3N8MA

Crystal structure of the grb2 sh2 domain in complex with an acyclic ligand having the sequence pyvnvp
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
99
structure length
99
Chain Sequence
MKPHPWFFGKIPRAKAEEMLSKQRHDGAFLIRESESAPGDFSLSVKFGNDVQHFKVLRDGAGKYFLWVVKFNSLNELVDYHRSTSVSRNQQIFLRDIEQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Growth factor receptor-bound protein 2
publication title Thermodynamic and Structural Effects of Macrocyclization as a Constraining Method in Protein-Ligand Interactions.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding/peptide
total genus 25
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2010-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00017 SH2 SH2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.505.10 Alpha Beta 2-Layer Sandwich SHC Adaptor Protein SH2 domain 3n8mA00
3MXYA 1O4EA 2CBLA 1BKLA 5DC9A 3WA4A 3TL0A 5DC4A 2H5KA 3OV1A 3VRQA 3VRPA 1SHBA 3QWXX 2DX0A 1OO3A 3PLFB 2RSYA 4F5AA 1IJRA 2C0IA 2GSBA 1O41A 5DC0B 3US4A 1TZEE 3M7FA 1FYRA 1MW4A 3BUOB 2MK2A 3VS1A 1D1ZA 3BUWB 3VROA 4K2RA 1CSZA 1R1PA 5EELA 1YVHA 3VS4A 4NWFA 1F1WA 1SKJA 2MRKA 1OPLA 1O45A 2MC1A 1AYDA 1A1BA 4QSYA 2CS0A 4WWQA 4JEGA 1TCEA 2EO3A 1BHFA 1GRIA 2AOAA 3HIZB 1Y1UA 1RPYA 2PTKA 3IMJA 3CBLA 2DVJA 1LCJA 2EYYA 1MILA 1KSWA 2L4KA 1R1QA 2IUIA 1QG1E 3PSKA 3VS0A 1A1AA 2RVFA 2LQNA 1O49A 3VS2A 1AYBA 2C9WA 2CI9A 1BFIA 2OQ1A 2ABLA 3S9KA 3OVEA 1RJAA 2EYVA 2DLZA 2AUGA 2FCIA 1NZLA 4EY0A 3VS7A 1O4MA 2MRJA 2XP1A 1AB2A 2EOBA 4M4ZA 1AD5A 1O4LA 2PLDA 1SPSA 2HMHA 1O4QA 1JYUA 1OPKA 1AYCA 1LKLA 1CSYA 1QADA 3VS6A 1Y57A 4X6SA 5I6VA 1O4RA 3VRZA 1O46A 1SHDA 1O4FA 2IZVA 3ZNIA 4OHEA 2EL8A 4ROJA 2SHPA 3MAZA 1WQUA 2DCRA 3PSJA 4D8KA 1O48A 3VGOA 1O4IA 2LNXA 2SRCA 1AOTF 2HDXA 1NRVA 2K7AB 5KAZA 1O4GA 1ZFPE 2EYZA 4DGXA 1O4PA 4E93A 1JWOA 1GHUA 2OZOA 3BKBA 5GJHA 4TZIA 2DM0A 1BHHA 1O4OA 5J3XA 1BHHB 1FU6A 1FBVA 1BFJA 1BLKA 1F2FA 3EACA 2EU0A 2ECDA 1FHSA 5EHRA 1LUKA 4U1PA 1JYRA 4P9VA 1A07A 1I3ZA 5EEQA 3IN7A 1M61A 2C0TA 3VRNA 3UF4A 1K9AA 4K11A 3TKZA 3VRRA 4A4CA 1O42A 1BLJA 4EIHA 2CR4A 2HUWA 2Y1MA 1SPRA 1CJ1A 3N7YA 3IN8A 3OB2B 1LKKA 4K44A 1A81A 4OHIA 3PFVA 4F59A 1O43A 3GQIB 2H46E 4XZ0A 3KFJA 1X6CA 3PJPA 1G83A 3BUMB 2LQWA 4LUEA 5CDWA 4E68A 1A1EA 5AULA 4K45A 1KA6A 2EO6A 1JYQA 2MQIA 1O4KA 1M27A 3GXXA 4FBNA 4OHHA 1O4NA 1CWDL 1BKMA 2L3TA 1SHAA 3C7IA 2CRHA 2BBUA 1LUMA 1XA6A 1FBZA 3OP0A 1JU5A 4JE4A 5HKZA 2VIFA 4FL2A 2IUGA 5BO4A 5HKWA 2DLYA 1AOUF 1O4HA 3HHMB 4JGHA 3N84A 3BUNB 1O4DA 1UURA 1LCKA 2Y1NA 1O4AA 2YSXA 4H1OA 3VRYA 1PICA 1O4JA 5GJIA 2HCKA 1Z3KA 1AYAA 5IBSA 2KNOA 4OHLA 1B47A 3K2MA 3T04A 3VS3A 2GE9A 3IMDA 3S8LA 1BMBA 2HDVA 4FL3A 3GXWA 5DF6A 2ETZA 3EAZA 3MXCA 1IS0A 1KC2A 1D4WA 4DGPA 2C0OA 1D4TA 1QCFA 2FO0A 4U17A 1O4BA 5EG3B 1NZVA 3PS5A 5IBMA 1UUSA 2CI8A 1X27A 1P13A 3CWGA 3CXLA 5AXIA 4H34A 3S8OA 3QWYA 2Y3AB 1LUNA 1HCSB 4XZ1A 3VS5A 1HCTB 3N8MA 1O4CA 2PNBA 3S8NA 5D0JA 2CIAA 4GPLB 1CWEA 1H9OA 4A4BA 2B3OA 3PQZA 4OHDA 2LCTA 3UYOA 3NHNA 4GL9E 2EKXA 2PNAA 1KA7A 2QMSA 1RQQC 4NWGA 4LUDA 2H8HA 2RMXA 4L1BB 1YVLA 1FMKA 2YU7A 1LUIA 2JYQA 1X0NA 2IUHA 2PLEA 2AOBA 2K79B 1OO4A 2LNWA 1A1CA 5HKYA 1FU5A 5EHPA 4F5BA 4GWFA 1BM2A 2L6KA 1BF5A 1A08A 1A09A 1R1SA 1O44A 3CD3A 1O47A 3HCKA 3OB1B 1BG1A 4P9ZA 3BUXB 2RORA 2KK6A
chains in the Genus database with same CATH superfamily
3MXYA 1O4EA 2CBLA 1BKLA 5DC9A 3WA4A 3TL0A 5DC4A 2H5KA 3OV1A 3VRQA 3VRPA 1SHBA 3QWXX 2DX0A 1OO3A 3PLFB 2RSYA 4F5AA 1IJRA 2C0IA 2GSBA 1O41A 5DC0B 3US4A 1TZEE 3M7FA 1FYRA 1MW4A 3BUOB 2MK2A 3VS1A 1D1ZA 3BUWB 3LYVA 3VROA 4K2RA 1CSZA 1R1PA 5EELA 1YVHA 3VS4A 4NWFA 1F1WA 1SKJA 2MRKA 1OPLA 1O45A 2MC1A 1AYDA 1A1BA 4QSYA 2CS0A 4WWQA 4JEGA 1TCEA 2EO3A 1BHFA 1GRIA 2AOAA 3HIZB 1Y1UA 1RPYA 2PTKA 3IMJA 3CBLA 2DVJA 1LCJA 2EYYA 1MILA 1KSWA 2L4KA 1R1QA 2IUIA 1QG1E 3PSKA 3VS0A 1A1AA 2RVFA 2LRAA 2LQNA 1O49A 3VS2A 1AYBA 2C9WA 2CI9A 1BFIA 2OQ1A 2ABLA 3S9KA 3OVEA 1RJAA 2EYVA 2DLZA 2AUGA 2FCIA 1NZLA 4EY0A 3VS7A 1O4MA 2MRJA 2XP1A 1AB2A 2EOBA 4M4ZA 1AD5A 1O4LA 2PLDA 1SPSA 2HMHA 1O4QA 1JYUA 1OPKA 1AYCA 1LKLA 1CSYA 1QADA 3VS6A 1Y57A 4X6SA 5I6VA 1O4RA 3VRZA 1O46A 1SHDA 1O4FA 2IZVA 3ZNIA 4OHEA 2EL8A 4ROJA 2SHPA 2KGYA 3MAZA 1WQUA 2DCRA 3PSJA 4D8KA 1O48A 3VGOA 1O4IA 2LNXA 2SRCA 1AOTF 2HDXA 1NRVA 2K7AB 5KAZA 1O4GA 1ZFPE 2EYZA 4DGXA 1O4PA 4E93A 1JWOA 1GHUA 2OZOA 3BKBA 5GJHA 4TZIA 2DM0A 1BHHA 1O4OA 5J3XA 1BHHB 1FU6A 1FBVA 1BFJA 1BLKA 1F2FA 3EACA 2EU0A 2ECDA 1FHSA 5EHRA 1LUKA 4U1PA 1JYRA 4P9VA 1A07A 1I3ZA 5EEQA 3IN7A 1M61A 2C0TA 3VRNA 3UF4A 1K9AA 4K11A 3TKZA 3VRRA 4A4CA 1O42A 1BLJA 4EIHA 2CR4A 2HUWA 2Y1MA 1SPRA 1CJ1A 3N7YA 3IN8A 3OB2B 1LKKA 4K44A 1A81A 3K2TA 4OHIA 3PFVA 4F59A 1O43A 3GQIB 2H46E 4XZ0A 3KFJA 1X6CA 3PJPA 1G83A 3BUMB 2LQWA 4LUEA 5CDWA 4E68A 1A1EA 5AULA 4K45A 1KA6A 2EO6A 1JYQA 2MQIA 1O4KA 1M27A 3GXXA 4FBNA 4OHHA 1O4NA 1CWDL 1BKMA 2L3TA 1SHAA 3C7IA 2CRHA 2BBUA 1LUMA 1XA6A 1FBZA 3OP0A 1JU5A 4JE4A 5HKZA 2VIFA 4FL2A 2IUGA 5BO4A 5HKWA 2DLYA 1AOUF 1O4HA 3HHMB 4JGHA 3N84A 3BUNB 1O4DA 1UURA 1LCKA 2Y1NA 1O4AA 2YSXA 4H1OA 3VRYA 1PICA 1O4JA 5GJIA 2HCKA 1Z3KA 1AYAA 5IBSA 2KNOA 4OHLA 1B47A 3K2MA 3T04A 3VS3A 2GE9A 3IMDA 3S8LA 1BMBA 2HDVA 4FL3A 3GXWA 5DF6A 2ETZA 3EAZA 3MXCA 1IS0A 1KC2A 1D4WA 4DGPA 2C0OA 1D4TA 1QCFA 2FO0A 4U17A 1O4BA 5EG3B 1NZVA 3PS5A 5IBMA 1UUSA 2CI8A 1X27A 1P13A 3CWGA 3CXLA 5AXIA 4H34A 3S8OA 3QWYA 2Y3AB 1LUNA 1HCSB 4XZ1A 3VS5A 1HCTB 3N8MA 1O4CA 2PNBA 3S8NA 5D0JA 2CIAA 4GPLB 1CWEA 1H9OA 4A4BA 2B3OA 3PQZA 4OHDA 2LCTA 3UYOA 3NHNA 4GL9E 2EKXA 2PNAA 1KA7A 2QMSA 1RQQC 4NWGA 4LUDA 2H8HA 2RMXA 4L1BB 1YVLA 1FMKA 2YU7A 1LUIA 2JYQA 1X0NA 2IUHA 2PLEA 2AOBA 2K79B 1OO4A 2LNWA 1A1CA 5HKYA 1FU5A 5EHPA 4F5BA 4GWFA 1BM2A 2L6KA 1BF5A 1A08A 1A09A 1R1SA 1O44A 3CD3A 1O47A 3HCKA 3OB1B 1BG1A 4P9ZA 3BUXB 2RORA 2KK6A
chains in the Genus database with same CATH topology
3MXYA 1O4EA 2CBLA 1BKLA 5DC9A 3WA4A 3TL0A 5DC4A 2H5KA 3OV1A 3VRQA 3VRPA 1SHBA 3QWXX 2DX0A 1OO3A 3PLFB 2RSYA 4F5AA 1IJRA 2C0IA 2GSBA 1O41A 5DC0B 3US4A 1TZEE 3M7FA 1FYRA 1MW4A 3BUOB 2MK2A 3VS1A 1D1ZA 3BUWB 3VROA 4K2RA 1CSZA 1R1PA 5EELA 1YVHA 3VS4A 4NWFA 1F1WA 1SKJA 2MRKA 1OPLA 1O45A 2MC1A 1AYDA 1A1BA 4QSYA 2CS0A 4WWQA 4JEGA 1TCEA 2EO3A 1BHFA 1GRIA 2AOAA 3HIZB 1Y1UA 1RPYA 2PTKA 3IMJA 3CBLA 2DVJA 1LCJA 2EYYA 1MILA 1KSWA 2L4KA 1R1QA 2IUIA 1QG1E 3PSKA 3VS0A 1A1AA 2RVFA 2LQNA 1O49A 3VS2A 1AYBA 2C9WA 2CI9A 1BFIA 2OQ1A 2ABLA 3S9KA 3OVEA 1RJAA 2EYVA 2DLZA 2AUGA 2FCIA 1NZLA 4EY0A 3VS7A 1O4MA 2MRJA 2XP1A 1AB2A 2EOBA 4M4ZA 1AD5A 1O4LA 2PLDA 1SPSA 2HMHA 1O4QA 1JYUA 1OPKA 1AYCA 1LKLA 1CSYA 1QADA 3VS6A 1Y57A 4X6SA 5I6VA 1O4RA 3VRZA 1O46A 1SHDA 1O4FA 2IZVA 3ZNIA 4OHEA 2EL8A 4ROJA 2SHPA 3MAZA 1WQUA 2DCRA 3PSJA 4D8KA 1O48A 3VGOA 1O4IA 2LNXA 2SRCA 1AOTF 2HDXA 1NRVA 2K7AB 5KAZA 1O4GA 1ZFPE 2EYZA 4DGXA 1O4PA 4E93A 1JWOA 1GHUA 2OZOA 3BKBA 5GJHA 4TZIA 2DM0A 1BHHA 1O4OA 5J3XA 1BHHB 1FU6A 1FBVA 1BFJA 1BLKA 1F2FA 3EACA 2EU0A 2ECDA 1FHSA 5EHRA 1LUKA 4U1PA 1JYRA 4P9VA 1A07A 1I3ZA 5EEQA 3IN7A 1M61A 2C0TA 3VRNA 3UF4A 1K9AA 4K11A 3TKZA 3VRRA 4A4CA 1O42A 1BLJA 4EIHA 2CR4A 2HUWA 2Y1MA 1SPRA 1CJ1A 3N7YA 3IN8A 3OB2B 1LKKA 4K44A 1A81A 4OHIA 3PFVA 4F59A 1O43A 3GQIB 2H46E 4XZ0A 3KFJA 1X6CA 3PJPA 1G83A 3BUMB 2LQWA 4LUEA 5CDWA 4E68A 1A1EA 5AULA 4K45A 1KA6A 2EO6A 1JYQA 2MQIA 1O4KA 1M27A 3GXXA 4FBNA 4OHHA 1O4NA 1CWDL 1BKMA 2L3TA 1SHAA 3C7IA 2CRHA 2BBUA 1LUMA 1XA6A 1FBZA 3OP0A 1JU5A 4JE4A 5HKZA 2VIFA 4FL2A 2IUGA 5BO4A 5HKWA 2DLYA 1AOUF 1O4HA 3HHMB 4JGHA 3N84A 3BUNB 1O4DA 1UURA 1LCKA 2Y1NA 1O4AA 2YSXA 4H1OA 3VRYA 1PICA 1O4JA 5GJIA 2HCKA 1Z3KA 1AYAA 5IBSA 2KNOA 4OHLA 1B47A 3K2MA 3T04A 3VS3A 2GE9A 3IMDA 3S8LA 1BMBA 2HDVA 4FL3A 3GXWA 5DF6A 2ETZA 3EAZA 3MXCA 1IS0A 1KC2A 1D4WA 4DGPA 2C0OA 1D4TA 1QCFA 2FO0A 4U17A 1O4BA 5EG3B 1NZVA 3PS5A 5IBMA 1UUSA 2CI8A 1X27A 1P13A 3CWGA 3CXLA 5AXIA 4H34A 3S8OA 3QWYA 2Y3AB 1LUNA 1HCSB 4XZ1A 3VS5A 1HCTB 3N8MA 1O4CA 2PNBA 3S8NA 5D0JA 2CIAA 4GPLB 1CWEA 1H9OA 4A4BA 2B3OA 3PQZA 4OHDA 2LCTA 3UYOA 3NHNA 4GL9E 2EKXA 2PNAA 1KA7A 2QMSA 1RQQC 4NWGA 4LUDA 2H8HA 2RMXA 4L1BB 1YVLA 1FMKA 2YU7A 1LUIA 2JYQA 1X0NA 2IUHA 2PLEA 2AOBA 2K79B 1OO4A 2LNWA 1A1CA 5HKYA 1FU5A 5EHPA 4F5BA 4GWFA 1BM2A 2L6KA 1BF5A 1A08A 1A09A 1R1SA 1O44A 3CD3A 1O47A 3HCKA 3OB1B 1BG1A 4P9ZA 3BUXB 2RORA 2KK6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MXY A;  1O4E A;  2CBL A;  1BKL A;  5DC9 A;  3WA4 A;  3TL0 A;  5DC4 A;  2H5K A;  3OV1 A;  3VRQ A;  3VRP A;  1SHB A;  3QWX X;  2DX0 A;  1OO3 A;  3PLF B;  2RSY A;  4F5A A;  1IJR A;  2C0I A;  2GSB A;  1O41 A;  5DC0 B;  3US4 A;  1TZE E;  3M7F A;  1FYR A;  1MW4 A;  3BUO B;  2MK2 A;  3VS1 A;  1D1Z A;  3BUW B;  3VRO A;  4K2R A;  1CSZ A;  1R1P A;  5EEL A;  1YVH A;  3VS4 A;  4NWF A;  1F1W A;  1SKJ A;  2MRK A;  1OPL A;  1O45 A;  2MC1 A;  1AYD A;  1A1B A;  4QSY A;  2CS0 A;  4WWQ A;  4JEG A;  1TCE A;  2EO3 A;  1BHF A;  1GRI A;  2AOA A;  3HIZ B;  1Y1U A;  1RPY A;  2PTK A;  3IMJ A;  3CBL A;  2DVJ A;  1LCJ A;  2EYY A;  1MIL A;  1KSW A;  2L4K A;  1R1Q A;  2IUI A;  1QG1 E;  3PSK A;  3VS0 A;  1A1A A;  2RVF A;  2LQN A;  1O49 A;  3VS2 A;  1AYB A;  2C9W A;  2CI9 A;  1BFI A;  2OQ1 A;  2ABL A;  3S9K A;  3OVE A;  1RJA A;  2EYV A;  2DLZ A;  2AUG A;  2FCI A;  1NZL A;  4EY0 A;  3VS7 A;  1O4M A;  2MRJ A;  2XP1 A;  1AB2 A;  2EOB A;  4M4Z A;  1AD5 A;  1O4L A;  2PLD A;  1SPS A;  2HMH A;  1O4Q A;  1JYU A;  1OPK A;  1AYC A;  1LKL A;  1CSY A;  1QAD A;  3VS6 A;  1Y57 A;  4X6S A;  5I6V A;  1O4R A;  3VRZ A;  1O46 A;  1SHD A;  1O4F A;  2IZV A;  3ZNI A;  4OHE A;  2EL8 A;  4ROJ A;  2SHP A;  3MAZ A;  1WQU A;  2DCR A;  3PSJ A;  4D8K A;  1O48 A;  3VGO A;  1O4I A;  2LNX A;  2SRC A;  1AOT F;  2HDX A;  1NRV A;  2K7A B;  5KAZ A;  1O4G A;  1ZFP E;  2EYZ A;  4DGX A;  1O4P A;  4E93 A;  1JWO A;  1GHU A;  2OZO A;  3BKB A;  5GJH A;  4TZI A;  2DM0 A;  1BHH A;  1O4O A;  5J3X A;  1BHH B;  1FU6 A;  1FBV A;  1BFJ A;  1BLK A;  1F2F A;  3EAC A;  2EU0 A;  2ECD A;  1FHS A;  5EHR A;  1LUK A;  4U1P A;  1JYR A;  4P9V A;  1A07 A;  1I3Z A;  5EEQ A;  3IN7 A;  1M61 A;  2C0T A;  3VRN A;  3UF4 A;  1K9A A;  4K11 A;  3TKZ A;  3VRR A;  4A4C A;  1O42 A;  1BLJ A;  4EIH A;  2CR4 A;  2HUW A;  2Y1M A;  1SPR A;  1CJ1 A;  3N7Y A;  3IN8 A;  3OB2 B;  1LKK A;  4K44 A;  1A81 A;  4OHI A;  3PFV A;  4F59 A;  1O43 A;  3GQI B;  2H46 E;  4XZ0 A;  3KFJ A;  1X6C A;  3PJP A;  1G83 A;  3BUM B;  2LQW A;  4LUE A;  5CDW A;  4E68 A;  1A1E A;  5AUL A;  4K45 A;  1KA6 A;  2EO6 A;  1JYQ A;  2MQI A;  1O4K A;  1M27 A;  3GXX A;  4FBN A;  4OHH A;  1O4N A;  1CWD L;  1BKM A;  2L3T A;  1SHA A;  3C7I A;  2CRH A;  2BBU A;  1LUM A;  1XA6 A;  1FBZ A;  3OP0 A;  1JU5 A;  4JE4 A;  5HKZ A;  2VIF A;  4FL2 A;  2IUG A;  5BO4 A;  5HKW A;  2DLY A;  1AOU F;  1O4H A;  3HHM B;  4JGH A;  3N84 A;  3BUN B;  1O4D A;  1UUR A;  1LCK A;  2Y1N A;  1O4A A;  2YSX A;  4H1O A;  3VRY A;  1PIC A;  1O4J A;  5GJI A;  2HCK A;  1Z3K A;  1AYA A;  5IBS A;  2KNO A;  4OHL A;  1B47 A;  3K2M A;  3T04 A;  3VS3 A;  2GE9 A;  3IMD A;  3S8L A;  1BMB A;  2HDV A;  4FL3 A;  3GXW A;  5DF6 A;  2ETZ A;  3EAZ A;  3MXC A;  1IS0 A;  1KC2 A;  1D4W A;  4DGP A;  2C0O A;  1D4T A;  1QCF A;  2FO0 A;  4U17 A;  1O4B A;  5EG3 B;  1NZV A;  3PS5 A;  5IBM A;  1UUS A;  2CI8 A;  1X27 A;  1P13 A;  3CWG A;  3CXL A;  5AXI A;  4H34 A;  3S8O A;  3QWY A;  2Y3A B;  1LUN A;  1HCS B;  4XZ1 A;  3VS5 A;  1HCT B;  3N8M A;  1O4C A;  2PNB A;  3S8N A;  5D0J A;  2CIA A;  4GPL B;  1CWE A;  1H9O A;  4A4B A;  2B3O A;  3PQZ A;  4OHD A;  2LCT A;  3UYO A;  3NHN A;  4GL9 E;  2EKX A;  2PNA A;  1KA7 A;  2QMS A;  1RQQ C;  4NWG A;  4LUD A;  2H8H A;  2RMX A;  4L1B B;  1YVL A;  1FMK A;  2YU7 A;  1LUI A;  2JYQ A;  1X0N A;  2IUH A;  2PLE A;  2AOB A;  2K79 B;  1OO4 A;  2LNW A;  1A1C A;  5HKY A;  1FU5 A;  5EHP A;  4F5B A;  4GWF A;  1BM2 A;  2L6K A;  1BF5 A;  1A08 A;  1A09 A;  1R1S A;  1O44 A;  3CD3 A;  1O47 A;  3HCK A;  3OB1 B;  1BG1 A;  4P9Z A;  3BUX B;  2ROR A;  2KK6 A; 
#chains in the Genus database with same CATH topology
 3MXY A;  1O4E A;  2CBL A;  1BKL A;  5DC9 A;  3WA4 A;  3TL0 A;  5DC4 A;  2H5K A;  3OV1 A;  3VRQ A;  3VRP A;  1SHB A;  3QWX X;  2DX0 A;  1OO3 A;  3PLF B;  2RSY A;  4F5A A;  1IJR A;  2C0I A;  2GSB A;  1O41 A;  5DC0 B;  3US4 A;  1TZE E;  3M7F A;  1FYR A;  1MW4 A;  3BUO B;  2MK2 A;  3VS1 A;  1D1Z A;  3BUW B;  3LYV A;  3VRO A;  4K2R A;  1CSZ A;  1R1P A;  5EEL A;  1YVH A;  3VS4 A;  4NWF A;  1F1W A;  1SKJ A;  2MRK A;  1OPL A;  1O45 A;  2MC1 A;  1AYD A;  1A1B A;  4QSY A;  2CS0 A;  4WWQ A;  4JEG A;  1TCE A;  2EO3 A;  1BHF A;  1GRI A;  2AOA A;  3HIZ B;  1Y1U A;  1RPY A;  2PTK A;  3IMJ A;  3CBL A;  2DVJ A;  1LCJ A;  2EYY A;  1MIL A;  1KSW A;  2L4K A;  1R1Q A;  2IUI A;  1QG1 E;  3PSK A;  3VS0 A;  1A1A A;  2RVF A;  2LRA A;  2LQN A;  1O49 A;  3VS2 A;  1AYB A;  2C9W A;  2CI9 A;  1BFI A;  2OQ1 A;  2ABL A;  3S9K A;  3OVE A;  1RJA A;  2EYV A;  2DLZ A;  2AUG A;  2FCI A;  1NZL A;  4EY0 A;  3VS7 A;  1O4M A;  2MRJ A;  2XP1 A;  1AB2 A;  2EOB A;  4M4Z A;  1AD5 A;  1O4L A;  2PLD A;  1SPS A;  2HMH A;  1O4Q A;  1JYU A;  1OPK A;  1AYC A;  1LKL A;  1CSY A;  1QAD A;  3VS6 A;  1Y57 A;  4X6S A;  5I6V A;  1O4R A;  3VRZ A;  1O46 A;  1SHD A;  1O4F A;  2IZV A;  3ZNI A;  4OHE A;  2EL8 A;  4ROJ A;  2SHP A;  2KGY A;  3MAZ A;  1WQU A;  2DCR A;  3PSJ A;  4D8K A;  1O48 A;  3VGO A;  1O4I A;  2LNX A;  2SRC A;  1AOT F;  2HDX A;  1NRV A;  2K7A B;  5KAZ A;  1O4G A;  1ZFP E;  2EYZ A;  4DGX A;  1O4P A;  4E93 A;  1JWO A;  1GHU A;  2OZO A;  3BKB A;  5GJH A;  4TZI A;  2DM0 A;  1BHH A;  1O4O A;  5J3X A;  1BHH B;  1FU6 A;  1FBV A;  1BFJ A;  1BLK A;  1F2F A;  3EAC A;  2EU0 A;  2ECD A;  1FHS A;  5EHR A;  1LUK A;  4U1P A;  1JYR A;  4P9V A;  1A07 A;  1I3Z A;  5EEQ A;  3IN7 A;  1M61 A;  2C0T A;  3VRN A;  3UF4 A;  1K9A A;  4K11 A;  3TKZ A;  3VRR A;  4A4C A;  1O42 A;  1BLJ A;  4EIH A;  2CR4 A;  2HUW A;  2Y1M A;  1SPR A;  1CJ1 A;  3N7Y A;  3IN8 A;  3OB2 B;  1LKK A;  4K44 A;  1A81 A;  3K2T A;  4OHI A;  3PFV A;  4F59 A;  1O43 A;  3GQI B;  2H46 E;  4XZ0 A;  3KFJ A;  1X6C A;  3PJP A;  1G83 A;  3BUM B;  2LQW A;  4LUE A;  5CDW A;  4E68 A;  1A1E A;  5AUL A;  4K45 A;  1KA6 A;  2EO6 A;  1JYQ A;  2MQI A;  1O4K A;  1M27 A;  3GXX A;  4FBN A;  4OHH A;  1O4N A;  1CWD L;  1BKM A;  2L3T A;  1SHA A;  3C7I A;  2CRH A;  2BBU A;  1LUM A;  1XA6 A;  1FBZ A;  3OP0 A;  1JU5 A;  4JE4 A;  5HKZ A;  2VIF A;  4FL2 A;  2IUG A;  5BO4 A;  5HKW A;  2DLY A;  1AOU F;  1O4H A;  3HHM B;  4JGH A;  3N84 A;  3BUN B;  1O4D A;  1UUR A;  1LCK A;  2Y1N A;  1O4A A;  2YSX A;  4H1O A;  3VRY A;  1PIC A;  1O4J A;  5GJI A;  2HCK A;  1Z3K A;  1AYA A;  5IBS A;  2KNO A;  4OHL A;  1B47 A;  3K2M A;  3T04 A;  3VS3 A;  2GE9 A;  3IMD A;  3S8L A;  1BMB A;  2HDV A;  4FL3 A;  3GXW A;  5DF6 A;  2ETZ A;  3EAZ A;  3MXC A;  1IS0 A;  1KC2 A;  1D4W A;  4DGP A;  2C0O A;  1D4T A;  1QCF A;  2FO0 A;  4U17 A;  1O4B A;  5EG3 B;  1NZV A;  3PS5 A;  5IBM A;  1UUS A;  2CI8 A;  1X27 A;  1P13 A;  3CWG A;  3CXL A;  5AXI A;  4H34 A;  3S8O A;  3QWY A;  2Y3A B;  1LUN A;  1HCS B;  4XZ1 A;  3VS5 A;  1HCT B;  3N8M A;  1O4C A;  2PNB A;  3S8N A;  5D0J A;  2CIA A;  4GPL B;  1CWE A;  1H9O A;  4A4B A;  2B3O A;  3PQZ A;  4OHD A;  2LCT A;  3UYO A;  3NHN A;  4GL9 E;  2EKX A;  2PNA A;  1KA7 A;  2QMS A;  1RQQ C;  4NWG A;  4LUD A;  2H8H A;  2RMX A;  4L1B B;  1YVL A;  1FMK A;  2YU7 A;  1LUI A;  2JYQ A;  1X0N A;  2IUH A;  2PLE A;  2AOB A;  2K79 B;  1OO4 A;  2LNW A;  1A1C A;  5HKY A;  1FU5 A;  5EHP A;  4F5B A;  4GWF A;  1BM2 A;  2L6K A;  1BF5 A;  1A08 A;  1A09 A;  1R1S A;  1O44 A;  3CD3 A;  1O47 A;  3HCK A;  3OB1 B;  1BG1 A;  4P9Z A;  3BUX B;  2ROR A;  2KK6 A; 
#chains in the Genus database with same CATH homology
 3MXY A;  1O4E A;  2CBL A;  1BKL A;  5DC9 A;  3WA4 A;  3TL0 A;  5DC4 A;  2H5K A;  3OV1 A;  3VRQ A;  3VRP A;  1SHB A;  3QWX X;  2DX0 A;  1OO3 A;  3PLF B;  2RSY A;  4F5A A;  1IJR A;  2C0I A;  2GSB A;  1O41 A;  5DC0 B;  3US4 A;  1TZE E;  3M7F A;  1FYR A;  1MW4 A;  3BUO B;  2MK2 A;  3VS1 A;  1D1Z A;  3BUW B;  3VRO A;  4K2R A;  1CSZ A;  1R1P A;  5EEL A;  1YVH A;  3VS4 A;  4NWF A;  1F1W A;  1SKJ A;  2MRK A;  1OPL A;  1O45 A;  2MC1 A;  1AYD A;  1A1B A;  4QSY A;  2CS0 A;  4WWQ A;  4JEG A;  1TCE A;  2EO3 A;  1BHF A;  1GRI A;  2AOA A;  3HIZ B;  1Y1U A;  1RPY A;  2PTK A;  3IMJ A;  3CBL A;  2DVJ A;  1LCJ A;  2EYY A;  1MIL A;  1KSW A;  2L4K A;  1R1Q A;  2IUI A;  1QG1 E;  3PSK A;  3VS0 A;  1A1A A;  2RVF A;  2LQN A;  1O49 A;  3VS2 A;  1AYB A;  2C9W A;  2CI9 A;  1BFI A;  2OQ1 A;  2ABL A;  3S9K A;  3OVE A;  1RJA A;  2EYV A;  2DLZ A;  2AUG A;  2FCI A;  1NZL A;  4EY0 A;  3VS7 A;  1O4M A;  2MRJ A;  2XP1 A;  1AB2 A;  2EOB A;  4M4Z A;  1AD5 A;  1O4L A;  2PLD A;  1SPS A;  2HMH A;  1O4Q A;  1JYU A;  1OPK A;  1AYC A;  1LKL A;  1CSY A;  1QAD A;  3VS6 A;  1Y57 A;  4X6S A;  5I6V A;  1O4R A;  3VRZ A;  1O46 A;  1SHD A;  1O4F A;  2IZV A;  3ZNI A;  4OHE A;  2EL8 A;  4ROJ A;  2SHP A;  3MAZ A;  1WQU A;  2DCR A;  3PSJ A;  4D8K A;  1O48 A;  3VGO A;  1O4I A;  2LNX A;  2SRC A;  1AOT F;  2HDX A;  1NRV A;  2K7A B;  5KAZ A;  1O4G A;  1ZFP E;  2EYZ A;  4DGX A;  1O4P A;  4E93 A;  1JWO A;  1GHU A;  2OZO A;  3BKB A;  5GJH A;  4TZI A;  2DM0 A;  1BHH A;  1O4O A;  5J3X A;  1BHH B;  1FU6 A;  1FBV A;  1BFJ A;  1BLK A;  1F2F A;  3EAC A;  2EU0 A;  2ECD A;  1FHS A;  5EHR A;  1LUK A;  4U1P A;  1JYR A;  4P9V A;  1A07 A;  1I3Z A;  5EEQ A;  3IN7 A;  1M61 A;  2C0T A;  3VRN A;  3UF4 A;  1K9A A;  4K11 A;  3TKZ A;  3VRR A;  4A4C A;  1O42 A;  1BLJ A;  4EIH A;  2CR4 A;  2HUW A;  2Y1M A;  1SPR A;  1CJ1 A;  3N7Y A;  3IN8 A;  3OB2 B;  1LKK A;  4K44 A;  1A81 A;  4OHI A;  3PFV A;  4F59 A;  1O43 A;  3GQI B;  2H46 E;  4XZ0 A;  3KFJ A;  1X6C A;  3PJP A;  1G83 A;  3BUM B;  2LQW A;  4LUE A;  5CDW A;  4E68 A;  1A1E A;  5AUL A;  4K45 A;  1KA6 A;  2EO6 A;  1JYQ A;  2MQI A;  1O4K A;  1M27 A;  3GXX A;  4FBN A;  4OHH A;  1O4N A;  1CWD L;  1BKM A;  2L3T A;  1SHA A;  3C7I A;  2CRH A;  2BBU A;  1LUM A;  1XA6 A;  1FBZ A;  3OP0 A;  1JU5 A;  4JE4 A;  5HKZ A;  2VIF A;  4FL2 A;  2IUG A;  5BO4 A;  5HKW A;  2DLY A;  1AOU F;  1O4H A;  3HHM B;  4JGH A;  3N84 A;  3BUN B;  1O4D A;  1UUR A;  1LCK A;  2Y1N A;  1O4A A;  2YSX A;  4H1O A;  3VRY A;  1PIC A;  1O4J A;  5GJI A;  2HCK A;  1Z3K A;  1AYA A;  5IBS A;  2KNO A;  4OHL A;  1B47 A;  3K2M A;  3T04 A;  3VS3 A;  2GE9 A;  3IMD A;  3S8L A;  1BMB A;  2HDV A;  4FL3 A;  3GXW A;  5DF6 A;  2ETZ A;  3EAZ A;  3MXC A;  1IS0 A;  1KC2 A;  1D4W A;  4DGP A;  2C0O A;  1D4T A;  1QCF A;  2FO0 A;  4U17 A;  1O4B A;  5EG3 B;  1NZV A;  3PS5 A;  5IBM A;  1UUS A;  2CI8 A;  1X27 A;  1P13 A;  3CWG A;  3CXL A;  5AXI A;  4H34 A;  3S8O A;  3QWY A;  2Y3A B;  1LUN A;  1HCS B;  4XZ1 A;  3VS5 A;  1HCT B;  3N8M A;  1O4C A;  2PNB A;  3S8N A;  5D0J A;  2CIA A;  4GPL B;  1CWE A;  1H9O A;  4A4B A;  2B3O A;  3PQZ A;  4OHD A;  2LCT A;  3UYO A;  3NHN A;  4GL9 E;  2EKX A;  2PNA A;  1KA7 A;  2QMS A;  1RQQ C;  4NWG A;  4LUD A;  2H8H A;  2RMX A;  4L1B B;  1YVL A;  1FMK A;  2YU7 A;  1LUI A;  2JYQ A;  1X0N A;  2IUH A;  2PLE A;  2AOB A;  2K79 B;  1OO4 A;  2LNW A;  1A1C A;  5HKY A;  1FU5 A;  5EHP A;  4F5B A;  4GWF A;  1BM2 A;  2L6K A;  1BF5 A;  1A08 A;  1A09 A;  1R1S A;  1O44 A;  3CD3 A;  1O47 A;  3HCK A;  3OB1 B;  1BG1 A;  4P9Z A;  3BUX B;  2ROR A;  2KK6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...