1C1A A;  3IN7 A;  4J5Y A;  4OP0 A;  3T9N A;  3BUN B;  1V1C A;  1A1E A;  2DM1 A;  1BLJ A;  2H3J A;  5KYW A;  3OSS C;  4FCY A;  4GBQ A;  3OYD A;  1I81 A;  2CUD A;  2EJG A;  1O4G A;  2P0Q A;  1T0J A;  2DZ9 A;  3U23 A;  1O4E A;  4Q5W A;  3M0P A;  1J3T A;  2RI3 A;  1QWF A;  4P5N A;  1YI2 T;  1WA7 A;  2ZPI B;  3M53 A;  3CPW P;  1R1S A;  1UUR A;  2RM4 A;  1ZA1 B;  1W2B P;  3RIR A;  3M0R A;  4M78 A;  2QA4 T;  2ZPG B;  1K9M C;  3M54 A;  3J80 E;  3IMD A;  1VQO A;  1TG0 A;  3KXT A;  3JCM d;  4GLM A;  1SEM A;  1WHG A;  3C95 A;  2NLU A;  1AYB A;  3CCE A;  5GAM e;  5C6S A;  2QA4 A;  2OTL Q;  2QGG A;  1AZG B;  1ZFP E;  4YTL A;  1Y0M A;  1VQL T;  2GFU A;  4E68 A;  4JJD A;  5LJ3 e;  5I2S A;  1IB8 A;  1IO6 A;  4WF2 A;  3EFO A;  1WJS A;  2EO6 A;  2F1L A;  3IQL A;  1RAD B;  4QT7 A;  2LNV A;  1O4B A;  4RKU E;  3LGF A;  4CRI A;  1M2V B;  4ZGD B;  3VYG A;  3CME A;  1P13 A;  1X0N A;  4XU0 A;  1YVL A;  4RTX A;  3MEV A;  5LJ5 d;  2EKO A;  4IUP A;  4J9I A;  2MMP A;  1AYC A;  4V2S A;  1CSZ A;  1ZHI A;  1A1C A;  3EG1 A;  1Y71 A;  3TKZ A;  4U17 A;  5GJV B;  1TOV A;  4C8Q A;  4Y28 E;  1O4N A;  3NHN A;  2DER A;  1BMB A;  2EAY A;  2QK0 A;  3I9Q A;  1IZ6 A;  3IMJ A;  3PLF B;  2DL3 A;  3VRQ A;  3UAT A;  2AZS A;  2K3X A;  3M58 A;  1XJW B;  3VS3 A;  1R77 A;  1X2Q A;  1YJN T;  4RG8 A;  2RQW A;  2KRM A;  1JXM A;  4BD3 A;  2RF0 A;  1VQK T;  2LCT A;  4A4F A;  2PLE A;  4AMC A;  4M7A B;  3OS1 A;  3BY7 A;  4XAX B;  4WWQ A;  3MAZ A;  1M3C A;  3MKD A;  2V8I A;  4L59 A;  3OB9 A;  3JV3 A;  1O9S A;  1K76 A;  5IHN A;  3HFN A;  1SPK A;  1SHA A;  1FMK A;  2QI2 A;  4ZN1 A;  2EGC A;  2E70 A;  1YIJ A;  2DEQ A;  5CKB A;  2CH4 W;  2Y4Y A;  2E5Q A;  1NLP C;  3VJP A;  4BE1 A;  5CQY A;  2RQT A;  4RUG A;  1SPS A;  3EGX A;  3P8H A;  3M59 A;  4N4H A;  1UGQ B;  3EFR A;  1Q82 U;  1K8A U;  1VQN Q;  2WSC E;  1M1K U;  1OU9 A;  4OMM A;  2OTJ A;  2J6K A;  4MMK A;  3QSU A;  4C0D B;  2M0O A;  3H6Z A;  4A53 A;  1D1A A;  1JQQ A;  1F1W A;  1EZZ B;  3OVE A;  1BCM A;  5IBS A;  2LJ3 A;  5GMK h;  2JMC A;  3RUX A;  3PS5 A;  1CKA A;  2CI8 A;  2A7Y A;  3JCM V;  3WVD B;  2HQH A;  1O4I A;  2KT1 A;  2W10 A;  4M7A C;  4F59 A;  4M78 B;  2A08 A;  5GMK m;  2ABL A;  4RG2 A;  2DIQ A;  2D1X A;  3TQ7 P;  4M75 G;  5CO7 A;  3HHT B;  2KBT A;  1U5S A;  1MND A;  2KDS A;  3QZ5 B;  2QDY B;  5I6V A;  3RKY A;  4M75 A;  1VQ9 A;  5GJW B;  3HCK A;  4GPL B;  3EFS A;  1NPP A;  4OVA A;  4B9W A;  3CBO A;  4MDX A;  2RK2 A;  3CEY A;  3HHM B;  3K2M A;  1BI0 A;  3QUI A;  4FL2 A;  1IXD A;  3JAM E;  4IIM A;  2KY9 A;  1Q81 U;  1I8F A;  2NUZ A;  1JYU A;  3G4S A;  3S3O A;  2K2M A;  3BW1 A;  3CBP A;  2VC8 A;  1VQ7 A;  4GY5 A;  2JVV A;  3T04 A;  3X28 B;  1O4R A;  4J6W A;  1O4M A;  4N4G A;  1MV0 B;  5GAN f;  1VQP T;  1D0X A;  3OMC A;  2DBM A;  2E41 A;  1N5Z A;  3ZNI A;  1GBR A;  1SSF A;  3M57 A;  1X6B A;  5GAN 7;  1G3Y A;  1H8K A;  1MUZ A;  3RES A;  1Q95 G;  1R0C B;  2XI9 A;  4C5G A;  4EPC A;  3GOX A;  1A1B A;  2CP6 A;  1X6O A;  5L8R E;  2K7A A;  4NOY A;  1P92 A;  1RAG B;  3OYI A;  1NBE B;  4C92 G;  1AWW A;  3GF5 A;  3CME Q;  4F7U A;  3MO8 A;  2NWM A;  2KQW A;  4M75 D;  3QII A;  3ER0 A;  2EJ9 A;  1WHK A;  1HYO A;  2HKN A;  2VYT A;  3SWN A;  2FO0 A;  1K73 U;  2CT3 A;  2MWO A;  1KK7 A;  1AWJ A;  2J05 A;  4JE4 A;  5CDW A;  2OTL A;  2V8J A;  5CKF A;  3CCR Q;  4TVR A;  1K9M U;  3JB9 G;  4XTV A;  2JW4 A;  2ZCF B;  4JDS A;  1G3W A;  2QMS A;  4J7F A;  2EYQ A;  2GFA A;  2JTE A;  2Y1N A;  3MP6 A;  4J9C A;  2LNH B;  1BG1 A;  5EG2 A;  5CCA A;  3RBB B;  4PJO F;  3VUZ A;  5KYX A;  1F1B B;  4X6S A;  2ATC B;  4QQD A;  2V1R A;  4K11 A;  2RSY A;  3VUB A;  2E4H A;  3CC2 A;  4KH0 B;  4TZI A;  4C0G A;  1PIC A;  1M1G A;  1KJW A;  2JZ2 A;  4KUI A;  2G6F X;  2JN0 A;  1OU8 A;  2RPN A;  2PZ1 A;  1SRL A;  1NG2 A;  1PD0 A;  3QPH A;  2F2V A;  1V76 A;  2LVM A;  2QYZ A;  1WQW A;  5BO4 A;  1WJR A;  2L3Q A;  4PFO A;  5HKC A;  2DEU A;  4M77 F;  5FU6 C;  4OHH A;  3JB9 J;  4DEY A;  1Q82 C;  1K8A C;  3TEE A;  2CUB A;  1WHJ A;  3DLL A;  4X9C A;  1R1P A;  1X6C A;  2O9V A;  1UDL A;  4E7K A;  1KG1 A;  2CZ1 B;  4XQ3 A;  2M0Y A;  3PSJ A;  1X01 A;  1OUL A;  4GL9 E;  2XU8 A;  3LWH A;  3L42 A;  1O4F A;  2LQ8 A;  2QAZ A;  1WGS A;  1JU5 C;  4L6V 5;  1XA6 A;  3BDL A;  1GFD A;  1AD5 A;  4ANJ A;  5J3X A;  2BTT A;  4WCI A;  2D8H A;  1UGP B;  1VOM A;  4FU6 A;  1RUW A;  2OAW A;  2KNO A;  2JXB A;  2KVQ G;  3VS5 A;  2DM0 A;  3NGP A;  1PD1 A;  4OMP A;  4OB3 B;  3PJP A;  1TXQ A;  3CXC S;  2KE9 A;  2XID A;  1RI0 A;  4RTT A;  3A8O B;  3NPF A;  3OYL A;  1BIA A;  2Y3A B;  2K2V A;  2MI6 A;  3X25 B;  5KCH A;  2J6F A;  1KA6 A;  1ZSZ A;  1NRV A;  3CPF A;  1AYA A;  1HSQ A;  4KBM B;  3IN8 A;  2ZPF B;  1OO4 A;  1BF5 A;  1JYR A;  1NJI R;  2Z0W A;  5J3B A;  1WXT A;  1MHN A;  5GAM f;  5FRM A;  1BKB A;  3CCU T;  2EFI A;  2OAU A;  1M9S A;  5CAI A;  4PJN A;  1N9S A;  2JS2 A;  5GAN d;  2YLB A;  4HCK A;  2QAS A;  4ESR A;  2LCL A;  3G71 A;  1GCP A;  2OI3 A;  3UA6 A;  2KMT A;  2F5K A;  4J9G A;  2WAC A;  5EHR A;  3JCM X;  4HXJ A;  4BI3 A;  5M9O A;  3GLX A;  4QKU A;  4ZN3 A;  9ATC B;  3F70 A;  2RJE A;  3FLG A;  2FL7 A;  4LXC A;  2ED0 A;  3VYH B;  1NZV A;  3PQZ A;  4XK8 E;  2JS0 A;  1O46 A;  3SWN C;  2DLP A;  1MMA A;  3DLM A;  2GE9 A;  5J26 A;  2JYQ A;  4Z02 A;  2E6Z A;  2GNC A;  2MRJ A;  3QJY A;  2LX7 A;  4M7D D;  1BKM A;  1O4K A;  2EW3 A;  2E64 A;  3QXE B;  4R0K A;  2K5F A;  2L3S A;  3EHQ A;  4IUU A;  2LQW A;  1KD1 U;  2L3R A;  2QTX A;  2AOA A;  1M3B A;  1RLQ C;  5AUL A;  4M75 C;  1VQ5 T;  1AEY A;  4FW1 A;  2FZG B;  3A98 A;  5IAY A;  1Y7X A;  1M61 A;  2RMX A;  3LYI A;  3JCM P;  5LJ5 j;  4LD9 K;  4DGP A;  1QVG S;  4M7D C;  2CT4 A;  3H0F A;  3OMG A;  2ZAE A;  1YIT Q;  1OYX A;  2MRK A;  2GTO A;  2QQ9 A;  1E7O A;  2R58 A;  3JCM c;  3BUX B;  2HQX A;  4Y91 A;  2LRA A;  5DLQ E;  2V26 A;  3REA B;  5IT9 E;  2EQM A;  1VQL Q;  1D4W A;  4N4I A;  5IHK A;  1I4K 1;  1QVG P;  4J83 A;  1SHD A;  4A4B A;  4RCC A;  1UUS A;  2BZX A;  1LKL A;  1A09 A;  2RK1 A;  2EWN A;  1K9M R;  2AT1 B;  4FYV B;  1JU5 A;  3LYV A;  1D3B A;  3CCL Q;  4OMF B;  2ROR A;  1PWT A;  1FBV A;  4NL2 A;  2YDL A;  1O41 A;  4EY0 A;  3OQ5 A;  3ZBD A;  2MIO A;  2PNB A;  2L8D A;  1KC2 A;  1XNI A;  3FIF A;  4LUE A;  2LQK A;  4J9D A;  3EH1 A;  2PNA A;  2HBW A;  4FYX B;  3I55 T;  1HCT B;  5HK3 A;  3BFM A;  4E7H A;  4F14 A;  1UGV A;  2CP2 A;  1PNJ A;  4VUB A;  1GBQ A;  1AWO A;  2A0F B;  4C92 C;  4QQ6 A;  2O4X A;  2P0K A;  1XOV A;  5FU7 C;  1JWO A;  2COZ A;  5GAO n;  1I07 A;  1SHF A;  1TUC A;  2CP7 A;  3OB2 B;  3NTH A;  1M90 U;  3BUM B;  2LT4 A;  2C0O A;  1IGQ A;  1HJD A;  5DC4 A;  1YFN A;  3WVE B;  3G6E T;  4F5B A;  5GAN 6;  5J39 A;  3M0Q A;  3L2V A;  1OX9 A;  1Q82 R;  2RI5 A;  2DTI A;  1K8A R;  1FYR A;  5DC0 B;  4JZ4 A;  1AT1 B;  2AKL A;  5GAM h;  1AZE A;  1NZ9 A;  1Z9Z A;  2IUI A;  3OS2 A;  2H46 E;  1TTH B;  2X3X D;  3CCE T;  2M16 A;  1BBZ A;  2RD1 A;  1O4Q A;  4PLI A;  3JSC A;  5GAM g;  3H0I A;  4ELY C;  3VRR A;  2KYM A;  1U1S A;  2YLC A;  4MDW A;  1LPL A;  4OF1 A;  1R8O B;  1LNX A;  1G2B A;  3MEA A;  4EMK C;  4E7J A;  1K0X A;  2RQR A;  3OYG A;  1O45 A;  1VQK A;  3MHX A;  3OS0 A;  1G3S A;  4XZ1 A;  2V8K A;  3OB1 B;  2KXC A;  4JS4 A;  1VQK Q;  2QEX Q;  2RHU A;  4M77 B;  1RL2 A;  1ZSG A;  1KQS P;  1N6A A;  2DE0 X;  3M9Q A;  5GAO p;  1AYD A;  4C8Q C;  3GQI B;  4MZT A;  2PLD A;  2VAS A;  4FT2 A;  5KYY A;  5LJ3 f;  5GAN g;  2DXB A;  3CBM A;  4AFZ C;  2HSE B;  2RJC A;  2DJQ A;  4O5V A;  2DX0 A;  1GCQ C;  4OMN A;  3K2T A;  2CYZ B;  3QJ6 A;  4HCB A;  4OHL A;  1LVK A;  4C0Z A;  2EQU A;  2BIV A;  1S72 T;  1VA7 A;  3A8M B;  4E7S A;  2EKH A;  1W6X A;  2YWW A;  4A4C A;  1IS0 A;  2DRM A;  1YJN A;  5GAO r;  2XDB A;  2DVE A;  4C92 A;  1LUM A;  3MJX A;  2LJ1 A;  2O31 A;  2KNB B;  4MML A;  3OY9 A;  4JLG A;  1PRL C;  2JM8 A;  4Z89 A;  3CCV A;  2LDM A;  2FB7 A;  1KQ2 A;  3RMS A;  1WHL A;  1GL5 A;  4II1 A;  2RJF A;  4NS5 A;  2K3B A;  2CS7 A;  3ZFJ A;  4P9Z A;  4M75 E;  4Z8A A;  3BUO B;  1YJ9 A;  5IHI A;  2XDP A;  1VQO T;  3KFJ A;  2IZV A;  1SKU B;  3VRN A;  2ZZD A;  2AOB A;  2A28 A;  1M8M A;  1U1T A;  3TSZ A;  1EFN A;  4PFP A;  1BYM A;  4OB2 B;  5CQX A;  3LH5 A;  1YHQ A;  1QMC A;  4OGC A;  5GAM d;  3R6O A;  1XQH A;  1O47 A;  2HDV A;  2Y90 A;  3V7C A;  4M7A F;  2X4J A;  3TRE A;  2XIC A;  3L1A A;  1M3A A;  4BY6 C;  4CC2 A;  1YHQ T;  1OX8 A;  4DA4 A;  1IRE B;  3QG1 A;  1N8R R;  3PSK A;  2KK6 A;  4PL6 A;  4E7L A;  4F5A A;  4FM4 B;  3JCM e;  1M1F A;  1JYQ A;  1WZO A;  2HDX A;  1SSH A;  1GRI A;  3JCM h;  1W2B S;  2WSE E;  2AIR B;  4C92 E;  1VQO Q;  4H1O A;  3LH0 A;  3CCJ T;  3CMA Q;  1VQ6 Q;  2DX1 A;  5I22 A;  1A08 A;  1IHW A;  4JRI A;  6AT1 B;  3PMI A;  1O4A A;  1UTI A;  2ED1 A;  4M7D B;  2R5A A;  2OTL T;  5LJ5 e;  2F2X A;  1I0C A;  4BB7 A;  3CCJ A;  1N9R A;  1OPL A;  1QVG A;  2DAQ A;  1UHC A;  3QWX X;  3LX7 A;  2ECD A;  2QXF A;  3QZ9 B;  5D6Y A;  3CCV T;  4J8O A;  4AG2 C;  3N84 A;  4BI8 B;  1QVF P;  2O4X B;  3RNJ A;  1VIE A;  5GAN 3;  4GWF A;  2B8A A;  4F7U B;  1LJO A;  2YSQ A;  3MXY A;  2LZ6 B;  3EHR A;  5GAN e;  2FCI A;  2QQR A;  2H3E B;  4M78 G;  2FVU A;  2OQ1 A;  1OV3 A;  1VQ5 Q;  1VQM T;  3QDR B;  5AXI A;  4M77 C;  3CCL T;  2EPD A;  1K0S A;  2VWF A;  4XTY A;  1WDX A;  1GFC A;  2DRK A;  4OGE A;  4UC4 A;  4AFS C;  4LDU A;  1CJ1 A;  2FRW A;  2L4K A;  4BUG A;  3PVQ A;  3L2W A;  2M9U A;  3OW2 P;  1X2K A;  1OO3 A;  1QVF S;  4ZNX A;  4E7Z A;  4C8Q D;  5FLX E;  2NUP A;  4A4H A;  2X35 A;  1N8R C;  2AHJ B;  4A4G A;  1BKL A;  1VQP A;  3ME9 A;  3GPL A;  3TU4 K;  1Q7Y R;  1ABQ A;  1Q86 C;  2ZPH B;  1VQ4 Q;  1WHH A;  3EGD B;  2MPX C;  2LC4 A;  3VS7 A;  4LDY A;  2MWP A;  4JLI A;  5CKH A;  1ZBX A;  4FW2 A;  1TUG B;  1QVP A;  2AK5 A;  3CCM A;  2BBU A;  5GAO m;  4F16 A;  1AB2 A;  1QCO A;  1FU5 A;  1T3L A;  2RB6 A;  1X69 A;  2EO3 A;  2M02 A;  2LTO A;  1Q81 R;  3G4S Q;  4EIH A;  3ASK A;  4M75 F;  4QSY A;  3QHS A;  5D6X A;  3CCQ A;  2IUG A;  4M78 E;  2L6K A;  3PIO A;  5FU7 B;  2FHD A;  2NUP B;  3OYF A;  3OYE A;  1T0H A;  3CPW S;  3CCJ Q;  3SB2 A;  3VV0 A;  3H9N A;  2EYX A;  2IVW A;  4EMK A;  5EEL A;  3CC2 T;  2X4Y A;  4XU2 A;  3A8L B;  2QEX T;  1KD1 R;  4DBR A;  2EQI A;  2LP5 A;  2LQN A;  3EAE A;  3WA4 A;  3KBG A;  4HA8 A;  1VQ6 A;  5GAO l;  4K45 A;  5HKY A;  2K5L A;  1CKB A;  4FYW B;  4LNP A;  2E6N A;  3PFV A;  3I56 Q;  3CWG A;  1MMN A;  2CRE A;  2FRY A;  3LWI A;  2I0N A;  3UPU A;  3GXW A;  8AT1 B;  2DO3 A;  1TSF A;  2YU7 A;  2DTO A;  4J9B A;  4Z88 A;  4C5I A;  1O48 A;  5FRN A;  1KA7 A;  4HVU A;  1RAI B;  1JJ2 P;  1S1N A;  4M4Z A;  1OI1 A;  2BUD A;  4N0A C;  4F04 B;  3JCM Q;  5A2Q E;  1TU0 B;  1WJQ A;  4AFQ C;  3PTA A;  1GCQ A;  1YJ9 Q;  1E6H A;  1MNE A;  3SEM A;  1HK9 A;  2LNW A;  5HK0 A;  3CCS A;  2IPO B;  1V29 B;  1D0Z A;  3UA7 A;  1RAC B;  1VQ4 A;  4J9F A;  3DB3 A;  1RAF B;  2ZPE B;  1KD1 C;  4PJJ A;  2B3O A;  5CK9 A;  3JCM f;  3CCS T;  1YNZ A;  3KUF A;  3M5A A;  2XHC A;  4RTZ A;  1T3S A;  3MEW A;  3GP8 A;  3OYY A;  4X34 A;  1YJW T;  3FEO A;  2QGF B;  1AOT F;  4JRQ A;  1O42 A;  4LUD A;  2YSX A;  4NWG A;  1A07 A;  4FL3 A;  2PQW A;  3NMZ C;  3V8J A;  3EG2 A;  2K6D A;  5GMK i;  3CME T;  2X3W D;  1Q81 C;  1TCE A;  1PKT A;  2LMJ A;  3INZ A;  3I5S A;  4E47 A;  1IHV A;  1KHC A;  1O4H A;  2FZK B;  2ROT A;  4JRP A;  1BCO A;  2FPF A;  4ZTF A;  5LJ5 f;  1X6G A;  3E19 A;  2P4R A;  2JT4 A;  5CKD A;  4KH1 B;  2DF6 A;  2KAF A;  3L2Z A;  2L2P A;  4XU1 A;  4IUR A;  2XKO C;  2XP1 A;  2SRC A;  1ZX6 A;  1OZ3 A;  2B86 A;  2KK4 A;  4F17 A;  2L89 A;  3X24 B;  3FJ5 A;  3OYB A;  2QEX A;  3CD6 Q;  1R1Q A;  2EYV A;  4RMO A;  2RMO A;  2DL7 A;  3CC7 T;  2K57 A;  2MQI A;  4JPB W;  4WTO B;  1RAE B;  2M1H A;  2KR3 A;  5KYU B;  1PKS A;  3AHU A;  1O4D A;  1QG1 E;  2Y4X A;  2KRN A;  4CI0 C;  4N0A A;  2FZC B;  2KRS A;  3MP1 A;  3ULR B;  1UUE A;  4A4K A;  4L5G A;  2QA4 Q;  2PTK A;  1WLP B;  5D0J A;  5LJ3 g;  3CMA T;  1O44 A;  2J7I A;  4KGX B;  4FT4 A;  4EMG A;  1UEB A;  2BKD N;  1YIJ T;  3ZL7 C;  5KAZ A;  5GAN 5;  2YT6 A;  1FU6 A;  4B6M A;  2D9T A;  2LT1 A;  2DTH A;  1AWX A;  1FYN A;  1YHQ Q;  4J9H A;  1NEG A;  2C0T A;  1LCK A;  1FBZ A;  1CSY A;  3M4Y A;  3BUW B;  3HFO A;  3QO3 A;  4HVV A;  4Y92 A;  5GAM j;  5KYU A;  4M7D G;  2H8H A;  1EIF A;  3SDZ A;  1VQP Q;  3N7Y A;  3VS4 A;  5IXF A;  5LJ5 h;  2GTJ A;  2F69 A;  4XTW A;  2E3I A;  3UT1 A;  2KYB A;  2MCN A;  4KT0 E;  1NJI C;  2K79 B;  4B9X A;  3J7A F;  2DIL A;  2RO0 A;  1JJ2 A;  2Y1M A;  3QKJ A;  3CPW A;  1LUI A;  5CR2 A;  1VQ6 T;  2NYS A;  3A8H B;  4ME7 A;  1WX6 A;  1Q7Y C;  1K1Z A;  4BE2 A;  5ECA A;  1HCS B;  1LUK A;  1BK2 A;  1YIT T;  3CXL A;  3FC3 A;  1KC8 R;  2QDL A;  1KQS S;  2DPP B;  2HMH A;  4JRK A;  2IIM A;  4F7U E;  4RTU A;  2DIG A;  3S9K A;  1M30 A;  2RI2 A;  3FB9 A;  2OZO A;  3US4 A;  3G6E A;  4FIB A;  3CCS Q;  3CCQ T;  3EGU A;  4LDX A;  1JBM A;  3BKB A;  5GMK e;  4RTY A;  2CRH A;  2OJ2 A;  2MYS A;  3CCR T;  5KE2 A;  1NM7 A;  5IXB A;  1AOJ A;  1BI2 A;  4KUD K;  4JUV A;  1AVZ C;  3LGL A;  1AOU F;  3CD6 T;  1ZBJ A;  2XG8 D;  3BDU A;  2J6O A;  3HP9 A;  2K3Y A;  1K4U S;  4QQG A;  5GAN j;  1FX7 A;  3M4G A;  1YCY A;  2QTV A;  2P0P A;  3LLR A;  3OBY A;  1QP3 A;  2E1H A;  2CBL A;  4X9D A;  2VKN A;  1ABO A;  3MET A;  5KCO A;  2I2L A;  5LJ5 g;  4ZTJ A;  1VQ9 Q;  5GAN 8;  3PFS A;  2D0N A;  1ZUU A;  3M0S A;  1UG1 A;  3MEU A;  2K4Y A;  4J6X A;  3EG9 A;  2CIA A;  5A0D A;  3CMA A;  2EGA A;  4DBQ A;  2VUB A;  5KYN A;  3JCM J;  1H92 A;  2CGH A;  1RJA A;  4K44 A;  1N8R U;  1M5Q 1;  1PRM C;  2RVF A;  1LOJ A;  1YBY A;  2RNA A;  1YCS B;  1O43 A;  2DCR A;  1UEC A;  1WHM A;  3CXC P;  2O01 E;  2DBK A;  2MK5 A;  3OYA A;  2JJ9 A;  2JUF A;  2DK3 A;  3M7F A;  2E65 A;  2GQI A;  2FYK A;  4JJN K;  3FRN A;  2L3T A;  1D3B B;  2XMF A;  3PIP A;  3X20 B;  4PJO G;  4C5E A;  1E6G A;  4LE9 A;  3OW2 A;  1FHS A;  1QWE A;  4ORZ A;  3CCU A;  2MAM A;  4KGV B;  3RKW A;  3OYK A;  2EYW A;  1D4T A;  5I11 A;  3RDV A;  2K79 A;  2RH2 A;  1S72 A;  3L2U A;  2DYI A;  2P84 A;  3RR6 A;  4DBF A;  4NL3 A;  3CC2 Q;  3FDR A;  3CC4 T;  1U3O A;  1QP2 A;  3CCQ Q;  4JEG A;  3EG3 A;  2DYB A;  5HY6 A;  4FL6 A;  4LD6 A;  2CZ0 B;  1AHJ B;  2HZY A;  2OTJ Q;  2GF7 A;  3HRU A;  1ZUY A;  3GBQ A;  2CSI A;  3V7R A;  5HKW A;  3E1S A;  5AT1 B;  2EKX A;  2OX7 A;  1KSW A;  3V8K A;  4LDW A;  1VIF A;  3CCR A;  5A0G A;  2DL8 A;  3CCV Q;  1MIL A;  1WI7 A;  2D0Q B;  1B47 A;  3CCL A;  2MK2 A;  3V8L A;  1UGS B;  3RKX A;  4X1V A;  1B7T A;  4NWF A;  2X4W A;  1DJ7 B;  5D7U A;  3HSB A;  1M8V A;  1NE8 A;  3PGG A;  1YJN Q;  4CC4 B;  4DOV A;  4QW2 A;  3GXX A;  2HMA A;  2DLZ A;  2ZGW A;  4IKF A;  4BY6 B;  3TSW A;  3I55 Q;  3MPU B;  2HSP A;  1QCF A;  1ZA2 B;  2HD0 A;  2W0Z A;  3PE0 A;  4D8D A;  5GJH A;  4DGX A;  4CC3 A;  1VQ5 A;  1RAH B;  2NUT A;  5FW9 A;  4F7U F;  3UF4 A;  1KFZ A;  1D1Z A;  1H3H A;  2DLY A;  1PCX A;  1MV3 A;  5EC7 A;  1YJW Q;  2QQS A;  2DNU A;  1M2O A;  2JMA A;  1U8R A;  5HKZ A;  2VGN A;  3S6W A;  1M90 C;  2X51 A;  2ENM A;  3CC7 Q;  3JB9 H;  2HNI A;  2HL5 C;  3H8Z A;  2QQA A;  4IUT A;  3VRZ A;  2A3L A;  1VQ4 T;  5A0L A;  4J9E A;  1O75 A;  3VS2 A;  4M77 A;  1IGU A;  1BU1 A;  1MMG A;  4RTV A;  4ATO A;  5DM7 R;  3S3N A;  3RER A;  4FBN A;  4OMO A;  1I3Z A;  2P4T A;  4F7U G;  1LKK A;  2ZPB B;  3P8D A;  2KGY A;  1TWB A;  4M7A A;  1RI9 A;  2E12 A;  1GHU A;  1WPY A;  2DFU A;  1SHB A;  4KRT A;  3O5Z A;  3S3M A;  1H3Z A;  2EVR A;  2VIF A;  2C06 A;  4QVZ A;  1WNL A;  3S8N A;  1YN8 A;  2IG0 A;  2DJZ A;  1FMW A;  3QYH B;  4XZ0 A;  1LCJ A;  3HRT A;  1B07 A;  2HQE A;  5FWC A;  1K9A A;  1O4P A;  3CCM Q;  2EYZ A;  1QQJ A;  1UFF A;  1JEG A;  1O4J A;  3VS0 A;  1VUB A;  3OYC A;  1M27 C;  2EYY A;  1PM3 A;  2DVJ A;  1PHT A;  3VKI A;  2XDD A;  2O2O A;  2X4X A;  3M55 A;  4M78 F;  5I21 A;  4C8Q B;  2KRO A;  4JJC A;  5IN1 A;  3VRP A;  3OSV A;  1SG5 A;  1VQN A;  4HCC A;  3C94 A;  4JZ3 A;  2JTM A;  1WXB A;  2CP5 A;  4HCZ A;  5CVI A;  1ZLM A;  2ETZ A;  4OHE A;  2YRD A;  4AFU C;  2CS0 A;  3G71 Q;  2DL4 A;  2A37 A;  3EFO B;  2DA9 A;  1YIJ Q;  1F2F A;  5DLO A;  1K73 C;  4C5H A;  2MOX A;  2L3P A;  4MZP A;  3C7I A;  2MC1 A;  3E9G A;  4EMK B;  1Q86 U;  4IUQ A;  2DMO A;  2DD5 A;  1Y07 A;  2BZY A;  1TH7 A;  1RQQ C;  4OB0 B;  4A63 B;  1KIK A;  2BE7 D;  1B3Q A;  3EAC A;  1C0M A;  1TUD A;  4JGH A;  4R56 A;  1NYF A;  2KXD A;  3REB B;  3JRZ A;  1Y1U A;  2DET A;  5KYW B;  3CQT A;  3NTK A;  4M7A E;  1VQ7 Q;  1WQ7 A;  1A1A A;  1RAB B;  2F5T X;  4LDV A;  1RAA B;  1CWE A;  2KI7 A;  2KGT A;  1G8X A;  1HXD A;  1U06 A;  4M7D E;  1M1K C;  4IIO A;  1UE9 A;  1G5V A;  2A36 A;  1OEB A;  1JXO A;  4DEX A;  1A0N B;  3OA6 A;  5LJ3 j;  3LW5 E;  4L1B B;  2E3H A;  3CCU Q;  3CXC A;  2RHZ A;  2AUG A;  3DKM A;  3Q1J A;  1UGR B;  2AKK A;  3NFC A;  3URG A;  4PJO B;  1X43 A;  1SPR A;  5GAN h;  4ROJ A;  3CBL A;  1VQ8 T;  4HT9 A;  1O4O A;  4LN2 A;  1VQ9 T;  2HEQ A;  2F2W A;  4XTU A;  3TCJ A;  3RMQ A;  2KSS A;  5EG3 B;  3JCM g;  4ZGE B;  1YVH A;  1JO8 A;  2H5K A;  4KGZ B;  2E5K A;  3N8M A;  3E9F A;  1MGQ A;  2PVD B;  3JCM b;  2C0I A;  1B34 B;  3OP0 A;  4M7A G;  3D7S B;  1S72 Q;  5EHP A;  5KH6 A;  2CKK A;  1WXU A;  3I35 A;  5FWB A;  4C92 D;  2QG9 B;  3UDC A;  4PFZ A;  3S8L A;  3VS1 A;  1O4C A;  3EG0 A;  4C0F A;  4GLK A;  4EDU A;  1FWZ A;  5I2M A;  1VQ8 A;  3VGO A;  2RHX A;  1VYU A;  1VYT A;  2RN8 A;  1NYG A;  4HT8 A;  3GNF B;  2VXE A;  4M75 B;  1VQ7 T;  1BFJ A;  2YHT A;  3A8G B;  5GMK l;  4E93 A;  1KQ1 A;  3PMT A;  4M7D A;  1H9O A;  3HRS A;  3JB9 D;  4C92 F;  2JNG A;  1TS9 A;  1KC8 U;  1UJ0 A;  3WXM B;  3VS6 A;  3SHW A;  1HD3 A;  3E2U A;  1MW4 A;  1NZL A;  1OPK A;  4QVD A;  2IUH A;  1ZSZ C;  4FSX A;  1H64 1;  4C8Q F;  1BHH A;  1WYX A;  2EJF A;  2PUO B;  1TZE E;  5GJI A;  2DXU A;  1PC0 A;  2O88 A;  4M7A D;  2OTJ T;  3M0U A;  2GCX A;  3DB4 A;  1B34 A;  1FXX A;  1VYV A;  5C0M A;  2LCC A;  2HBP A;  4OML A;  1GXI E;  3J81 E;  2EBP A;  3CC4 A;  2YUO A;  5GAO q;  2DZC A;  3L2R A;  4HVW A;  2COW A;  2CSQ A;  1PSF A;  1ZUK A;  3OYN A;  3G6E Q;  5IH2 A;  1YWO A;  5D6W A;  2RJD A;  1Y57 A;  3G1J A;  4M77 D;  4BDY A;  1W2B A;  1Y96 A;  2DD4 A;  1ARK A;  2YRV A;  1A81 A;  2CZ7 B;  3L2Q A;  3EGD A;  5KE3 A;  1LUN A;  4BAC A;  2NUT B;  4CC7 A;  3C4S A;  5DF6 A;  1M90 R;  4J7I A;  2LX9 A;  2DL5 A;  4M78 D;  3MP8 A;  4XTZ A;  1YIT A;  2YUP A;  4PNO A;  3VRO A;  2HUW A;  1ZSZ B;  1BB9 A;  3HL8 A;  2K5I A;  1G83 A;  1I1J A;  1QKX A;  3CCE Q;  2R5M A;  2YUN A;  4C92 B;  5GMK j;  2JOY A;  3N5B B;  4DQ2 A;  2VB6 A;  2CR4 A;  5CIU A;  4ZGJ B;  2HL3 A;  2FPE A;  4JJB A;  1M4Z A;  1NJI U;  4K2R A;  2O9S A;  2LJ0 A;  2SEM A;  3A1P A;  1NLO C;  3EH2 A;  4ELZ C;  1W1F A;  1ZQ1 A;  1PSE A;  2V1Q A;  1QW1 A;  3SFM A;  3VRY A;  4EMH A;  1BLK A;  1YP5 A;  1PG5 B;  2KEA A;  5LJ3 h;  2JM9 A; 
#chains in the Genus database with same CATH homology
 3VRN A;  1UHF A;  2SHP A;  2DBK A;  2LCS A;  2DBM A;  2AOB A;  4P9V A;  1N5Z A;  3ZNI A;  1GBR A;  2A28 A;  1M8M A;  2GQI A;  3M7F A;  1BM2 A;  2GGR A;  1X6B A;  3TSZ A;  1EFN A;  3H41 A;  1H8K A;  3H0H A;  1MUZ A;  3LH5 A;  2L3T A;  3I5R A;  2XMF A;  2RQU A;  1E6G A;  4LE9 A;  1A1B A;  1O47 A;  2K7A A;  2HDV A;  1FHS A;  1QWE A;  2KT8 A;  4ORZ A;  2EYW A;  1D4T A;  5I11 A;  1M3A A;  1AWW A;  2K79 A;  4CC2 A;  2NWM A;  4OHD A;  2RQV A;  2FG0 A;  3PSK A;  5IBM A;  2KK6 A;  1U3O A;  2EU0 A;  2FO0 A;  2CT3 A;  4JEG A;  4F5A A;  3EG3 A;  2DYB A;  1AWJ A;  2K9G A;  1JYQ A;  3TL0 A;  2J05 A;  4JE4 A;  5CDW A;  3MXC A;  2HDX A;  3HIZ B;  2JW4 A;  1SSH A;  1GRI A;  1ZUY A;  2CDT A;  2HCK A;  3GBQ A;  2CSI A;  2QMS A;  2JTE A;  5HKW A;  2Y1N A;  4FSS A;  2EGE A;  2EKX A;  4H1O A;  5DC9 A;  1KSW A;  4J9C A;  1OOT A;  2LNH B;  2DX1 A;  5I22 A;  1A08 A;  1BG1 A;  3RBB B;  1O4A A;  4X6S A;  1UTI A;  2VVK A;  2DL8 A;  2ED1 A;  2ESW A;  2V1R A;  1MIL A;  1WI7 A;  4K11 A;  4EIK A;  2RSY A;  1B47 A;  2F2X A;  2MK2 A;  1I0C A;  4X1V A;  1IJR A;  4NWF A;  4TZI A;  1OPL A;  1PIC A;  3TVT A;  1UHC A;  3R6N A;  4D8K A;  1KJW A;  2AZV A;  3QWX X;  2ECD A;  4CC4 B;  2G6F X;  2RPN A;  3KFV A;  3GXX A;  4AG2 C;  3N84 A;  2DLZ A;  2PZ1 A;  3TSW A;  2CI9 A;  2C9W A;  1SRL A;  1NG2 A;  2F2V A;  1BHF A;  1YWP A;  2HSP A;  1QCF A;  2W0Z A;  3PE0 A;  3RNJ A;  5GJH A;  4D8D A;  5BO4 A;  4GWF A;  2EOB A;  2K7A B;  4DGX A;  4CC3 A;  2L3Q A;  2ROL A;  4OHH A;  2YSQ A;  3MXY A;  5FW9 A;  4DEY A;  2LZ6 B;  3EHR A;  3UF4 A;  1KFZ A;  1H3H A;  1D1Z A;  2DLY A;  2CUB A;  1MV3 A;  1QAD A;  5EC7 A;  3OV1 A;  2OQ1 A;  4RTW A;  1OV3 A;  1UJY A;  3C0C A;  2DNU A;  5HKZ A;  2JMA A;  3S8O A;  2YUQ A;  1R1P A;  5AXI A;  1X6C A;  4H34 A;  1K0S A;  2EPD A;  2LNX A;  2VWF A;  2O9V A;  1WDX A;  1UDL A;  1GFC A;  2DRK A;  2ENM A;  4AFS C;  2M0Y A;  5HCK A;  3PSJ A;  4GL9 E;  1CJ1 A;  2FRW A;  2L4K A;  1O4F A;  3PVQ A;  1OO3 A;  1X2K A;  2GBQ A;  3VRZ A;  1WFW A;  1JU5 C;  1O49 A;  1XA6 A;  4J9E A;  3VS2 A;  1W70 A;  1GFD A;  1AD5 A;  4ZNX A;  5J3X A;  2IZV A;  2BTT A;  1BU1 A;  4RTV A;  4WCI A;  2D8H A;  1WQU A;  4FBN A;  4OMO A;  1RUW A;  2OAW A;  1I3Z A;  1LKK A;  2JXB A;  1BKL A;  3VS5 A;  2DM0 A;  3NGP A;  2KNO A;  3UYO A;  4OMP A;  1RI9 A;  1M27 A;  2D8J A;  4AG1 C;  3PJP A;  1GHU A;  1ABQ A;  2HDA A;  2KE9 A;  1SHB A;  2FPD A;  1QKW A;  3O5Z A;  4KRT A;  3NPF A;  4RTT A;  3VS7 A;  2EVR A;  2VIF A;  2Y3A B;  1CWD L;  3S8N A;  5EEQ A;  1YN8 A;  2AK5 A;  2BBU A;  4F16 A;  1AB2 A;  1FU5 A;  1T3L A;  2J6F A;  1X69 A;  1RPY A;  4XZ0 A;  1LCJ A;  1KA6 A;  1SKJ A;  1NRV A;  4E6R A;  3CD3 A;  1B07 A;  1SHG A;  3IN8 A;  1AYA A;  1HSQ A;  2EO3 A;  5FWC A;  1K9A A;  1O4P A;  3EAZ A;  4OMQ A;  2EYZ A;  1OO4 A;  4EIH A;  1UFF A;  1JEG A;  1BF5 A;  4QSY A;  1JYR A;  1O4J A;  3VS0 A;  2GSB A;  2IUG A;  1WXT A;  1M27 C;  2BZ8 A;  1WIE A;  2L6K A;  2EYY A;  2DVJ A;  2J06 A;  2M51 A;  1PHT A;  1T0H A;  2ECZ A;  2O2O A;  2JS2 A;  2EYX A;  2L0A A;  2CH4 A;  2KRO A;  1O4L A;  5EEL A;  4JJC A;  4HCK A;  3VRP A;  4ESR A;  1GCP A;  1SRM A;  2OI3 A;  3UA6 A;  3M0T A;  2EQI A;  2LP5 A;  2LQN A;  4JZ3 A;  1Z3K A;  1WXB A;  4J9G A;  4U1P A;  3WA4 A;  5EHR A;  1BHH B;  4HXJ A;  1ZLM A;  4K45 A;  2ETZ A;  5HKY A;  3PVL A;  4OHE A;  2PNI A;  1CKB A;  2FEI A;  4AFU C;  2CS0 A;  2DL4 A;  4LNP A;  3PFV A;  3THK A;  2A37 A;  4OHI A;  2DA9 A;  1F2F A;  3PQZ A;  2ED0 A;  1NZV A;  3CWG A;  5L23 A;  1BFI A;  2CRE A;  2FRY A;  2JS0 A;  2MOX A;  2L3P A;  1O46 A;  2DLP A;  2I0N A;  3C7I A;  3GXW A;  1NEB A;  2MC1 A;  1QLY A;  2GE9 A;  2DMO A;  3QWY A;  2YU7 A;  2BZY A;  4J9B A;  4Z88 A;  1RQQ C;  1Z9Q A;  2JYQ A;  1O48 A;  2FCI A;  2GNC A;  4A63 B;  1KA7 A;  2MRJ A;  1KIK A;  4HVU A;  1B3Q A;  2LX7 A;  1BKM A;  1O4K A;  2EW3 A;  1TUD A;  1CSK A;  1S1N A;  3EAC A;  4JGH A;  1NYF A;  1X27 A;  2KXD A;  4M4Z A;  3REB B;  1Y1U A;  4AFQ C;  4R0K A;  1GCQ A;  2L3S A;  1RLP C;  3EHQ A;  2EL8 A;  3IN7 A;  3CQT A;  1E6H A;  3SEM A;  3BUN B;  1V1C A;  2LQW A;  1A1E A;  2DM1 A;  2LNW A;  1A1A A;  1BLJ A;  2AOA A;  1M3B A;  1RLQ C;  3UA7 A;  1AEY A;  1CWE A;  4J9F A;  5AUL A;  4GBQ A;  3A98 A;  1O4G A;  2CUD A;  2KGT A;  1M61 A;  1T0J A;  2RMX A;  1U06 A;  3U23 A;  4IIO A;  2B3O A;  1O4E A;  3M0P A;  1UE9 A;  1J3T A;  2A36 A;  1OEB A;  1JXO A;  4DGP A;  1YNZ A;  2CT4 A;  1QWF A;  3H0F A;  4DEX A;  1A0N B;  1WA7 A;  1R1S A;  4RTZ A;  1T3S A;  2GTO A;  2MRK A;  1UUR A;  1E7O A;  3BUX B;  4L1B B;  1AOT F;  3M0R A;  1O42 A;  2AUG A;  4LUD A;  2YSX A;  4NWG A;  3REA B;  1D4W A;  1SHD A;  1A07 A;  5IHK A;  4A4B A;  2AKK A;  3IMD A;  4FL3 A;  3NMZ C;  1UUS A;  1TG0 A;  3EG2 A;  2BZX A;  1X43 A;  2K6D A;  2X3W D;  1A09 A;  1LKL A;  1SPR A;  1TCE A;  1PKT A;  2LMJ A;  1SEM A;  4GLM A;  3CBL A;  3I5S A;  4ROJ A;  1JU5 A;  1AYB A;  1O4H A;  2ROT A;  1O4O A;  4LN2 A;  2FPF A;  2HEQ A;  2F2W A;  1AZG B;  1X6G A;  1ZFP E;  2ROR A;  1PWT A;  5EG3 B;  2P4R A;  1Y0M A;  1YVH A;  1JO8 A;  2JT4 A;  1FBV A;  4JJD A;  2H5K A;  4E68 A;  2DF6 A;  1IO6 A;  2L2P A;  2EO6 A;  2E5K A;  2YDL A;  1O41 A;  3N8M A;  4EY0 A;  2XP1 A;  3IQL A;  2SRC A;  1ZX6 A;  4QT7 A;  1O4B A;  2B86 A;  2MIO A;  2PNB A;  1KC2 A;  4F17 A;  2C0I A;  1P13 A;  1X0N A;  3FJ5 A;  4LUE A;  1YVL A;  3OP0 A;  4J9D A;  4RTX A;  1R1Q A;  2EYV A;  2PNA A;  2HBW A;  1HCT B;  2RMO A;  2DL7 A;  4F14 A;  1UGV A;  4J9I A;  5EHP A;  1AYC A;  1CSZ A;  1PNJ A;  1A1C A;  3EG1 A;  1GBQ A;  1AWO A;  2MQI A;  3TKZ A;  4JPB W;  5GJV B;  4U17 A;  1WXU A;  3I35 A;  5FWB A;  1O4N A;  2KR3 A;  3NHN A;  3S8L A;  1PKS A;  3VS1 A;  1O4C A;  1XOV A;  3EG0 A;  1JWO A;  1O4D A;  1QG1 E;  2KRN A;  1I07 A;  1SHF A;  1TUC A;  1BMB A;  3OB2 B;  3VGO A;  3BUM B;  2KRS A;  3I9Q A;  2C0O A;  3ULR B;  3IMJ A;  1HJD A;  1UUE A;  3PLF B;  5DC4 A;  1VYU A;  1VYT A;  2RN8 A;  2DL3 A;  2PTK A;  3VRQ A;  3UAT A;  1NYG A;  1WLP B;  2AZS A;  5D0J A;  4F5B A;  1O44 A;  2J7I A;  3VS3 A;  3M0Q A;  1X2Q A;  1BFJ A;  2RQW A;  1FYR A;  2KRM A;  3ZL7 C;  5DC0 B;  1JXM A;  5KAZ A;  4JZ4 A;  2YT6 A;  1FU6 A;  2RF0 A;  2LCT A;  4E93 A;  2PLE A;  1H9O A;  2AKL A;  4WWQ A;  1AWX A;  1AZE A;  3MAZ A;  1FYN A;  1Z9Z A;  4J9H A;  1M3C A;  1UJ0 A;  2IUI A;  3VS6 A;  2H46 E;  1NEG A;  2C0T A;  1LCK A;  1FBZ A;  1CSY A;  2X3X D;  3SHW A;  3BUW B;  1HD3 A;  1MW4 A;  3JV3 A;  1NZL A;  1OPK A;  4HVV A;  1BBZ A;  1K76 A;  5IHN A;  1O4Q A;  4Y92 A;  1SPK A;  1SHA A;  1FMK A;  2IUH A;  2H8H A;  3H0I A;  3VRR A;  2EGC A;  2KYM A;  1G2B A;  3N7Y A;  3VS4 A;  5IXF A;  1BHH A;  1WYX A;  1K0X A;  2GTJ A;  2RQR A;  1TZE E;  5GJI A;  1O45 A;  2O88 A;  2CH4 W;  2KYB A;  3M0U A;  1NLP C;  2MCN A;  4XZ1 A;  2RQT A;  4RUG A;  1SPS A;  3OB1 B;  2K79 B;  1VYV A;  2KXC A;  2DIL A;  4OML A;  2Y1M A;  1LUI A;  2EBP A;  1WX6 A;  2YUO A;  1ZSG A;  1K1Z A;  4OMM A;  2J6K A;  5ECA A;  1HCS B;  4HVW A;  1LUK A;  2CSQ A;  1BK2 A;  2DE0 X;  1ZUK A;  3CXL A;  1JQQ A;  2QDL A;  1F1W A;  5IH2 A;  2HMH A;  1YWO A;  3OVE A;  2IIM A;  1AYD A;  3GQI B;  5IBS A;  2LJ3 A;  1Y57 A;  4RTU A;  2PLD A;  3S9K A;  1M30 A;  2JMC A;  2OZO A;  3US4 A;  3PS5 A;  1CKA A;  2CI8 A;  4AFZ C;  3EGU A;  1O4I A;  2DJQ A;  2KT1 A;  1ARK A;  1A81 A;  3BKB A;  2W10 A;  4RTY A;  2CRH A;  2OJ2 A;  4F59 A;  2DX0 A;  1GCQ C;  4OMN A;  2A08 A;  1NM7 A;  2ABL A;  5IXB A;  1AOJ A;  1LUN A;  2D1X A;  4CC7 A;  5DF6 A;  4OHL A;  1AVZ C;  1AOU F;  1ZBJ A;  2DL5 A;  2J6O A;  1VA7 A;  2KBT A;  3VRO A;  2YUP A;  2EKH A;  1W6X A;  1U5S A;  4A4C A;  1IS0 A;  2DRM A;  5I6V A;  1K4U S;  2HUW A;  5GJW B;  1BB9 A;  3HCK A;  4GPL B;  1LUM A;  2CBL A;  2LJ1 A;  2O31 A;  2KNB B;  2VKN A;  1ABO A;  1G83 A;  3HHM B;  3K2M A;  1I1J A;  1QKX A;  4FL2 A;  4Z89 A;  1PRL C;  2JM8 A;  4IIM A;  2YUN A;  2D0N A;  1ZUU A;  3M0S A;  1UG1 A;  2CR4 A;  1GL5 A;  2FPE A;  2K3B A;  2NUZ A;  2CIA A;  4P9Z A;  2EGA A;  1JYU A;  1H92 A;  1RJA A;  2K2M A;  4JJB A;  4K2R A;  4K44 A;  2O9S A;  2LJ0 A;  2SEM A;  3T04 A;  4Z8A A;  1NLO C;  1PRM C;  1O4R A;  1W1F A;  2V1Q A;  2RVF A;  3VRY A;  3BUO B;  5IHI A;  2RNA A;  1YCS B;  1O43 A;  2DCR A;  1YP5 A;  1BLK A;  1UEC A;  3KFJ A;  1O4M A;  1MV0 B;  2KEA A;  2JM9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...