1JYUA

Xray structure of grb2 sh2 domain
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
96
structure length
96
Chain Sequence
GSMAWFFGKIPRAKAEEMLSKQRHDGAFLIRESESAPGDFSLSVKFGNDVQHFKVLRDGAGKYFLWVVKFNSLNELVDYHRSTSVSRNQQIFLRDI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords GROWTH FACTOR RECEPTOR-BOUND PROTEIN 2
publication title Crystal structures of the SH2 domain of Grb2: highlight on the binding of a new high-affinity inhibitor.
pubmed doi rcsb
source organism Homo sapiens
total genus 17
structure length 96
sequence length 96
ec nomenclature
pdb deposition date 2001-09-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00017 SH2 SH2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.505.10 Alpha Beta 2-Layer Sandwich SHC Adaptor Protein SH2 domain 1jyuA00
2RMXA 2MRKA 1O4JA 4F5AA 3PLFB 1SKJA 1O43A 1GRIA 2HCKA 1WQUA 2KK6A 1NZLA 1RJAA 1AYBA 1AB2A 1O4GA 2ECDA 3N84A 3OP0A 5AULA 5KAZA 4OHDA 1Y57A 1FMKA 3VGOA 1ZFPE 3S8OA 1SHDA 1BHFA 1BHHA 2MRJA 1O46A 1O42A 1A1EA 1JU5A 1X0NA 2AOAA 3VS4A 3NHNA 3CXLA 1XA6A 4P9VA 4X6SA 1R1SA 3N8MA 1FU5A 4XZ0A 1Z3KA 3VRNA 1JWOA 2ABLA 1O4EA 1YVLA 1A1BA 2IZVA 1LCJA 1QG1E 5EG3B 3PJPA 4K44A 1CWEA 2VIFA 3VS6A 3T04A 3BUWB 3HHMB 1O4NA 1D4WA 1SPSA 5AXIA 2IUIA 2HDXA 2MC1A 4U17A 1KC2A 1O4FA 5HKWA 1BG1A 3PSKA 4NWGA 4XZ1A 1RPYA 2DLYA 2MK2A 3IMDA 4M4ZA 1O4HA 1BMBA 1AD5A 3VROA 2PNAA 1O49A 2HUWA 1H9OA 2MQIA 3K2MA 1O4KA 5DC4A 4FL2A 4DGPA 3US4A 2L3TA 3GQIB 4K2RA 1BLJA 2PLEA 1BKLA 2LQNA 1NZVA 1TCEA 4JEGA 1LUNA 2DX0A 3ZNIA 3IN7A 4FL3A 1LUMA 3BUMB 1A81A 3BUOB 4LUEA 1I3ZA 1BM2A 3OVEA 1NRVA 4JE4A 2OZOA 1LKKA 5IBSA 3HIZB 2H46E 3CWGA 1CJ1A 1JYRA 3VRRA 2CIAA 4ROJA 1TZEE 1BFIA 3TKZA 1K9AA 2H5KA 2EU0A 1QADA 3TL0A 1AYDA 5HKYA 3S9KA 1AYCA 2FCIA 2EL8A 4LUDA 3IMJA 4GWFA 2GE9A 5J3XA 3WA4A 1KA6A 3KFJA 3EAZA 3MXYA 2SRCA 2RORA 1O4DA 5EELA 1X27A 2DM0A 1G83A 2KNOA 4P9ZA 2ETZA 1F1WA 1P13A 2L4KA 3VS3A 1OPKA 1JYQA 1LKLA 3CD3A 5IBMA 1O4PA 1A09A 1D4TA 5DC9A 4K11A 3VS2A 3QWYA 2LCTA 1A07A 1UURA 4FBNA 2EYYA 1KSWA 2HMHA 4OHEA 1BKMA 4TZIA 1SPRA 1O4LA 2EO3A 1JYUA 1M27A 1O4RA 1YVHA 1R1PA 1OO4A 2DVJA 2H8HA 3OB1B 3GXXA 1O4MA 1BLKA 1LCKA 5CDWA 4NWFA 1O4IA 3HCKA 2JYQA 4GPLB 2PLDA 2YU7A 1SHAA 2EKXA 2DLZA 1O41A 3IN8A 1O44A 2Y1MA 3PQZA 1BHHB 1FYRA 3UF4A 3VS0A 2CI8A 1RQQC 5HKZA 4A4BA 1FBVA 2CBLA 1X6CA 1MILA 3S8LA 1CSZA 1M61A 2IUHA 2PNBA 4K45A 1O4AA 3MXCA 5EHRA 2YSXA 3BUXB 3N7YA 1HCSB 3QWXX 3M7FA 1PICA 1QCFA 1FBZA 2OQ1A 3BKBA 1AOUF 1R1QA 1AOTF 5I6VA 4L1BB 2SHPA 2LNWA 3PFVA 4E93A 1OO3A 2RSYA 5EHPA 1IS0A 1LUKA 2EYVA 1Y1UA 2B3OA 1O4CA 2K7AB 1F2FA 2Y3AB 3VRZA 1FHSA 4OHLA 3VRQA 2C0IA 2K79B 2EO6A 2CRHA 3BUNB 2AUGA 1SHBA 4GL9E 5GJHA 3S8NA 2CS0A 3VRPA 4H34A 4F5BA 3MAZA 4WWQA 4EY0A 2LNXA 1CSYA 1GHUA 2BBUA 1O4BA 2EYZA 2EOBA 5DC0B 1O48A 4OHIA 3VS7A 1KA7A 4D8KA 1CWDL 4A4CA 2CR4A 2RVFA 1IJRA 3PSJA 3UYOA 5BO4A 2IUGA 4H1OA 2C0OA 4DGXA 3C7IA 5GJIA 2LQWA 3VRYA 1HCTB 1MW4A 2XP1A 2CI9A 1LUIA 4EIHA 2C9WA 3PS5A 1A1CA 1O45A 1D1ZA 1A08A 4U1PA 2PTKA 3VS5A 2FO0A 2AOBA 2QMSA 1FU6A 2Y1NA 5EEQA 1BFJA 1A1AA 5DF6A 1AYAA 1OPLA 1O47A 5D0JA 3CBLA 3EACA 4JGHA 2DCRA 1O4OA 1BF5A 3OV1A 4E68A 1UUSA 4F59A 2GSBA 3VS1A 2HDVA 3OB2B 4OHHA 4QSYA 1B47A 2L6KA 1O4QA 3GXWA 2C0TA
chains in the Genus database with same CATH superfamily
2RMXA 2MRKA 1O4JA 4F5AA 3PLFB 1SKJA 1O43A 1GRIA 2HCKA 1WQUA 2KK6A 1NZLA 1RJAA 1AYBA 1AB2A 1O4GA 2ECDA 3N84A 3OP0A 5AULA 5KAZA 4OHDA 1Y57A 1FMKA 3VGOA 1ZFPE 3S8OA 3LYVA 1SHDA 1BHFA 1BHHA 2MRJA 1O46A 1O42A 1A1EA 1JU5A 1X0NA 2AOAA 3VS4A 3NHNA 3CXLA 1XA6A 4P9VA 4X6SA 1R1SA 3N8MA 1FU5A 4XZ0A 1Z3KA 3VRNA 1JWOA 2ABLA 1O4EA 1YVLA 1A1BA 2IZVA 1LCJA 1QG1E 5EG3B 3PJPA 4K44A 1CWEA 2VIFA 3VS6A 3T04A 3BUWB 3HHMB 1O4NA 1D4WA 1SPSA 5AXIA 2IUIA 2HDXA 2MC1A 4U17A 1KC2A 1O4FA 5HKWA 1BG1A 3PSKA 4NWGA 4XZ1A 1RPYA 2DLYA 2MK2A 3IMDA 4M4ZA 1O4HA 1BMBA 1AD5A 3VROA 2PNAA 1O49A 2HUWA 1H9OA 2MQIA 3K2MA 1O4KA 5DC4A 4FL2A 2KGYA 4DGPA 3US4A 2L3TA 3GQIB 4K2RA 1BLJA 2PLEA 1BKLA 2LQNA 1NZVA 1TCEA 4JEGA 1LUNA 2DX0A 3ZNIA 3IN7A 4FL3A 1LUMA 3BUMB 1A81A 3BUOB 4LUEA 1I3ZA 1BM2A 3OVEA 1NRVA 4JE4A 2OZOA 1LKKA 5IBSA 3HIZB 2H46E 3CWGA 1CJ1A 1JYRA 3VRRA 2CIAA 4ROJA 1TZEE 1BFIA 3TKZA 1K9AA 2H5KA 2EU0A 1QADA 3TL0A 1AYDA 5HKYA 3S9KA 1AYCA 2FCIA 2EL8A 4LUDA 3IMJA 4GWFA 2GE9A 5J3XA 3WA4A 1KA6A 3KFJA 3EAZA 3MXYA 2SRCA 2RORA 1O4DA 5EELA 1X27A 2DM0A 1G83A 2KNOA 4P9ZA 2ETZA 1F1WA 1P13A 2L4KA 3VS3A 1OPKA 1JYQA 1LKLA 3CD3A 5IBMA 1O4PA 1A09A 1D4TA 5DC9A 4K11A 3VS2A 3QWYA 2LCTA 1A07A 1UURA 4FBNA 2EYYA 1KSWA 2HMHA 4OHEA 1BKMA 4TZIA 1SPRA 1O4LA 2EO3A 1JYUA 1M27A 1O4RA 1YVHA 1R1PA 1OO4A 2DVJA 2H8HA 3OB1B 3GXXA 1O4MA 1BLKA 1LCKA 5CDWA 4NWFA 1O4IA 3HCKA 2JYQA 4GPLB 2PLDA 2YU7A 1SHAA 2LRAA 2EKXA 2DLZA 1O41A 3IN8A 1O44A 2Y1MA 3PQZA 1BHHB 1FYRA 3UF4A 3VS0A 2CI8A 1RQQC 5HKZA 4A4BA 1FBVA 2CBLA 1X6CA 1MILA 3S8LA 1CSZA 1M61A 2IUHA 2PNBA 4K45A 1O4AA 3MXCA 5EHRA 2YSXA 3BUXB 3N7YA 1HCSB 3QWXX 3M7FA 1PICA 1QCFA 1FBZA 2OQ1A 3BKBA 1AOUF 1R1QA 1AOTF 5I6VA 4L1BB 2SHPA 2LNWA 3PFVA 4E93A 1OO3A 2RSYA 5EHPA 1IS0A 1LUKA 2EYVA 1Y1UA 2B3OA 1O4CA 2K7AB 1F2FA 2Y3AB 3VRZA 1FHSA 4OHLA 3VRQA 2C0IA 2K79B 2EO6A 2CRHA 3BUNB 2AUGA 1SHBA 4GL9E 5GJHA 3S8NA 2CS0A 3VRPA 4H34A 4F5BA 3MAZA 4WWQA 4EY0A 2LNXA 1CSYA 1GHUA 2BBUA 1O4BA 2EYZA 3K2TA 2EOBA 5DC0B 1O48A 4OHIA 3VS7A 1KA7A 4D8KA 1CWDL 4A4CA 2CR4A 2RVFA 1IJRA 3PSJA 3UYOA 5BO4A 2IUGA 4H1OA 2C0OA 4DGXA 3C7IA 5GJIA 2LQWA 3VRYA 1HCTB 1MW4A 2XP1A 2CI9A 1LUIA 4EIHA 2C9WA 3PS5A 1A1CA 1O45A 1D1ZA 1A08A 4U1PA 2PTKA 3VS5A 2FO0A 2AOBA 2QMSA 1FU6A 2Y1NA 5EEQA 1BFJA 1A1AA 5DF6A 1AYAA 1OPLA 1O47A 5D0JA 3CBLA 3EACA 4JGHA 2DCRA 1O4OA 1BF5A 3OV1A 4E68A 1UUSA 4F59A 2GSBA 3VS1A 2HDVA 3OB2B 4OHHA 4QSYA 1B47A 2L6KA 1O4QA 3GXWA 2C0TA
chains in the Genus database with same CATH topology
2RMXA 2MRKA 1O4JA 4F5AA 3PLFB 1SKJA 1O43A 1GRIA 2HCKA 1WQUA 2KK6A 1NZLA 1RJAA 1AYBA 1AB2A 1O4GA 2ECDA 3N84A 3OP0A 5AULA 5KAZA 4OHDA 1Y57A 1FMKA 3VGOA 1ZFPE 3S8OA 1SHDA 1BHFA 1BHHA 2MRJA 1O46A 1O42A 1A1EA 1JU5A 1X0NA 2AOAA 3VS4A 3NHNA 3CXLA 1XA6A 4P9VA 4X6SA 1R1SA 3N8MA 1FU5A 4XZ0A 1Z3KA 3VRNA 1JWOA 2ABLA 1O4EA 1YVLA 1A1BA 2IZVA 1LCJA 1QG1E 5EG3B 3PJPA 4K44A 1CWEA 2VIFA 3VS6A 3T04A 3BUWB 3HHMB 1O4NA 1D4WA 1SPSA 5AXIA 2IUIA 2HDXA 2MC1A 4U17A 1KC2A 1O4FA 5HKWA 1BG1A 3PSKA 4NWGA 4XZ1A 1RPYA 2DLYA 2MK2A 3IMDA 4M4ZA 1O4HA 1BMBA 1AD5A 3VROA 2PNAA 1O49A 2HUWA 1H9OA 2MQIA 3K2MA 1O4KA 5DC4A 4FL2A 4DGPA 3US4A 2L3TA 3GQIB 4K2RA 1BLJA 2PLEA 1BKLA 2LQNA 1NZVA 1TCEA 4JEGA 1LUNA 2DX0A 3ZNIA 3IN7A 4FL3A 1LUMA 3BUMB 1A81A 3BUOB 4LUEA 1I3ZA 1BM2A 3OVEA 1NRVA 4JE4A 2OZOA 1LKKA 5IBSA 3HIZB 2H46E 3CWGA 1CJ1A 1JYRA 3VRRA 2CIAA 4ROJA 1TZEE 1BFIA 3TKZA 1K9AA 2H5KA 2EU0A 1QADA 3TL0A 1AYDA 5HKYA 3S9KA 1AYCA 2FCIA 2EL8A 4LUDA 3IMJA 4GWFA 2GE9A 5J3XA 3WA4A 1KA6A 3KFJA 3EAZA 3MXYA 2SRCA 2RORA 1O4DA 5EELA 1X27A 2DM0A 1G83A 2KNOA 4P9ZA 2ETZA 1F1WA 1P13A 2L4KA 3VS3A 1OPKA 1JYQA 1LKLA 3CD3A 5IBMA 1O4PA 1A09A 1D4TA 5DC9A 4K11A 3VS2A 3QWYA 2LCTA 1A07A 1UURA 4FBNA 2EYYA 1KSWA 2HMHA 4OHEA 1BKMA 4TZIA 1SPRA 1O4LA 2EO3A 1JYUA 1M27A 1O4RA 1YVHA 1R1PA 1OO4A 2DVJA 2H8HA 3OB1B 3GXXA 1O4MA 1BLKA 1LCKA 5CDWA 4NWFA 1O4IA 3HCKA 2JYQA 4GPLB 2PLDA 2YU7A 1SHAA 2EKXA 2DLZA 1O41A 3IN8A 1O44A 2Y1MA 3PQZA 1BHHB 1FYRA 3UF4A 3VS0A 2CI8A 1RQQC 5HKZA 4A4BA 1FBVA 2CBLA 1X6CA 1MILA 3S8LA 1CSZA 1M61A 2IUHA 2PNBA 4K45A 1O4AA 3MXCA 5EHRA 2YSXA 3BUXB 3N7YA 1HCSB 3QWXX 3M7FA 1PICA 1QCFA 1FBZA 2OQ1A 3BKBA 1AOUF 1R1QA 1AOTF 5I6VA 4L1BB 2SHPA 2LNWA 3PFVA 4E93A 1OO3A 2RSYA 5EHPA 1IS0A 1LUKA 2EYVA 1Y1UA 2B3OA 1O4CA 2K7AB 1F2FA 2Y3AB 3VRZA 1FHSA 4OHLA 3VRQA 2C0IA 2K79B 2EO6A 2CRHA 3BUNB 2AUGA 1SHBA 4GL9E 5GJHA 3S8NA 2CS0A 3VRPA 4H34A 4F5BA 3MAZA 4WWQA 4EY0A 2LNXA 1CSYA 1GHUA 2BBUA 1O4BA 2EYZA 2EOBA 5DC0B 1O48A 4OHIA 3VS7A 1KA7A 4D8KA 1CWDL 4A4CA 2CR4A 2RVFA 1IJRA 3PSJA 3UYOA 5BO4A 2IUGA 4H1OA 2C0OA 4DGXA 3C7IA 5GJIA 2LQWA 3VRYA 1HCTB 1MW4A 2XP1A 2CI9A 1LUIA 4EIHA 2C9WA 3PS5A 1A1CA 1O45A 1D1ZA 1A08A 4U1PA 2PTKA 3VS5A 2FO0A 2AOBA 2QMSA 1FU6A 2Y1NA 5EEQA 1BFJA 1A1AA 5DF6A 1AYAA 1OPLA 1O47A 5D0JA 3CBLA 3EACA 4JGHA 2DCRA 1O4OA 1BF5A 3OV1A 4E68A 1UUSA 4F59A 2GSBA 3VS1A 2HDVA 3OB2B 4OHHA 4QSYA 1B47A 2L6KA 1O4QA 3GXWA 2C0TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RMX A;  2MRK A;  1O4J A;  4F5A A;  3PLF B;  1SKJ A;  1O43 A;  1GRI A;  2HCK A;  1WQU A;  2KK6 A;  1NZL A;  1RJA A;  1AYB A;  1AB2 A;  1O4G A;  2ECD A;  3N84 A;  3OP0 A;  5AUL A;  5KAZ A;  4OHD A;  1Y57 A;  1FMK A;  3VGO A;  1ZFP E;  3S8O A;  1SHD A;  1BHF A;  1BHH A;  2MRJ A;  1O46 A;  1O42 A;  1A1E A;  1JU5 A;  1X0N A;  2AOA A;  3VS4 A;  3NHN A;  3CXL A;  1XA6 A;  4P9V A;  4X6S A;  1R1S A;  3N8M A;  1FU5 A;  4XZ0 A;  1Z3K A;  3VRN A;  1JWO A;  2ABL A;  1O4E A;  1YVL A;  1A1B A;  2IZV A;  1LCJ A;  1QG1 E;  5EG3 B;  3PJP A;  4K44 A;  1CWE A;  2VIF A;  3VS6 A;  3T04 A;  3BUW B;  3HHM B;  1O4N A;  1D4W A;  1SPS A;  5AXI A;  2IUI A;  2HDX A;  2MC1 A;  4U17 A;  1KC2 A;  1O4F A;  5HKW A;  1BG1 A;  3PSK A;  4NWG A;  4XZ1 A;  1RPY A;  2DLY A;  2MK2 A;  3IMD A;  4M4Z A;  1O4H A;  1BMB A;  1AD5 A;  3VRO A;  2PNA A;  1O49 A;  2HUW A;  1H9O A;  2MQI A;  3K2M A;  1O4K A;  5DC4 A;  4FL2 A;  4DGP A;  3US4 A;  2L3T A;  3GQI B;  4K2R A;  1BLJ A;  2PLE A;  1BKL A;  2LQN A;  1NZV A;  1TCE A;  4JEG A;  1LUN A;  2DX0 A;  3ZNI A;  3IN7 A;  4FL3 A;  1LUM A;  3BUM B;  1A81 A;  3BUO B;  4LUE A;  1I3Z A;  1BM2 A;  3OVE A;  1NRV A;  4JE4 A;  2OZO A;  1LKK A;  5IBS A;  3HIZ B;  2H46 E;  3CWG A;  1CJ1 A;  1JYR A;  3VRR A;  2CIA A;  4ROJ A;  1TZE E;  1BFI A;  3TKZ A;  1K9A A;  2H5K A;  2EU0 A;  1QAD A;  3TL0 A;  1AYD A;  5HKY A;  3S9K A;  1AYC A;  2FCI A;  2EL8 A;  4LUD A;  3IMJ A;  4GWF A;  2GE9 A;  5J3X A;  3WA4 A;  1KA6 A;  3KFJ A;  3EAZ A;  3MXY A;  2SRC A;  2ROR A;  1O4D A;  5EEL A;  1X27 A;  2DM0 A;  1G83 A;  2KNO A;  4P9Z A;  2ETZ A;  1F1W A;  1P13 A;  2L4K A;  3VS3 A;  1OPK A;  1JYQ A;  1LKL A;  3CD3 A;  5IBM A;  1O4P A;  1A09 A;  1D4T A;  5DC9 A;  4K11 A;  3VS2 A;  3QWY A;  2LCT A;  1A07 A;  1UUR A;  4FBN A;  2EYY A;  1KSW A;  2HMH A;  4OHE A;  1BKM A;  4TZI A;  1SPR A;  1O4L A;  2EO3 A;  1JYU A;  1M27 A;  1O4R A;  1YVH A;  1R1P A;  1OO4 A;  2DVJ A;  2H8H A;  3OB1 B;  3GXX A;  1O4M A;  1BLK A;  1LCK A;  5CDW A;  4NWF A;  1O4I A;  3HCK A;  2JYQ A;  4GPL B;  2PLD A;  2YU7 A;  1SHA A;  2EKX A;  2DLZ A;  1O41 A;  3IN8 A;  1O44 A;  2Y1M A;  3PQZ A;  1BHH B;  1FYR A;  3UF4 A;  3VS0 A;  2CI8 A;  1RQQ C;  5HKZ A;  4A4B A;  1FBV A;  2CBL A;  1X6C A;  1MIL A;  3S8L A;  1CSZ A;  1M61 A;  2IUH A;  2PNB A;  4K45 A;  1O4A A;  3MXC A;  5EHR A;  2YSX A;  3BUX B;  3N7Y A;  1HCS B;  3QWX X;  3M7F A;  1PIC A;  1QCF A;  1FBZ A;  2OQ1 A;  3BKB A;  1AOU F;  1R1Q A;  1AOT F;  5I6V A;  4L1B B;  2SHP A;  2LNW A;  3PFV A;  4E93 A;  1OO3 A;  2RSY A;  5EHP A;  1IS0 A;  1LUK A;  2EYV A;  1Y1U A;  2B3O A;  1O4C A;  2K7A B;  1F2F A;  2Y3A B;  3VRZ A;  1FHS A;  4OHL A;  3VRQ A;  2C0I A;  2K79 B;  2EO6 A;  2CRH A;  3BUN B;  2AUG A;  1SHB A;  4GL9 E;  5GJH A;  3S8N A;  2CS0 A;  3VRP A;  4H34 A;  4F5B A;  3MAZ A;  4WWQ A;  4EY0 A;  2LNX A;  1CSY A;  1GHU A;  2BBU A;  1O4B A;  2EYZ A;  2EOB A;  5DC0 B;  1O48 A;  4OHI A;  3VS7 A;  1KA7 A;  4D8K A;  1CWD L;  4A4C A;  2CR4 A;  2RVF A;  1IJR A;  3PSJ A;  3UYO A;  5BO4 A;  2IUG A;  4H1O A;  2C0O A;  4DGX A;  3C7I A;  5GJI A;  2LQW A;  3VRY A;  1HCT B;  1MW4 A;  2XP1 A;  2CI9 A;  1LUI A;  4EIH A;  2C9W A;  3PS5 A;  1A1C A;  1O45 A;  1D1Z A;  1A08 A;  4U1P A;  2PTK A;  3VS5 A;  2FO0 A;  2AOB A;  2QMS A;  1FU6 A;  2Y1N A;  5EEQ A;  1BFJ A;  1A1A A;  5DF6 A;  1AYA A;  1OPL A;  1O47 A;  5D0J A;  3CBL A;  3EAC A;  4JGH A;  2DCR A;  1O4O A;  1BF5 A;  3OV1 A;  4E68 A;  1UUS A;  4F59 A;  2GSB A;  3VS1 A;  2HDV A;  3OB2 B;  4OHH A;  4QSY A;  1B47 A;  2L6K A;  1O4Q A;  3GXW A;  2C0T A; 
#chains in the Genus database with same CATH topology
 2RMX A;  2MRK A;  1O4J A;  4F5A A;  3PLF B;  1SKJ A;  1O43 A;  1GRI A;  2HCK A;  1WQU A;  2KK6 A;  1NZL A;  1RJA A;  1AYB A;  1AB2 A;  1O4G A;  2ECD A;  3N84 A;  3OP0 A;  5AUL A;  5KAZ A;  4OHD A;  1Y57 A;  1FMK A;  3VGO A;  1ZFP E;  3S8O A;  3LYV A;  1SHD A;  1BHF A;  1BHH A;  2MRJ A;  1O46 A;  1O42 A;  1A1E A;  1JU5 A;  1X0N A;  2AOA A;  3VS4 A;  3NHN A;  3CXL A;  1XA6 A;  4P9V A;  4X6S A;  1R1S A;  3N8M A;  1FU5 A;  4XZ0 A;  1Z3K A;  3VRN A;  1JWO A;  2ABL A;  1O4E A;  1YVL A;  1A1B A;  2IZV A;  1LCJ A;  1QG1 E;  5EG3 B;  3PJP A;  4K44 A;  1CWE A;  2VIF A;  3VS6 A;  3T04 A;  3BUW B;  3HHM B;  1O4N A;  1D4W A;  1SPS A;  5AXI A;  2IUI A;  2HDX A;  2MC1 A;  4U17 A;  1KC2 A;  1O4F A;  5HKW A;  1BG1 A;  3PSK A;  4NWG A;  4XZ1 A;  1RPY A;  2DLY A;  2MK2 A;  3IMD A;  4M4Z A;  1O4H A;  1BMB A;  1AD5 A;  3VRO A;  2PNA A;  1O49 A;  2HUW A;  1H9O A;  2MQI A;  3K2M A;  1O4K A;  5DC4 A;  4FL2 A;  2KGY A;  4DGP A;  3US4 A;  2L3T A;  3GQI B;  4K2R A;  1BLJ A;  2PLE A;  1BKL A;  2LQN A;  1NZV A;  1TCE A;  4JEG A;  1LUN A;  2DX0 A;  3ZNI A;  3IN7 A;  4FL3 A;  1LUM A;  3BUM B;  1A81 A;  3BUO B;  4LUE A;  1I3Z A;  1BM2 A;  3OVE A;  1NRV A;  4JE4 A;  2OZO A;  1LKK A;  5IBS A;  3HIZ B;  2H46 E;  3CWG A;  1CJ1 A;  1JYR A;  3VRR A;  2CIA A;  4ROJ A;  1TZE E;  1BFI A;  3TKZ A;  1K9A A;  2H5K A;  2EU0 A;  1QAD A;  3TL0 A;  1AYD A;  5HKY A;  3S9K A;  1AYC A;  2FCI A;  2EL8 A;  4LUD A;  3IMJ A;  4GWF A;  2GE9 A;  5J3X A;  3WA4 A;  1KA6 A;  3KFJ A;  3EAZ A;  3MXY A;  2SRC A;  2ROR A;  1O4D A;  5EEL A;  1X27 A;  2DM0 A;  1G83 A;  2KNO A;  4P9Z A;  2ETZ A;  1F1W A;  1P13 A;  2L4K A;  3VS3 A;  1OPK A;  1JYQ A;  1LKL A;  3CD3 A;  5IBM A;  1O4P A;  1A09 A;  1D4T A;  5DC9 A;  4K11 A;  3VS2 A;  3QWY A;  2LCT A;  1A07 A;  1UUR A;  4FBN A;  2EYY A;  1KSW A;  2HMH A;  4OHE A;  1BKM A;  4TZI A;  1SPR A;  1O4L A;  2EO3 A;  1JYU A;  1M27 A;  1O4R A;  1YVH A;  1R1P A;  1OO4 A;  2DVJ A;  2H8H A;  3OB1 B;  3GXX A;  1O4M A;  1BLK A;  1LCK A;  5CDW A;  4NWF A;  1O4I A;  3HCK A;  2JYQ A;  4GPL B;  2PLD A;  2YU7 A;  1SHA A;  2LRA A;  2EKX A;  2DLZ A;  1O41 A;  3IN8 A;  1O44 A;  2Y1M A;  3PQZ A;  1BHH B;  1FYR A;  3UF4 A;  3VS0 A;  2CI8 A;  1RQQ C;  5HKZ A;  4A4B A;  1FBV A;  2CBL A;  1X6C A;  1MIL A;  3S8L A;  1CSZ A;  1M61 A;  2IUH A;  2PNB A;  4K45 A;  1O4A A;  3MXC A;  5EHR A;  2YSX A;  3BUX B;  3N7Y A;  1HCS B;  3QWX X;  3M7F A;  1PIC A;  1QCF A;  1FBZ A;  2OQ1 A;  3BKB A;  1AOU F;  1R1Q A;  1AOT F;  5I6V A;  4L1B B;  2SHP A;  2LNW A;  3PFV A;  4E93 A;  1OO3 A;  2RSY A;  5EHP A;  1IS0 A;  1LUK A;  2EYV A;  1Y1U A;  2B3O A;  1O4C A;  2K7A B;  1F2F A;  2Y3A B;  3VRZ A;  1FHS A;  4OHL A;  3VRQ A;  2C0I A;  2K79 B;  2EO6 A;  2CRH A;  3BUN B;  2AUG A;  1SHB A;  4GL9 E;  5GJH A;  3S8N A;  2CS0 A;  3VRP A;  4H34 A;  4F5B A;  3MAZ A;  4WWQ A;  4EY0 A;  2LNX A;  1CSY A;  1GHU A;  2BBU A;  1O4B A;  2EYZ A;  3K2T A;  2EOB A;  5DC0 B;  1O48 A;  4OHI A;  3VS7 A;  1KA7 A;  4D8K A;  1CWD L;  4A4C A;  2CR4 A;  2RVF A;  1IJR A;  3PSJ A;  3UYO A;  5BO4 A;  2IUG A;  4H1O A;  2C0O A;  4DGX A;  3C7I A;  5GJI A;  2LQW A;  3VRY A;  1HCT B;  1MW4 A;  2XP1 A;  2CI9 A;  1LUI A;  4EIH A;  2C9W A;  3PS5 A;  1A1C A;  1O45 A;  1D1Z A;  1A08 A;  4U1P A;  2PTK A;  3VS5 A;  2FO0 A;  2AOB A;  2QMS A;  1FU6 A;  2Y1N A;  5EEQ A;  1BFJ A;  1A1A A;  5DF6 A;  1AYA A;  1OPL A;  1O47 A;  5D0J A;  3CBL A;  3EAC A;  4JGH A;  2DCR A;  1O4O A;  1BF5 A;  3OV1 A;  4E68 A;  1UUS A;  4F59 A;  2GSB A;  3VS1 A;  2HDV A;  3OB2 B;  4OHH A;  4QSY A;  1B47 A;  2L6K A;  1O4Q A;  3GXW A;  2C0T A; 
#chains in the Genus database with same CATH homology
 2RMX A;  2MRK A;  1O4J A;  4F5A A;  3PLF B;  1SKJ A;  1O43 A;  1GRI A;  2HCK A;  1WQU A;  2KK6 A;  1NZL A;  1RJA A;  1AYB A;  1AB2 A;  1O4G A;  2ECD A;  3N84 A;  3OP0 A;  5AUL A;  5KAZ A;  4OHD A;  1Y57 A;  1FMK A;  3VGO A;  1ZFP E;  3S8O A;  1SHD A;  1BHF A;  1BHH A;  2MRJ A;  1O46 A;  1O42 A;  1A1E A;  1JU5 A;  1X0N A;  2AOA A;  3VS4 A;  3NHN A;  3CXL A;  1XA6 A;  4P9V A;  4X6S A;  1R1S A;  3N8M A;  1FU5 A;  4XZ0 A;  1Z3K A;  3VRN A;  1JWO A;  2ABL A;  1O4E A;  1YVL A;  1A1B A;  2IZV A;  1LCJ A;  1QG1 E;  5EG3 B;  3PJP A;  4K44 A;  1CWE A;  2VIF A;  3VS6 A;  3T04 A;  3BUW B;  3HHM B;  1O4N A;  1D4W A;  1SPS A;  5AXI A;  2IUI A;  2HDX A;  2MC1 A;  4U17 A;  1KC2 A;  1O4F A;  5HKW A;  1BG1 A;  3PSK A;  4NWG A;  4XZ1 A;  1RPY A;  2DLY A;  2MK2 A;  3IMD A;  4M4Z A;  1O4H A;  1BMB A;  1AD5 A;  3VRO A;  2PNA A;  1O49 A;  2HUW A;  1H9O A;  2MQI A;  3K2M A;  1O4K A;  5DC4 A;  4FL2 A;  4DGP A;  3US4 A;  2L3T A;  3GQI B;  4K2R A;  1BLJ A;  2PLE A;  1BKL A;  2LQN A;  1NZV A;  1TCE A;  4JEG A;  1LUN A;  2DX0 A;  3ZNI A;  3IN7 A;  4FL3 A;  1LUM A;  3BUM B;  1A81 A;  3BUO B;  4LUE A;  1I3Z A;  1BM2 A;  3OVE A;  1NRV A;  4JE4 A;  2OZO A;  1LKK A;  5IBS A;  3HIZ B;  2H46 E;  3CWG A;  1CJ1 A;  1JYR A;  3VRR A;  2CIA A;  4ROJ A;  1TZE E;  1BFI A;  3TKZ A;  1K9A A;  2H5K A;  2EU0 A;  1QAD A;  3TL0 A;  1AYD A;  5HKY A;  3S9K A;  1AYC A;  2FCI A;  2EL8 A;  4LUD A;  3IMJ A;  4GWF A;  2GE9 A;  5J3X A;  3WA4 A;  1KA6 A;  3KFJ A;  3EAZ A;  3MXY A;  2SRC A;  2ROR A;  1O4D A;  5EEL A;  1X27 A;  2DM0 A;  1G83 A;  2KNO A;  4P9Z A;  2ETZ A;  1F1W A;  1P13 A;  2L4K A;  3VS3 A;  1OPK A;  1JYQ A;  1LKL A;  3CD3 A;  5IBM A;  1O4P A;  1A09 A;  1D4T A;  5DC9 A;  4K11 A;  3VS2 A;  3QWY A;  2LCT A;  1A07 A;  1UUR A;  4FBN A;  2EYY A;  1KSW A;  2HMH A;  4OHE A;  1BKM A;  4TZI A;  1SPR A;  1O4L A;  2EO3 A;  1JYU A;  1M27 A;  1O4R A;  1YVH A;  1R1P A;  1OO4 A;  2DVJ A;  2H8H A;  3OB1 B;  3GXX A;  1O4M A;  1BLK A;  1LCK A;  5CDW A;  4NWF A;  1O4I A;  3HCK A;  2JYQ A;  4GPL B;  2PLD A;  2YU7 A;  1SHA A;  2EKX A;  2DLZ A;  1O41 A;  3IN8 A;  1O44 A;  2Y1M A;  3PQZ A;  1BHH B;  1FYR A;  3UF4 A;  3VS0 A;  2CI8 A;  1RQQ C;  5HKZ A;  4A4B A;  1FBV A;  2CBL A;  1X6C A;  1MIL A;  3S8L A;  1CSZ A;  1M61 A;  2IUH A;  2PNB A;  4K45 A;  1O4A A;  3MXC A;  5EHR A;  2YSX A;  3BUX B;  3N7Y A;  1HCS B;  3QWX X;  3M7F A;  1PIC A;  1QCF A;  1FBZ A;  2OQ1 A;  3BKB A;  1AOU F;  1R1Q A;  1AOT F;  5I6V A;  4L1B B;  2SHP A;  2LNW A;  3PFV A;  4E93 A;  1OO3 A;  2RSY A;  5EHP A;  1IS0 A;  1LUK A;  2EYV A;  1Y1U A;  2B3O A;  1O4C A;  2K7A B;  1F2F A;  2Y3A B;  3VRZ A;  1FHS A;  4OHL A;  3VRQ A;  2C0I A;  2K79 B;  2EO6 A;  2CRH A;  3BUN B;  2AUG A;  1SHB A;  4GL9 E;  5GJH A;  3S8N A;  2CS0 A;  3VRP A;  4H34 A;  4F5B A;  3MAZ A;  4WWQ A;  4EY0 A;  2LNX A;  1CSY A;  1GHU A;  2BBU A;  1O4B A;  2EYZ A;  2EOB A;  5DC0 B;  1O48 A;  4OHI A;  3VS7 A;  1KA7 A;  4D8K A;  1CWD L;  4A4C A;  2CR4 A;  2RVF A;  1IJR A;  3PSJ A;  3UYO A;  5BO4 A;  2IUG A;  4H1O A;  2C0O A;  4DGX A;  3C7I A;  5GJI A;  2LQW A;  3VRY A;  1HCT B;  1MW4 A;  2XP1 A;  2CI9 A;  1LUI A;  4EIH A;  2C9W A;  3PS5 A;  1A1C A;  1O45 A;  1D1Z A;  1A08 A;  4U1P A;  2PTK A;  3VS5 A;  2FO0 A;  2AOB A;  2QMS A;  1FU6 A;  2Y1N A;  5EEQ A;  1BFJ A;  1A1A A;  5DF6 A;  1AYA A;  1OPL A;  1O47 A;  5D0J A;  3CBL A;  3EAC A;  4JGH A;  2DCR A;  1O4O A;  1BF5 A;  3OV1 A;  4E68 A;  1UUS A;  4F59 A;  2GSB A;  3VS1 A;  2HDV A;  3OB2 B;  4OHH A;  4QSY A;  1B47 A;  2L6K A;  1O4Q A;  3GXW A;  2C0T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...