1JYUA

Xray structure of grb2 sh2 domain
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
96
structure length
96
Chain Sequence
GSMAWFFGKIPRAKAEEMLSKQRHDGAFLIRESESAPGDFSLSVKFGNDVQHFKVLRDGAGKYFLWVVKFNSLNELVDYHRSTSVSRNQQIFLRDI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GROWTH FACTOR RECEPTOR-BOUND PROTEIN 2
publication title Crystal structures of the SH2 domain of Grb2: highlight on the binding of a new high-affinity inhibitor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 17
structure length 96
sequence length 96
ec nomenclature
pdb deposition date 2001-09-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00017 SH2 SH2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.505.10 Alpha Beta 2-Layer Sandwich SHC Adaptor Protein SH2 domain 1jyuA00
1FU6A 4EIHA 2RSYA 3N84A 1WQUA 1A08A 1O4EA 3C7IA 1X27A 3OVEA 1BM2A 1B47A 1O46A 3PQZA 1HCSB 4A4CA 2EYVA 1AD5A 1JWOA 1O4RA 2HDVA 1KSWA 5I6VA 2ABLA 3PSJA 2DVJA 2DX0A 5EELA 2ETZA 4QSYA 1BHHA 2GSBA 3QWXX 3CBLA 3GXWA 5HKWA 1Y57A 1D1ZA 1D4TA 1QCFA 2IZVA 2CR4A 2PTKA 3VRPA 2MC1A 2HCKA 3CD3A 3CXLA 2H8HA 5CDWA 2HUWA 4GPLB 1A1BA 2XP1A 1BLKA 1AYDA 5BO4A 1FMKA 3IN7A 1SPSA 4E68A 3HCKA 1X0NA 2H46E 2RVFA 3IMJA 1UUSA 2MRKA 1SHBA 3MAZA 1X6CA 2B3OA 1FU5A 1I3ZA 2CS0A 3N7YA 4JGHA 1MW4A 1A1AA 1FBZA 2EKXA 1Y1UA 3VRRA 1O49A 1RQQC 2OZOA 1CWEA 1AOTF 1LKLA 1M61A 3PSKA 1R1QA 1O4JA 3VS6A 1R1PA 1O4HA 5IBSA 1IS0A 3QWYA 1O4AA 3M7FA 3PJPA 2FCIA 1O4FA 4P9VA 1O4QA 1BG1A 3N8MA 1CWDL 4DGPA 2Y3AB 3T04A 1AYBA 2K79B 3NHNA 3PFVA 2OQ1A 1O4KA 4XZ1A 4K45A 2IUGA 1F1WA 2H5KA 5EEQA 3UF4A 1D4WA 3HHMB 3VS3A 4P9ZA 2PNBA 2LQNA 1IJRA 1MILA 1ZFPE 1JU5A 3OP0A 5IBMA 2EO3A 1LCKA 1A1EA 3PLFB 2MK2A 1F2FA 2LQWA 1R1SA 4TZIA 3OB2B 1O45A 4F59A 1CSZA 1O4DA 1A81A 5GJHA 1FYRA 2RORA 5D0JA 2SHPA 2SRCA 1LUIA 2AOAA 2ECDA 1OPLA 2Y1NA 1RPYA 3K2MA 2C0OA 2CIAA 5DF6A 3BUMB 4FBNA 3VRYA 4D8KA 2LNXA 1PICA 5EHRA 1BMBA 1O4PA 3VRNA 1O4NA 5DC0B 1AOUF 3VS5A 3ZNIA 1JYUA 2C9WA 1XA6A 2PLEA 1A09A 2MRJA 1KC2A 1O44A 4GWFA 3TKZA 3BUWB 1LUNA 1LUKA 1O4BA 2PNAA 3VROA 1H9OA 3US4A 1CJ1A 5J3XA 1OO3A 2C0TA 1BKMA 2DLYA 4DGXA 4OHEA 2YSXA 4XZ0A 3EAZA 1TZEE 2C0IA 1O47A 3S8NA 1O4LA 4OHIA 5KAZA 3OV1A 1O4OA 2Y1MA 4F5BA 1NZLA 1O43A 1FHSA 3IMDA 4ROJA 3VS2A 2AOBA 2LNWA 2YU7A 2HDXA 5DC4A 4F5AA 4K11A 1Z3KA 3BKBA 2BBUA 1O4CA 4OHLA 1AYAA 2JYQA 2DM0A 1NZVA 5EG3B 3VS4A 5AXIA 3VRQA 1YVLA 4OHHA 2EYYA 3PS5A 2CRHA 4K44A 3MXYA 4K2RA 2KNOA 1QG1E 3S8LA 1O41A 3EACA 1P13A 1FBVA 3BUNB 1HCTB 1UURA 2MQIA 2L4KA 2EU0A 4U17A 1A07A 2DCRA 1SKJA 2FO0A 3CWGA 3VRZA 1A1CA 3IN8A 5DC9A 4A4BA 4H1OA 2PLDA 1YVHA 3WA4A 3S9KA 1SHAA 2CI8A 1M27A 1BLJA 4X6SA 2DLZA 3TL0A 4GL9E 1GHUA 2EOBA 2L6KA 4OHDA 1KA7A 1KA6A 1O4IA 1JYQA 1AYCA 4JEGA 3HIZB 5HKYA 2RMXA 2VIFA 3OB1B 1BHFA 3BUXB 4JE4A 1BFJA 1GRIA 1CSYA 1O42A 4LUEA 1QADA 1K9AA 3VS0A 1JYRA 1TCEA 3KFJA 2EO6A 4WWQA 5GJIA 4H34A 1OPKA 4FL3A 4EY0A 3MXCA 3VS1A 1BKLA 2CI9A 1SPRA 1BF5A 4NWGA 1OO4A 4L1BB 1NRVA 2EL8A 2GE9A 5HKZA 2HMHA 3UYOA 5AULA 1G83A 2EYZA 4FL2A 2LCTA 5EHPA 1LUMA 3GQIB 1O4MA 4E93A 2AUGA 1LKKA 2K7AB 4M4ZA 1LCJA 4LUDA 1BFIA 3VGOA 1O4GA 1BHHB 4U1PA 1SHDA 2IUIA 2IUHA 2CBLA 2KK6A 3VS7A 3BUOB 1AB2A 4NWFA 3S8OA 2QMSA 3GXXA 1RJAA 1O48A 2L3TA
chains in the Genus database with same CATH superfamily
1FU6A 4EIHA 2RSYA 3N84A 1WQUA 1A08A 1O4EA 3C7IA 1X27A 3OVEA 1BM2A 1B47A 1O46A 3PQZA 1HCSB 4A4CA 2EYVA 1AD5A 1JWOA 1O4RA 2HDVA 1KSWA 5I6VA 2ABLA 3PSJA 2DVJA 2DX0A 5EELA 2ETZA 4QSYA 1BHHA 2GSBA 3QWXX 3CBLA 3GXWA 5HKWA 1Y57A 1D1ZA 1D4TA 1QCFA 2IZVA 2LRAA 2CR4A 2PTKA 3VRPA 2MC1A 2HCKA 3CD3A 3CXLA 2H8HA 5CDWA 2HUWA 4GPLB 1A1BA 2XP1A 1BLKA 1AYDA 5BO4A 1FMKA 3IN7A 1SPSA 4E68A 3HCKA 1X0NA 2H46E 2RVFA 3IMJA 1UUSA 2MRKA 1SHBA 3MAZA 1X6CA 2B3OA 1FU5A 1I3ZA 2CS0A 3N7YA 4JGHA 1MW4A 1A1AA 1FBZA 2EKXA 1Y1UA 3VRRA 1O49A 1RQQC 2OZOA 1CWEA 1AOTF 1LKLA 1M61A 3PSKA 1R1QA 1O4JA 3VS6A 1R1PA 1O4HA 5IBSA 1IS0A 3QWYA 1O4AA 3M7FA 3PJPA 2FCIA 1O4FA 4P9VA 1O4QA 1BG1A 3N8MA 1CWDL 4DGPA 2Y3AB 3T04A 1AYBA 2K79B 3NHNA 3PFVA 2OQ1A 1O4KA 4XZ1A 4K45A 2IUGA 1F1WA 2H5KA 5EEQA 3UF4A 1D4WA 3HHMB 3VS3A 4P9ZA 2PNBA 3K2TA 2LQNA 1IJRA 1MILA 1ZFPE 1JU5A 3OP0A 5IBMA 2EO3A 1LCKA 1A1EA 3PLFB 2MK2A 1F2FA 2LQWA 1R1SA 4TZIA 3OB2B 1O45A 4F59A 1CSZA 1O4DA 1A81A 5GJHA 1FYRA 2RORA 5D0JA 2SHPA 2SRCA 1LUIA 2AOAA 2ECDA 1OPLA 2Y1NA 1RPYA 3K2MA 2C0OA 2CIAA 5DF6A 3BUMB 4FBNA 3VRYA 4D8KA 2LNXA 1PICA 5EHRA 1BMBA 1O4PA 3VRNA 1O4NA 5DC0B 1AOUF 3VS5A 3ZNIA 1JYUA 2C9WA 1XA6A 2PLEA 1A09A 2MRJA 1KC2A 1O44A 4GWFA 3TKZA 3BUWB 1LUNA 1LUKA 1O4BA 2PNAA 3VROA 1H9OA 3US4A 1CJ1A 5J3XA 1OO3A 2C0TA 1BKMA 2DLYA 4DGXA 4OHEA 2YSXA 4XZ0A 3EAZA 1TZEE 2C0IA 1O47A 3S8NA 1O4LA 4OHIA 5KAZA 3OV1A 1O4OA 2Y1MA 4F5BA 1NZLA 1O43A 1FHSA 3IMDA 4ROJA 3VS2A 2AOBA 2LNWA 2YU7A 2HDXA 5DC4A 2KGYA 4F5AA 4K11A 1Z3KA 3BKBA 2BBUA 1O4CA 4OHLA 1AYAA 2JYQA 2DM0A 1NZVA 5EG3B 3VS4A 5AXIA 3VRQA 1YVLA 4OHHA 2EYYA 3PS5A 2CRHA 4K44A 3MXYA 4K2RA 3LYVA 2KNOA 1QG1E 3S8LA 1O41A 3EACA 1P13A 1FBVA 3BUNB 1HCTB 1UURA 2MQIA 2L4KA 2EU0A 4U17A 1A07A 2DCRA 1SKJA 2FO0A 3CWGA 3VRZA 1A1CA 3IN8A 5DC9A 4A4BA 4H1OA 2PLDA 1YVHA 3WA4A 3S9KA 1SHAA 2CI8A 1M27A 1BLJA 4X6SA 2DLZA 3TL0A 4GL9E 1GHUA 2EOBA 2L6KA 4OHDA 1KA7A 1KA6A 1O4IA 1JYQA 1AYCA 4JEGA 3HIZB 5HKYA 2RMXA 2VIFA 3OB1B 1BHFA 3BUXB 4JE4A 1BFJA 1GRIA 1CSYA 1O42A 4LUEA 1QADA 1K9AA 3VS0A 1JYRA 1TCEA 3KFJA 2EO6A 4WWQA 5GJIA 4H34A 1OPKA 4FL3A 4EY0A 3MXCA 3VS1A 1BKLA 2CI9A 1SPRA 1BF5A 4NWGA 1OO4A 4L1BB 1NRVA 2EL8A 2GE9A 5HKZA 2HMHA 3UYOA 5AULA 1G83A 2EYZA 4FL2A 2LCTA 5EHPA 1LUMA 3GQIB 1O4MA 4E93A 2AUGA 1LKKA 2K7AB 4M4ZA 1LCJA 4LUDA 1BFIA 3VGOA 1O4GA 1BHHB 4U1PA 1SHDA 2IUIA 2IUHA 2CBLA 2KK6A 3VS7A 3BUOB 1AB2A 4NWFA 3S8OA 2QMSA 3GXXA 1RJAA 1O48A 2L3TA
chains in the Genus database with same CATH topology
1FU6A 4EIHA 2RSYA 3N84A 1WQUA 1A08A 1O4EA 3C7IA 1X27A 3OVEA 1BM2A 1B47A 1O46A 3PQZA 1HCSB 4A4CA 2EYVA 1AD5A 1JWOA 1O4RA 2HDVA 1KSWA 5I6VA 2ABLA 3PSJA 2DVJA 2DX0A 5EELA 2ETZA 4QSYA 1BHHA 2GSBA 3QWXX 3CBLA 3GXWA 5HKWA 1Y57A 1D1ZA 1D4TA 1QCFA 2IZVA 2CR4A 2PTKA 3VRPA 2MC1A 2HCKA 3CD3A 3CXLA 2H8HA 5CDWA 2HUWA 4GPLB 1A1BA 2XP1A 1BLKA 1AYDA 5BO4A 1FMKA 3IN7A 1SPSA 4E68A 3HCKA 1X0NA 2H46E 2RVFA 3IMJA 1UUSA 2MRKA 1SHBA 3MAZA 1X6CA 2B3OA 1FU5A 1I3ZA 2CS0A 3N7YA 4JGHA 1MW4A 1A1AA 1FBZA 2EKXA 1Y1UA 3VRRA 1O49A 1RQQC 2OZOA 1CWEA 1AOTF 1LKLA 1M61A 3PSKA 1R1QA 1O4JA 3VS6A 1R1PA 1O4HA 5IBSA 1IS0A 3QWYA 1O4AA 3M7FA 3PJPA 2FCIA 1O4FA 4P9VA 1O4QA 1BG1A 3N8MA 1CWDL 4DGPA 2Y3AB 3T04A 1AYBA 2K79B 3NHNA 3PFVA 2OQ1A 1O4KA 4XZ1A 4K45A 2IUGA 1F1WA 2H5KA 5EEQA 3UF4A 1D4WA 3HHMB 3VS3A 4P9ZA 2PNBA 2LQNA 1IJRA 1MILA 1ZFPE 1JU5A 3OP0A 5IBMA 2EO3A 1LCKA 1A1EA 3PLFB 2MK2A 1F2FA 2LQWA 1R1SA 4TZIA 3OB2B 1O45A 4F59A 1CSZA 1O4DA 1A81A 5GJHA 1FYRA 2RORA 5D0JA 2SHPA 2SRCA 1LUIA 2AOAA 2ECDA 1OPLA 2Y1NA 1RPYA 3K2MA 2C0OA 2CIAA 5DF6A 3BUMB 4FBNA 3VRYA 4D8KA 2LNXA 1PICA 5EHRA 1BMBA 1O4PA 3VRNA 1O4NA 5DC0B 1AOUF 3VS5A 3ZNIA 1JYUA 2C9WA 1XA6A 2PLEA 1A09A 2MRJA 1KC2A 1O44A 4GWFA 3TKZA 3BUWB 1LUNA 1LUKA 1O4BA 2PNAA 3VROA 1H9OA 3US4A 1CJ1A 5J3XA 1OO3A 2C0TA 1BKMA 2DLYA 4DGXA 4OHEA 2YSXA 4XZ0A 3EAZA 1TZEE 2C0IA 1O47A 3S8NA 1O4LA 4OHIA 5KAZA 3OV1A 1O4OA 2Y1MA 4F5BA 1NZLA 1O43A 1FHSA 3IMDA 4ROJA 3VS2A 2AOBA 2LNWA 2YU7A 2HDXA 5DC4A 4F5AA 4K11A 1Z3KA 3BKBA 2BBUA 1O4CA 4OHLA 1AYAA 2JYQA 2DM0A 1NZVA 5EG3B 3VS4A 5AXIA 3VRQA 1YVLA 4OHHA 2EYYA 3PS5A 2CRHA 4K44A 3MXYA 4K2RA 2KNOA 1QG1E 3S8LA 1O41A 3EACA 1P13A 1FBVA 3BUNB 1HCTB 1UURA 2MQIA 2L4KA 2EU0A 4U17A 1A07A 2DCRA 1SKJA 2FO0A 3CWGA 3VRZA 1A1CA 3IN8A 5DC9A 4A4BA 4H1OA 2PLDA 1YVHA 3WA4A 3S9KA 1SHAA 2CI8A 1M27A 1BLJA 4X6SA 2DLZA 3TL0A 4GL9E 1GHUA 2EOBA 2L6KA 4OHDA 1KA7A 1KA6A 1O4IA 1JYQA 1AYCA 4JEGA 3HIZB 5HKYA 2RMXA 2VIFA 3OB1B 1BHFA 3BUXB 4JE4A 1BFJA 1GRIA 1CSYA 1O42A 4LUEA 1QADA 1K9AA 3VS0A 1JYRA 1TCEA 3KFJA 2EO6A 4WWQA 5GJIA 4H34A 1OPKA 4FL3A 4EY0A 3MXCA 3VS1A 1BKLA 2CI9A 1SPRA 1BF5A 4NWGA 1OO4A 4L1BB 1NRVA 2EL8A 2GE9A 5HKZA 2HMHA 3UYOA 5AULA 1G83A 2EYZA 4FL2A 2LCTA 5EHPA 1LUMA 3GQIB 1O4MA 4E93A 2AUGA 1LKKA 2K7AB 4M4ZA 1LCJA 4LUDA 1BFIA 3VGOA 1O4GA 1BHHB 4U1PA 1SHDA 2IUIA 2IUHA 2CBLA 2KK6A 3VS7A 3BUOB 1AB2A 4NWFA 3S8OA 2QMSA 3GXXA 1RJAA 1O48A 2L3TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FU6 A;  4EIH A;  2RSY A;  3N84 A;  1WQU A;  1A08 A;  1O4E A;  3C7I A;  1X27 A;  3OVE A;  1BM2 A;  1B47 A;  1O46 A;  3PQZ A;  1HCS B;  4A4C A;  2EYV A;  1AD5 A;  1JWO A;  1O4R A;  2HDV A;  1KSW A;  5I6V A;  2ABL A;  3PSJ A;  2DVJ A;  2DX0 A;  5EEL A;  2ETZ A;  4QSY A;  1BHH A;  2GSB A;  3QWX X;  3CBL A;  3GXW A;  5HKW A;  1Y57 A;  1D1Z A;  1D4T A;  1QCF A;  2IZV A;  2CR4 A;  2PTK A;  3VRP A;  2MC1 A;  2HCK A;  3CD3 A;  3CXL A;  2H8H A;  5CDW A;  2HUW A;  4GPL B;  1A1B A;  2XP1 A;  1BLK A;  1AYD A;  5BO4 A;  1FMK A;  3IN7 A;  1SPS A;  4E68 A;  3HCK A;  1X0N A;  2H46 E;  2RVF A;  3IMJ A;  1UUS A;  2MRK A;  1SHB A;  3MAZ A;  1X6C A;  2B3O A;  1FU5 A;  1I3Z A;  2CS0 A;  3N7Y A;  4JGH A;  1MW4 A;  1A1A A;  1FBZ A;  2EKX A;  1Y1U A;  3VRR A;  1O49 A;  1RQQ C;  2OZO A;  1CWE A;  1AOT F;  1LKL A;  1M61 A;  3PSK A;  1R1Q A;  1O4J A;  3VS6 A;  1R1P A;  1O4H A;  5IBS A;  1IS0 A;  3QWY A;  1O4A A;  3M7F A;  3PJP A;  2FCI A;  1O4F A;  4P9V A;  1O4Q A;  1BG1 A;  3N8M A;  1CWD L;  4DGP A;  2Y3A B;  3T04 A;  1AYB A;  2K79 B;  3NHN A;  3PFV A;  2OQ1 A;  1O4K A;  4XZ1 A;  4K45 A;  2IUG A;  1F1W A;  2H5K A;  5EEQ A;  3UF4 A;  1D4W A;  3HHM B;  3VS3 A;  4P9Z A;  2PNB A;  2LQN A;  1IJR A;  1MIL A;  1ZFP E;  1JU5 A;  3OP0 A;  5IBM A;  2EO3 A;  1LCK A;  1A1E A;  3PLF B;  2MK2 A;  1F2F A;  2LQW A;  1R1S A;  4TZI A;  3OB2 B;  1O45 A;  4F59 A;  1CSZ A;  1O4D A;  1A81 A;  5GJH A;  1FYR A;  2ROR A;  5D0J A;  2SHP A;  2SRC A;  1LUI A;  2AOA A;  2ECD A;  1OPL A;  2Y1N A;  1RPY A;  3K2M A;  2C0O A;  2CIA A;  5DF6 A;  3BUM B;  4FBN A;  3VRY A;  4D8K A;  2LNX A;  1PIC A;  5EHR A;  1BMB A;  1O4P A;  3VRN A;  1O4N A;  5DC0 B;  1AOU F;  3VS5 A;  3ZNI A;  1JYU A;  2C9W A;  1XA6 A;  2PLE A;  1A09 A;  2MRJ A;  1KC2 A;  1O44 A;  4GWF A;  3TKZ A;  3BUW B;  1LUN A;  1LUK A;  1O4B A;  2PNA A;  3VRO A;  1H9O A;  3US4 A;  1CJ1 A;  5J3X A;  1OO3 A;  2C0T A;  1BKM A;  2DLY A;  4DGX A;  4OHE A;  2YSX A;  4XZ0 A;  3EAZ A;  1TZE E;  2C0I A;  1O47 A;  3S8N A;  1O4L A;  4OHI A;  5KAZ A;  3OV1 A;  1O4O A;  2Y1M A;  4F5B A;  1NZL A;  1O43 A;  1FHS A;  3IMD A;  4ROJ A;  3VS2 A;  2AOB A;  2LNW A;  2YU7 A;  2HDX A;  5DC4 A;  4F5A A;  4K11 A;  1Z3K A;  3BKB A;  2BBU A;  1O4C A;  4OHL A;  1AYA A;  2JYQ A;  2DM0 A;  1NZV A;  5EG3 B;  3VS4 A;  5AXI A;  3VRQ A;  1YVL A;  4OHH A;  2EYY A;  3PS5 A;  2CRH A;  4K44 A;  3MXY A;  4K2R A;  2KNO A;  1QG1 E;  3S8L A;  1O41 A;  3EAC A;  1P13 A;  1FBV A;  3BUN B;  1HCT B;  1UUR A;  2MQI A;  2L4K A;  2EU0 A;  4U17 A;  1A07 A;  2DCR A;  1SKJ A;  2FO0 A;  3CWG A;  3VRZ A;  1A1C A;  3IN8 A;  5DC9 A;  4A4B A;  4H1O A;  2PLD A;  1YVH A;  3WA4 A;  3S9K A;  1SHA A;  2CI8 A;  1M27 A;  1BLJ A;  4X6S A;  2DLZ A;  3TL0 A;  4GL9 E;  1GHU A;  2EOB A;  2L6K A;  4OHD A;  1KA7 A;  1KA6 A;  1O4I A;  1JYQ A;  1AYC A;  4JEG A;  3HIZ B;  5HKY A;  2RMX A;  2VIF A;  3OB1 B;  1BHF A;  3BUX B;  4JE4 A;  1BFJ A;  1GRI A;  1CSY A;  1O42 A;  4LUE A;  1QAD A;  1K9A A;  3VS0 A;  1JYR A;  1TCE A;  3KFJ A;  2EO6 A;  4WWQ A;  5GJI A;  4H34 A;  1OPK A;  4FL3 A;  4EY0 A;  3MXC A;  3VS1 A;  1BKL A;  2CI9 A;  1SPR A;  1BF5 A;  4NWG A;  1OO4 A;  4L1B B;  1NRV A;  2EL8 A;  2GE9 A;  5HKZ A;  2HMH A;  3UYO A;  5AUL A;  1G83 A;  2EYZ A;  4FL2 A;  2LCT A;  5EHP A;  1LUM A;  3GQI B;  1O4M A;  4E93 A;  2AUG A;  1LKK A;  2K7A B;  4M4Z A;  1LCJ A;  4LUD A;  1BFI A;  3VGO A;  1O4G A;  1BHH B;  4U1P A;  1SHD A;  2IUI A;  2IUH A;  2CBL A;  2KK6 A;  3VS7 A;  3BUO B;  1AB2 A;  4NWF A;  3S8O A;  2QMS A;  3GXX A;  1RJA A;  1O48 A;  2L3T A; 
#chains in the Genus database with same CATH topology
 1FU6 A;  4EIH A;  2RSY A;  3N84 A;  1WQU A;  1A08 A;  1O4E A;  3C7I A;  1X27 A;  3OVE A;  1BM2 A;  1B47 A;  1O46 A;  3PQZ A;  1HCS B;  4A4C A;  2EYV A;  1AD5 A;  1JWO A;  1O4R A;  2HDV A;  1KSW A;  5I6V A;  2ABL A;  3PSJ A;  2DVJ A;  2DX0 A;  5EEL A;  2ETZ A;  4QSY A;  1BHH A;  2GSB A;  3QWX X;  3CBL A;  3GXW A;  5HKW A;  1Y57 A;  1D1Z A;  1D4T A;  1QCF A;  2IZV A;  2LRA A;  2CR4 A;  2PTK A;  3VRP A;  2MC1 A;  2HCK A;  3CD3 A;  3CXL A;  2H8H A;  5CDW A;  2HUW A;  4GPL B;  1A1B A;  2XP1 A;  1BLK A;  1AYD A;  5BO4 A;  1FMK A;  3IN7 A;  1SPS A;  4E68 A;  3HCK A;  1X0N A;  2H46 E;  2RVF A;  3IMJ A;  1UUS A;  2MRK A;  1SHB A;  3MAZ A;  1X6C A;  2B3O A;  1FU5 A;  1I3Z A;  2CS0 A;  3N7Y A;  4JGH A;  1MW4 A;  1A1A A;  1FBZ A;  2EKX A;  1Y1U A;  3VRR A;  1O49 A;  1RQQ C;  2OZO A;  1CWE A;  1AOT F;  1LKL A;  1M61 A;  3PSK A;  1R1Q A;  1O4J A;  3VS6 A;  1R1P A;  1O4H A;  5IBS A;  1IS0 A;  3QWY A;  1O4A A;  3M7F A;  3PJP A;  2FCI A;  1O4F A;  4P9V A;  1O4Q A;  1BG1 A;  3N8M A;  1CWD L;  4DGP A;  2Y3A B;  3T04 A;  1AYB A;  2K79 B;  3NHN A;  3PFV A;  2OQ1 A;  1O4K A;  4XZ1 A;  4K45 A;  2IUG A;  1F1W A;  2H5K A;  5EEQ A;  3UF4 A;  1D4W A;  3HHM B;  3VS3 A;  4P9Z A;  2PNB A;  3K2T A;  2LQN A;  1IJR A;  1MIL A;  1ZFP E;  1JU5 A;  3OP0 A;  5IBM A;  2EO3 A;  1LCK A;  1A1E A;  3PLF B;  2MK2 A;  1F2F A;  2LQW A;  1R1S A;  4TZI A;  3OB2 B;  1O45 A;  4F59 A;  1CSZ A;  1O4D A;  1A81 A;  5GJH A;  1FYR A;  2ROR A;  5D0J A;  2SHP A;  2SRC A;  1LUI A;  2AOA A;  2ECD A;  1OPL A;  2Y1N A;  1RPY A;  3K2M A;  2C0O A;  2CIA A;  5DF6 A;  3BUM B;  4FBN A;  3VRY A;  4D8K A;  2LNX A;  1PIC A;  5EHR A;  1BMB A;  1O4P A;  3VRN A;  1O4N A;  5DC0 B;  1AOU F;  3VS5 A;  3ZNI A;  1JYU A;  2C9W A;  1XA6 A;  2PLE A;  1A09 A;  2MRJ A;  1KC2 A;  1O44 A;  4GWF A;  3TKZ A;  3BUW B;  1LUN A;  1LUK A;  1O4B A;  2PNA A;  3VRO A;  1H9O A;  3US4 A;  1CJ1 A;  5J3X A;  1OO3 A;  2C0T A;  1BKM A;  2DLY A;  4DGX A;  4OHE A;  2YSX A;  4XZ0 A;  3EAZ A;  1TZE E;  2C0I A;  1O47 A;  3S8N A;  1O4L A;  4OHI A;  5KAZ A;  3OV1 A;  1O4O A;  2Y1M A;  4F5B A;  1NZL A;  1O43 A;  1FHS A;  3IMD A;  4ROJ A;  3VS2 A;  2AOB A;  2LNW A;  2YU7 A;  2HDX A;  5DC4 A;  2KGY A;  4F5A A;  4K11 A;  1Z3K A;  3BKB A;  2BBU A;  1O4C A;  4OHL A;  1AYA A;  2JYQ A;  2DM0 A;  1NZV A;  5EG3 B;  3VS4 A;  5AXI A;  3VRQ A;  1YVL A;  4OHH A;  2EYY A;  3PS5 A;  2CRH A;  4K44 A;  3MXY A;  4K2R A;  3LYV A;  2KNO A;  1QG1 E;  3S8L A;  1O41 A;  3EAC A;  1P13 A;  1FBV A;  3BUN B;  1HCT B;  1UUR A;  2MQI A;  2L4K A;  2EU0 A;  4U17 A;  1A07 A;  2DCR A;  1SKJ A;  2FO0 A;  3CWG A;  3VRZ A;  1A1C A;  3IN8 A;  5DC9 A;  4A4B A;  4H1O A;  2PLD A;  1YVH A;  3WA4 A;  3S9K A;  1SHA A;  2CI8 A;  1M27 A;  1BLJ A;  4X6S A;  2DLZ A;  3TL0 A;  4GL9 E;  1GHU A;  2EOB A;  2L6K A;  4OHD A;  1KA7 A;  1KA6 A;  1O4I A;  1JYQ A;  1AYC A;  4JEG A;  3HIZ B;  5HKY A;  2RMX A;  2VIF A;  3OB1 B;  1BHF A;  3BUX B;  4JE4 A;  1BFJ A;  1GRI A;  1CSY A;  1O42 A;  4LUE A;  1QAD A;  1K9A A;  3VS0 A;  1JYR A;  1TCE A;  3KFJ A;  2EO6 A;  4WWQ A;  5GJI A;  4H34 A;  1OPK A;  4FL3 A;  4EY0 A;  3MXC A;  3VS1 A;  1BKL A;  2CI9 A;  1SPR A;  1BF5 A;  4NWG A;  1OO4 A;  4L1B B;  1NRV A;  2EL8 A;  2GE9 A;  5HKZ A;  2HMH A;  3UYO A;  5AUL A;  1G83 A;  2EYZ A;  4FL2 A;  2LCT A;  5EHP A;  1LUM A;  3GQI B;  1O4M A;  4E93 A;  2AUG A;  1LKK A;  2K7A B;  4M4Z A;  1LCJ A;  4LUD A;  1BFI A;  3VGO A;  1O4G A;  1BHH B;  4U1P A;  1SHD A;  2IUI A;  2IUH A;  2CBL A;  2KK6 A;  3VS7 A;  3BUO B;  1AB2 A;  4NWF A;  3S8O A;  2QMS A;  3GXX A;  1RJA A;  1O48 A;  2L3T A; 
#chains in the Genus database with same CATH homology
 1FU6 A;  4EIH A;  2RSY A;  3N84 A;  1WQU A;  1A08 A;  1O4E A;  3C7I A;  1X27 A;  3OVE A;  1BM2 A;  1B47 A;  1O46 A;  3PQZ A;  1HCS B;  4A4C A;  2EYV A;  1AD5 A;  1JWO A;  1O4R A;  2HDV A;  1KSW A;  5I6V A;  2ABL A;  3PSJ A;  2DVJ A;  2DX0 A;  5EEL A;  2ETZ A;  4QSY A;  1BHH A;  2GSB A;  3QWX X;  3CBL A;  3GXW A;  5HKW A;  1Y57 A;  1D1Z A;  1D4T A;  1QCF A;  2IZV A;  2CR4 A;  2PTK A;  3VRP A;  2MC1 A;  2HCK A;  3CD3 A;  3CXL A;  2H8H A;  5CDW A;  2HUW A;  4GPL B;  1A1B A;  2XP1 A;  1BLK A;  1AYD A;  5BO4 A;  1FMK A;  3IN7 A;  1SPS A;  4E68 A;  3HCK A;  1X0N A;  2H46 E;  2RVF A;  3IMJ A;  1UUS A;  2MRK A;  1SHB A;  3MAZ A;  1X6C A;  2B3O A;  1FU5 A;  1I3Z A;  2CS0 A;  3N7Y A;  4JGH A;  1MW4 A;  1A1A A;  1FBZ A;  2EKX A;  1Y1U A;  3VRR A;  1O49 A;  1RQQ C;  2OZO A;  1CWE A;  1AOT F;  1LKL A;  1M61 A;  3PSK A;  1R1Q A;  1O4J A;  3VS6 A;  1R1P A;  1O4H A;  5IBS A;  1IS0 A;  3QWY A;  1O4A A;  3M7F A;  3PJP A;  2FCI A;  1O4F A;  4P9V A;  1O4Q A;  1BG1 A;  3N8M A;  1CWD L;  4DGP A;  2Y3A B;  3T04 A;  1AYB A;  2K79 B;  3NHN A;  3PFV A;  2OQ1 A;  1O4K A;  4XZ1 A;  4K45 A;  2IUG A;  1F1W A;  2H5K A;  5EEQ A;  3UF4 A;  1D4W A;  3HHM B;  3VS3 A;  4P9Z A;  2PNB A;  2LQN A;  1IJR A;  1MIL A;  1ZFP E;  1JU5 A;  3OP0 A;  5IBM A;  2EO3 A;  1LCK A;  1A1E A;  3PLF B;  2MK2 A;  1F2F A;  2LQW A;  1R1S A;  4TZI A;  3OB2 B;  1O45 A;  4F59 A;  1CSZ A;  1O4D A;  1A81 A;  5GJH A;  1FYR A;  2ROR A;  5D0J A;  2SHP A;  2SRC A;  1LUI A;  2AOA A;  2ECD A;  1OPL A;  2Y1N A;  1RPY A;  3K2M A;  2C0O A;  2CIA A;  5DF6 A;  3BUM B;  4FBN A;  3VRY A;  4D8K A;  2LNX A;  1PIC A;  5EHR A;  1BMB A;  1O4P A;  3VRN A;  1O4N A;  5DC0 B;  1AOU F;  3VS5 A;  3ZNI A;  1JYU A;  2C9W A;  1XA6 A;  2PLE A;  1A09 A;  2MRJ A;  1KC2 A;  1O44 A;  4GWF A;  3TKZ A;  3BUW B;  1LUN A;  1LUK A;  1O4B A;  2PNA A;  3VRO A;  1H9O A;  3US4 A;  1CJ1 A;  5J3X A;  1OO3 A;  2C0T A;  1BKM A;  2DLY A;  4DGX A;  4OHE A;  2YSX A;  4XZ0 A;  3EAZ A;  1TZE E;  2C0I A;  1O47 A;  3S8N A;  1O4L A;  4OHI A;  5KAZ A;  3OV1 A;  1O4O A;  2Y1M A;  4F5B A;  1NZL A;  1O43 A;  1FHS A;  3IMD A;  4ROJ A;  3VS2 A;  2AOB A;  2LNW A;  2YU7 A;  2HDX A;  5DC4 A;  4F5A A;  4K11 A;  1Z3K A;  3BKB A;  2BBU A;  1O4C A;  4OHL A;  1AYA A;  2JYQ A;  2DM0 A;  1NZV A;  5EG3 B;  3VS4 A;  5AXI A;  3VRQ A;  1YVL A;  4OHH A;  2EYY A;  3PS5 A;  2CRH A;  4K44 A;  3MXY A;  4K2R A;  2KNO A;  1QG1 E;  3S8L A;  1O41 A;  3EAC A;  1P13 A;  1FBV A;  3BUN B;  1HCT B;  1UUR A;  2MQI A;  2L4K A;  2EU0 A;  4U17 A;  1A07 A;  2DCR A;  1SKJ A;  2FO0 A;  3CWG A;  3VRZ A;  1A1C A;  3IN8 A;  5DC9 A;  4A4B A;  4H1O A;  2PLD A;  1YVH A;  3WA4 A;  3S9K A;  1SHA A;  2CI8 A;  1M27 A;  1BLJ A;  4X6S A;  2DLZ A;  3TL0 A;  4GL9 E;  1GHU A;  2EOB A;  2L6K A;  4OHD A;  1KA7 A;  1KA6 A;  1O4I A;  1JYQ A;  1AYC A;  4JEG A;  3HIZ B;  5HKY A;  2RMX A;  2VIF A;  3OB1 B;  1BHF A;  3BUX B;  4JE4 A;  1BFJ A;  1GRI A;  1CSY A;  1O42 A;  4LUE A;  1QAD A;  1K9A A;  3VS0 A;  1JYR A;  1TCE A;  3KFJ A;  2EO6 A;  4WWQ A;  5GJI A;  4H34 A;  1OPK A;  4FL3 A;  4EY0 A;  3MXC A;  3VS1 A;  1BKL A;  2CI9 A;  1SPR A;  1BF5 A;  4NWG A;  1OO4 A;  4L1B B;  1NRV A;  2EL8 A;  2GE9 A;  5HKZ A;  2HMH A;  3UYO A;  5AUL A;  1G83 A;  2EYZ A;  4FL2 A;  2LCT A;  5EHP A;  1LUM A;  3GQI B;  1O4M A;  4E93 A;  2AUG A;  1LKK A;  2K7A B;  4M4Z A;  1LCJ A;  4LUD A;  1BFI A;  3VGO A;  1O4G A;  1BHH B;  4U1P A;  1SHD A;  2IUI A;  2IUH A;  2CBL A;  2KK6 A;  3VS7 A;  3BUO B;  1AB2 A;  4NWF A;  3S8O A;  2QMS A;  3GXX A;  1RJA A;  1O48 A;  2L3T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...