3N8MA

Crystal structure of the grb2 sh2 domain in complex with an acyclic ligand having the sequence pyvnvp
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
99
structure length
99
Chain Sequence
b'MKPHPWFFGKIPRAKAEEMLSKQRHDGAFLIRESESAPGDFSLSVKFGNDVQHFKVLRDGAGKYFLWVVKFNSLNELVDYHRSTSVSRNQQIFLRDIEQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Growth factor receptor-bound protein 2
publication title Thermodynamic and Structural Effects of Macrocyclization as a Constraining Method in Protein-Ligand Interactions.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding/peptide
total genus 25
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2010-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00017 SH2 SH2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.505.10 Alpha Beta 2-Layer Sandwich SHC Adaptor Protein SH2 domain 3n8mA00
5HKWA 5BO4A 4FL3A 2RSYA 1NZLA 3HCKA 2XP1A 3KFJA 3VRQA 2LNWA 3BUMB 5DC4A 3S8LA 3CWGA 1O4PA 1A09A 3PFVA 5AXIA 3QWYA 4D8KA 1JYQA 1FYRA 1JYRA 2B3OA 3M7FA 4LUDA 1Z3KA 1LCJA 2YU7A 3VS1A 1QCFA 2FCIA 2YSXA 3PJPA 1O4JA 2EO3A 1YVHA 1UURA 3HHMB 1BLJA 3T04A 1I3ZA 2CIAA 3MXYA 4H34A 1LUKA 3PLFB 2HUWA 2VIFA 1WQUA 1A1AA 3OB2B 5EELA 3PQZA 3BUXB 2MRKA 1BMBA 5D0JA 1BHHA 4XZ1A 3S8OA 5IBSA 1TZEE 4A4CA 4P9ZA 1Y1UA 1O4IA 1IJRA 2PLEA 1O4FA 5HKYA 1O45A 1O42A 4OHLA 4F59A 3MAZA 1UUSA 2LQNA 2ECDA 4K2RA 1FHSA 1ZFPE 2DCRA 3TL0A 2C0OA 1D1ZA 1CSYA 2H5KA 5EHRA 1O4CA 4M4ZA 1AYAA 3OV1A 1BFIA 1R1QA 3UF4A 1QADA 2ABLA 1O4MA 1A1BA 1A1CA 3OP0A 4L1BB 2CR4A 3HIZB 5EHPA 5HKZA 2KNOA 2EU0A 1BG1A 2RMXA 1QG1E 1GRIA 2AOBA 2DX0A 2CI9A 1X27A 4F5BA 3VS2A 3VS7A 1BHHB 3VRPA 5AULA 1MW4A 4JGHA 2BBUA 3WA4A 1AYBA 2CS0A 3VS6A 4GL9E 3IMDA 2Y1MA 3CD3A 2AOAA 2PNAA 1OPKA 2SHPA 4DGPA 5GJIA 1AB2A 5J3XA 2MQIA 1O4NA 2RORA 4A4BA 1AOTF 3VRNA 4OHDA 4OHIA 2CI8A 4WWQA 1B47A 2H8HA 1KSWA 1OO3A 1A08A 1A81A 5I6VA 2EKXA 5DC9A 2JYQA 1D4WA 2IZVA 1YVLA 1SHAA 5CDWA 3VROA 2KK6A 1BLKA 2AUGA 1O4DA 1BHFA 5KAZA 4JE4A 4NWGA 1O4OA 3US4A 4P9VA 1BF5A 4GWFA 1O43A 1CJ1A 3IN8A 4H1OA 2PNBA 2QMSA 1BKLA 1RJAA 2K79B 2DLZA 1Y57A 5IBMA 3TKZA 3IN7A 4OHEA 3C7IA 2GSBA 3UYOA 2C9WA 2C0TA 3ZNIA 1LKKA 1PICA 2MC1A 1KA7A 3CXLA 1NZVA 1G83A 3VS4A 4FL2A 2HDVA 3BUNB 2PTKA 2LQWA 2HCKA 1O4QA 1XA6A 4U1PA 1FMKA 1LUNA 4K11A 4NWFA 1RPYA 3OVEA 3PS5A 2L4KA 1O48A 3IMJA 2LCTA 1O4HA 3QWXX 2DVJA 2L6KA 4TZIA 1AYDA 1IS0A 2GE9A 1CWEA 3NHNA 1RQQC 3VS3A 1A1EA 1JU5A 1AYCA 1H9OA 3VS0A 4E93A 2H46E 4EIHA 2EYZA 1O46A 1O4RA 1OO4A 1AD5A 1NRVA 3N8MA 3BKBA 1JWOA 1O4EA 4E68A 4GPLB 3GXXA 3VRYA 2Y1NA 4K45A 1KA6A 1SHBA 1R1SA 1FU6A 1A07A 1R1PA 4LUEA 3VGOA 1O44A 1O4GA 1BKMA 2EYYA 1O47A 5GJHA 4F5AA 3N7YA 3OB1B 1SKJA 4JEGA 4QSYA 2FO0A 2RVFA 3N84A 3EAZA 2IUHA 1LUIA 4EY0A 1O41A 4X6SA 2ETZA 1LCKA 5EEQA 2EOBA 2EYVA 4ROJA 3S8NA 2L3TA 1KC2A 4XZ0A 2DM0A 4FBNA 4K44A 1FBZA 2PLDA 4U17A 2EO6A 3K2MA 5DC0B 3BUOB 1LUMA 2HDXA 2DLYA 1BM2A 3CBLA 1O4BA 1X0NA 1X6CA 1OPLA 3EACA 3PSJA 5DF6A 1AOUF 2Y3AB 3GXWA 1O49A 3S9KA 1P13A 3VRZA 1F2FA 1FU5A 2MRJA 1SPRA 1GHUA 2IUGA 2IUIA 1O4KA 3BUWB 1SHDA 3PSKA 1FBVA 3GQIB 2CBLA 1CWDL 2MK2A 1BFJA 1TCEA 2EL8A 1HCSB 4OHHA 3MXCA 2CRHA 1JYUA 1HCTB 1M61A 2LNXA 1CSZA 2K7AB 1D4TA 2C0IA 2SRCA 1SPSA 3VS5A 2OQ1A 3VRRA 4DGXA 1K9AA 1O4LA 2OZOA 5EG3B 2HMHA 1F1WA 1M27A 1MILA 1LKLA 1O4AA
chains in the Genus database with same CATH superfamily
5HKWA 5BO4A 4FL3A 2RSYA 1NZLA 3HCKA 2XP1A 3KFJA 3VRQA 2LNWA 3BUMB 5DC4A 3S8LA 3CWGA 1O4PA 1A09A 3PFVA 5AXIA 3QWYA 4D8KA 1JYQA 1FYRA 1JYRA 2B3OA 3M7FA 4LUDA 1Z3KA 1LCJA 2YU7A 3VS1A 1QCFA 2FCIA 2YSXA 3PJPA 1O4JA 2EO3A 1YVHA 1UURA 3HHMB 1BLJA 3T04A 1I3ZA 2CIAA 3MXYA 4H34A 1LUKA 3PLFB 2HUWA 2VIFA 1WQUA 1A1AA 3OB2B 5EELA 3PQZA 3BUXB 2MRKA 1BMBA 5D0JA 1BHHA 4XZ1A 3S8OA 5IBSA 1TZEE 4A4CA 4P9ZA 1Y1UA 1O4IA 1IJRA 2PLEA 1O4FA 5HKYA 1O45A 1O42A 4OHLA 4F59A 3MAZA 1UUSA 2LQNA 2ECDA 4K2RA 1FHSA 1ZFPE 2DCRA 3TL0A 2C0OA 1D1ZA 1CSYA 2H5KA 5EHRA 1O4CA 4M4ZA 1AYAA 3OV1A 1BFIA 1R1QA 2LRAA 3UF4A 1QADA 2ABLA 1O4MA 1A1BA 1A1CA 3OP0A 4L1BB 2CR4A 3HIZB 5EHPA 5HKZA 2KNOA 2EU0A 1BG1A 2RMXA 1QG1E 1GRIA 2AOBA 2DX0A 2CI9A 1X27A 4F5BA 2KGYA 3VS2A 3VS7A 1BHHB 3VRPA 5AULA 1MW4A 4JGHA 2BBUA 3WA4A 1AYBA 2CS0A 3VS6A 4GL9E 3IMDA 2Y1MA 3CD3A 2AOAA 2PNAA 1OPKA 2SHPA 4DGPA 5GJIA 1AB2A 5J3XA 2MQIA 1O4NA 2RORA 4A4BA 1AOTF 3VRNA 4OHDA 4OHIA 2CI8A 4WWQA 1B47A 2H8HA 1KSWA 1OO3A 1A08A 1A81A 5I6VA 2EKXA 5DC9A 2JYQA 1D4WA 2IZVA 1YVLA 1SHAA 5CDWA 3VROA 2KK6A 1BLKA 2AUGA 1O4DA 1BHFA 5KAZA 4JE4A 4NWGA 1O4OA 3US4A 4P9VA 1BF5A 4GWFA 1O43A 1CJ1A 3IN8A 4H1OA 2PNBA 2QMSA 1BKLA 1RJAA 2K79B 2DLZA 1Y57A 5IBMA 3TKZA 3IN7A 4OHEA 3C7IA 2GSBA 3UYOA 2C9WA 2C0TA 3ZNIA 1LKKA 1PICA 2MC1A 1KA7A 3CXLA 1NZVA 1G83A 3VS4A 4FL2A 2HDVA 3BUNB 2PTKA 2LQWA 2HCKA 1O4QA 1XA6A 4U1PA 1FMKA 1LUNA 4K11A 4NWFA 1RPYA 3OVEA 3PS5A 2L4KA 1O48A 3IMJA 2LCTA 1O4HA 3QWXX 2DVJA 2L6KA 4TZIA 1AYDA 1IS0A 2GE9A 1CWEA 3NHNA 1RQQC 3VS3A 1A1EA 1JU5A 1AYCA 1H9OA 3VS0A 4E93A 2H46E 4EIHA 2EYZA 1O46A 1O4RA 1OO4A 1AD5A 1NRVA 3N8MA 3BKBA 1JWOA 1O4EA 4E68A 4GPLB 3GXXA 3VRYA 2Y1NA 4K45A 1KA6A 1SHBA 1R1SA 1FU6A 1A07A 1R1PA 4LUEA 3VGOA 1O44A 1O4GA 1BKMA 2EYYA 1O47A 5GJHA 4F5AA 3N7YA 3OB1B 1SKJA 4JEGA 4QSYA 2FO0A 2RVFA 3N84A 3EAZA 2IUHA 1LUIA 4EY0A 1O41A 4X6SA 2ETZA 1LCKA 5EEQA 2EOBA 2EYVA 4ROJA 3S8NA 2L3TA 1KC2A 4XZ0A 2DM0A 4FBNA 4K44A 1FBZA 2PLDA 4U17A 2EO6A 3K2MA 5DC0B 3BUOB 1LUMA 2HDXA 2DLYA 1BM2A 3CBLA 1O4BA 1X0NA 1X6CA 1OPLA 3EACA 3PSJA 5DF6A 1AOUF 2Y3AB 3GXWA 3K2TA 1O49A 3S9KA 1P13A 3VRZA 1F2FA 1FU5A 2MRJA 1SPRA 1GHUA 2IUGA 2IUIA 1O4KA 3BUWB 1SHDA 3PSKA 1FBVA 3GQIB 2CBLA 1CWDL 2MK2A 1BFJA 1TCEA 2EL8A 1HCSB 4OHHA 3MXCA 2CRHA 1JYUA 1HCTB 1M61A 2LNXA 1CSZA 2K7AB 1D4TA 3LYVA 2C0IA 2SRCA 1SPSA 3VS5A 2OQ1A 3VRRA 4DGXA 1K9AA 1O4LA 2OZOA 5EG3B 2HMHA 1F1WA 1M27A 1MILA 1LKLA 1O4AA
chains in the Genus database with same CATH topology
5HKWA 5BO4A 4FL3A 2RSYA 1NZLA 3HCKA 2XP1A 3KFJA 3VRQA 2LNWA 3BUMB 5DC4A 3S8LA 3CWGA 1O4PA 1A09A 3PFVA 5AXIA 3QWYA 4D8KA 1JYQA 1FYRA 1JYRA 2B3OA 3M7FA 4LUDA 1Z3KA 1LCJA 2YU7A 3VS1A 1QCFA 2FCIA 2YSXA 3PJPA 1O4JA 2EO3A 1YVHA 1UURA 3HHMB 1BLJA 3T04A 1I3ZA 2CIAA 3MXYA 4H34A 1LUKA 3PLFB 2HUWA 2VIFA 1WQUA 1A1AA 3OB2B 5EELA 3PQZA 3BUXB 2MRKA 1BMBA 5D0JA 1BHHA 4XZ1A 3S8OA 5IBSA 1TZEE 4A4CA 4P9ZA 1Y1UA 1O4IA 1IJRA 2PLEA 1O4FA 5HKYA 1O45A 1O42A 4OHLA 4F59A 3MAZA 1UUSA 2LQNA 2ECDA 4K2RA 1FHSA 1ZFPE 2DCRA 3TL0A 2C0OA 1D1ZA 1CSYA 2H5KA 5EHRA 1O4CA 4M4ZA 1AYAA 3OV1A 1BFIA 1R1QA 3UF4A 1QADA 2ABLA 1O4MA 1A1BA 1A1CA 3OP0A 4L1BB 2CR4A 3HIZB 5EHPA 5HKZA 2KNOA 2EU0A 1BG1A 2RMXA 1QG1E 1GRIA 2AOBA 2DX0A 2CI9A 1X27A 4F5BA 3VS2A 3VS7A 1BHHB 3VRPA 5AULA 1MW4A 4JGHA 2BBUA 3WA4A 1AYBA 2CS0A 3VS6A 4GL9E 3IMDA 2Y1MA 3CD3A 2AOAA 2PNAA 1OPKA 2SHPA 4DGPA 5GJIA 1AB2A 5J3XA 2MQIA 1O4NA 2RORA 4A4BA 1AOTF 3VRNA 4OHDA 4OHIA 2CI8A 4WWQA 1B47A 2H8HA 1KSWA 1OO3A 1A08A 1A81A 5I6VA 2EKXA 5DC9A 2JYQA 1D4WA 2IZVA 1YVLA 1SHAA 5CDWA 3VROA 2KK6A 1BLKA 2AUGA 1O4DA 1BHFA 5KAZA 4JE4A 4NWGA 1O4OA 3US4A 4P9VA 1BF5A 4GWFA 1O43A 1CJ1A 3IN8A 4H1OA 2PNBA 2QMSA 1BKLA 1RJAA 2K79B 2DLZA 1Y57A 5IBMA 3TKZA 3IN7A 4OHEA 3C7IA 2GSBA 3UYOA 2C9WA 2C0TA 3ZNIA 1LKKA 1PICA 2MC1A 1KA7A 3CXLA 1NZVA 1G83A 3VS4A 4FL2A 2HDVA 3BUNB 2PTKA 2LQWA 2HCKA 1O4QA 1XA6A 4U1PA 1FMKA 1LUNA 4K11A 4NWFA 1RPYA 3OVEA 3PS5A 2L4KA 1O48A 3IMJA 2LCTA 1O4HA 3QWXX 2DVJA 2L6KA 4TZIA 1AYDA 1IS0A 2GE9A 1CWEA 3NHNA 1RQQC 3VS3A 1A1EA 1JU5A 1AYCA 1H9OA 3VS0A 4E93A 2H46E 4EIHA 2EYZA 1O46A 1O4RA 1OO4A 1AD5A 1NRVA 3N8MA 3BKBA 1JWOA 1O4EA 4E68A 4GPLB 3GXXA 3VRYA 2Y1NA 4K45A 1KA6A 1SHBA 1R1SA 1FU6A 1A07A 1R1PA 4LUEA 3VGOA 1O44A 1O4GA 1BKMA 2EYYA 1O47A 5GJHA 4F5AA 3N7YA 3OB1B 1SKJA 4JEGA 4QSYA 2FO0A 2RVFA 3N84A 3EAZA 2IUHA 1LUIA 4EY0A 1O41A 4X6SA 2ETZA 1LCKA 5EEQA 2EOBA 2EYVA 4ROJA 3S8NA 2L3TA 1KC2A 4XZ0A 2DM0A 4FBNA 4K44A 1FBZA 2PLDA 4U17A 2EO6A 3K2MA 5DC0B 3BUOB 1LUMA 2HDXA 2DLYA 1BM2A 3CBLA 1O4BA 1X0NA 1X6CA 1OPLA 3EACA 3PSJA 5DF6A 1AOUF 2Y3AB 3GXWA 1O49A 3S9KA 1P13A 3VRZA 1F2FA 1FU5A 2MRJA 1SPRA 1GHUA 2IUGA 2IUIA 1O4KA 3BUWB 1SHDA 3PSKA 1FBVA 3GQIB 2CBLA 1CWDL 2MK2A 1BFJA 1TCEA 2EL8A 1HCSB 4OHHA 3MXCA 2CRHA 1JYUA 1HCTB 1M61A 2LNXA 1CSZA 2K7AB 1D4TA 2C0IA 2SRCA 1SPSA 3VS5A 2OQ1A 3VRRA 4DGXA 1K9AA 1O4LA 2OZOA 5EG3B 2HMHA 1F1WA 1M27A 1MILA 1LKLA 1O4AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HKW A;  5BO4 A;  4FL3 A;  2RSY A;  1NZL A;  3HCK A;  2XP1 A;  3KFJ A;  3VRQ A;  2LNW A;  3BUM B;  5DC4 A;  3S8L A;  3CWG A;  1O4P A;  1A09 A;  3PFV A;  5AXI A;  3QWY A;  4D8K A;  1JYQ A;  1FYR A;  1JYR A;  2B3O A;  3M7F A;  4LUD A;  1Z3K A;  1LCJ A;  2YU7 A;  3VS1 A;  1QCF A;  2FCI A;  2YSX A;  3PJP A;  1O4J A;  2EO3 A;  1YVH A;  1UUR A;  3HHM B;  1BLJ A;  3T04 A;  1I3Z A;  2CIA A;  3MXY A;  4H34 A;  1LUK A;  3PLF B;  2HUW A;  2VIF A;  1WQU A;  1A1A A;  3OB2 B;  5EEL A;  3PQZ A;  3BUX B;  2MRK A;  1BMB A;  5D0J A;  1BHH A;  4XZ1 A;  3S8O A;  5IBS A;  1TZE E;  4A4C A;  4P9Z A;  1Y1U A;  1O4I A;  1IJR A;  2PLE A;  1O4F A;  5HKY A;  1O45 A;  1O42 A;  4OHL A;  4F59 A;  3MAZ A;  1UUS A;  2LQN A;  2ECD A;  4K2R A;  1FHS A;  1ZFP E;  2DCR A;  3TL0 A;  2C0O A;  1D1Z A;  1CSY A;  2H5K A;  5EHR A;  1O4C A;  4M4Z A;  1AYA A;  3OV1 A;  1BFI A;  1R1Q A;  3UF4 A;  1QAD A;  2ABL A;  1O4M A;  1A1B A;  1A1C A;  3OP0 A;  4L1B B;  2CR4 A;  3HIZ B;  5EHP A;  5HKZ A;  2KNO A;  2EU0 A;  1BG1 A;  2RMX A;  1QG1 E;  1GRI A;  2AOB A;  2DX0 A;  2CI9 A;  1X27 A;  4F5B A;  3VS2 A;  3VS7 A;  1BHH B;  3VRP A;  5AUL A;  1MW4 A;  4JGH A;  2BBU A;  3WA4 A;  1AYB A;  2CS0 A;  3VS6 A;  4GL9 E;  3IMD A;  2Y1M A;  3CD3 A;  2AOA A;  2PNA A;  1OPK A;  2SHP A;  4DGP A;  5GJI A;  1AB2 A;  5J3X A;  2MQI A;  1O4N A;  2ROR A;  4A4B A;  1AOT F;  3VRN A;  4OHD A;  4OHI A;  2CI8 A;  4WWQ A;  1B47 A;  2H8H A;  1KSW A;  1OO3 A;  1A08 A;  1A81 A;  5I6V A;  2EKX A;  5DC9 A;  2JYQ A;  1D4W A;  2IZV A;  1YVL A;  1SHA A;  5CDW A;  3VRO A;  2KK6 A;  1BLK A;  2AUG A;  1O4D A;  1BHF A;  5KAZ A;  4JE4 A;  4NWG A;  1O4O A;  3US4 A;  4P9V A;  1BF5 A;  4GWF A;  1O43 A;  1CJ1 A;  3IN8 A;  4H1O A;  2PNB A;  2QMS A;  1BKL A;  1RJA A;  2K79 B;  2DLZ A;  1Y57 A;  5IBM A;  3TKZ A;  3IN7 A;  4OHE A;  3C7I A;  2GSB A;  3UYO A;  2C9W A;  2C0T A;  3ZNI A;  1LKK A;  1PIC A;  2MC1 A;  1KA7 A;  3CXL A;  1NZV A;  1G83 A;  3VS4 A;  4FL2 A;  2HDV A;  3BUN B;  2PTK A;  2LQW A;  2HCK A;  1O4Q A;  1XA6 A;  4U1P A;  1FMK A;  1LUN A;  4K11 A;  4NWF A;  1RPY A;  3OVE A;  3PS5 A;  2L4K A;  1O48 A;  3IMJ A;  2LCT A;  1O4H A;  3QWX X;  2DVJ A;  2L6K A;  4TZI A;  1AYD A;  1IS0 A;  2GE9 A;  1CWE A;  3NHN A;  1RQQ C;  3VS3 A;  1A1E A;  1JU5 A;  1AYC A;  1H9O A;  3VS0 A;  4E93 A;  2H46 E;  4EIH A;  2EYZ A;  1O46 A;  1O4R A;  1OO4 A;  1AD5 A;  1NRV A;  3N8M A;  3BKB A;  1JWO A;  1O4E A;  4E68 A;  4GPL B;  3GXX A;  3VRY A;  2Y1N A;  4K45 A;  1KA6 A;  1SHB A;  1R1S A;  1FU6 A;  1A07 A;  1R1P A;  4LUE A;  3VGO A;  1O44 A;  1O4G A;  1BKM A;  2EYY A;  1O47 A;  5GJH A;  4F5A A;  3N7Y A;  3OB1 B;  1SKJ A;  4JEG A;  4QSY A;  2FO0 A;  2RVF A;  3N84 A;  3EAZ A;  2IUH A;  1LUI A;  4EY0 A;  1O41 A;  4X6S A;  2ETZ A;  1LCK A;  5EEQ A;  2EOB A;  2EYV A;  4ROJ A;  3S8N A;  2L3T A;  1KC2 A;  4XZ0 A;  2DM0 A;  4FBN A;  4K44 A;  1FBZ A;  2PLD A;  4U17 A;  2EO6 A;  3K2M A;  5DC0 B;  3BUO B;  1LUM A;  2HDX A;  2DLY A;  1BM2 A;  3CBL A;  1O4B A;  1X0N A;  1X6C A;  1OPL A;  3EAC A;  3PSJ A;  5DF6 A;  1AOU F;  2Y3A B;  3GXW A;  1O49 A;  3S9K A;  1P13 A;  3VRZ A;  1F2F A;  1FU5 A;  2MRJ A;  1SPR A;  1GHU A;  2IUG A;  2IUI A;  1O4K A;  3BUW B;  1SHD A;  3PSK A;  1FBV A;  3GQI B;  2CBL A;  1CWD L;  2MK2 A;  1BFJ A;  1TCE A;  2EL8 A;  1HCS B;  4OHH A;  3MXC A;  2CRH A;  1JYU A;  1HCT B;  1M61 A;  2LNX A;  1CSZ A;  2K7A B;  1D4T A;  2C0I A;  2SRC A;  1SPS A;  3VS5 A;  2OQ1 A;  3VRR A;  4DGX A;  1K9A A;  1O4L A;  2OZO A;  5EG3 B;  2HMH A;  1F1W A;  1M27 A;  1MIL A;  1LKL A;  1O4A A; 
#chains in the Genus database with same CATH topology
 5HKW A;  5BO4 A;  4FL3 A;  2RSY A;  1NZL A;  3HCK A;  2XP1 A;  3KFJ A;  3VRQ A;  2LNW A;  3BUM B;  5DC4 A;  3S8L A;  3CWG A;  1O4P A;  1A09 A;  3PFV A;  5AXI A;  3QWY A;  4D8K A;  1JYQ A;  1FYR A;  1JYR A;  2B3O A;  3M7F A;  4LUD A;  1Z3K A;  1LCJ A;  2YU7 A;  3VS1 A;  1QCF A;  2FCI A;  2YSX A;  3PJP A;  1O4J A;  2EO3 A;  1YVH A;  1UUR A;  3HHM B;  1BLJ A;  3T04 A;  1I3Z A;  2CIA A;  3MXY A;  4H34 A;  1LUK A;  3PLF B;  2HUW A;  2VIF A;  1WQU A;  1A1A A;  3OB2 B;  5EEL A;  3PQZ A;  3BUX B;  2MRK A;  1BMB A;  5D0J A;  1BHH A;  4XZ1 A;  3S8O A;  5IBS A;  1TZE E;  4A4C A;  4P9Z A;  1Y1U A;  1O4I A;  1IJR A;  2PLE A;  1O4F A;  5HKY A;  1O45 A;  1O42 A;  4OHL A;  4F59 A;  3MAZ A;  1UUS A;  2LQN A;  2ECD A;  4K2R A;  1FHS A;  1ZFP E;  2DCR A;  3TL0 A;  2C0O A;  1D1Z A;  1CSY A;  2H5K A;  5EHR A;  1O4C A;  4M4Z A;  1AYA A;  3OV1 A;  1BFI A;  1R1Q A;  2LRA A;  3UF4 A;  1QAD A;  2ABL A;  1O4M A;  1A1B A;  1A1C A;  3OP0 A;  4L1B B;  2CR4 A;  3HIZ B;  5EHP A;  5HKZ A;  2KNO A;  2EU0 A;  1BG1 A;  2RMX A;  1QG1 E;  1GRI A;  2AOB A;  2DX0 A;  2CI9 A;  1X27 A;  4F5B A;  2KGY A;  3VS2 A;  3VS7 A;  1BHH B;  3VRP A;  5AUL A;  1MW4 A;  4JGH A;  2BBU A;  3WA4 A;  1AYB A;  2CS0 A;  3VS6 A;  4GL9 E;  3IMD A;  2Y1M A;  3CD3 A;  2AOA A;  2PNA A;  1OPK A;  2SHP A;  4DGP A;  5GJI A;  1AB2 A;  5J3X A;  2MQI A;  1O4N A;  2ROR A;  4A4B A;  1AOT F;  3VRN A;  4OHD A;  4OHI A;  2CI8 A;  4WWQ A;  1B47 A;  2H8H A;  1KSW A;  1OO3 A;  1A08 A;  1A81 A;  5I6V A;  2EKX A;  5DC9 A;  2JYQ A;  1D4W A;  2IZV A;  1YVL A;  1SHA A;  5CDW A;  3VRO A;  2KK6 A;  1BLK A;  2AUG A;  1O4D A;  1BHF A;  5KAZ A;  4JE4 A;  4NWG A;  1O4O A;  3US4 A;  4P9V A;  1BF5 A;  4GWF A;  1O43 A;  1CJ1 A;  3IN8 A;  4H1O A;  2PNB A;  2QMS A;  1BKL A;  1RJA A;  2K79 B;  2DLZ A;  1Y57 A;  5IBM A;  3TKZ A;  3IN7 A;  4OHE A;  3C7I A;  2GSB A;  3UYO A;  2C9W A;  2C0T A;  3ZNI A;  1LKK A;  1PIC A;  2MC1 A;  1KA7 A;  3CXL A;  1NZV A;  1G83 A;  3VS4 A;  4FL2 A;  2HDV A;  3BUN B;  2PTK A;  2LQW A;  2HCK A;  1O4Q A;  1XA6 A;  4U1P A;  1FMK A;  1LUN A;  4K11 A;  4NWF A;  1RPY A;  3OVE A;  3PS5 A;  2L4K A;  1O48 A;  3IMJ A;  2LCT A;  1O4H A;  3QWX X;  2DVJ A;  2L6K A;  4TZI A;  1AYD A;  1IS0 A;  2GE9 A;  1CWE A;  3NHN A;  1RQQ C;  3VS3 A;  1A1E A;  1JU5 A;  1AYC A;  1H9O A;  3VS0 A;  4E93 A;  2H46 E;  4EIH A;  2EYZ A;  1O46 A;  1O4R A;  1OO4 A;  1AD5 A;  1NRV A;  3N8M A;  3BKB A;  1JWO A;  1O4E A;  4E68 A;  4GPL B;  3GXX A;  3VRY A;  2Y1N A;  4K45 A;  1KA6 A;  1SHB A;  1R1S A;  1FU6 A;  1A07 A;  1R1P A;  4LUE A;  3VGO A;  1O44 A;  1O4G A;  1BKM A;  2EYY A;  1O47 A;  5GJH A;  4F5A A;  3N7Y A;  3OB1 B;  1SKJ A;  4JEG A;  4QSY A;  2FO0 A;  2RVF A;  3N84 A;  3EAZ A;  2IUH A;  1LUI A;  4EY0 A;  1O41 A;  4X6S A;  2ETZ A;  1LCK A;  5EEQ A;  2EOB A;  2EYV A;  4ROJ A;  3S8N A;  2L3T A;  1KC2 A;  4XZ0 A;  2DM0 A;  4FBN A;  4K44 A;  1FBZ A;  2PLD A;  4U17 A;  2EO6 A;  3K2M A;  5DC0 B;  3BUO B;  1LUM A;  2HDX A;  2DLY A;  1BM2 A;  3CBL A;  1O4B A;  1X0N A;  1X6C A;  1OPL A;  3EAC A;  3PSJ A;  5DF6 A;  1AOU F;  2Y3A B;  3GXW A;  3K2T A;  1O49 A;  3S9K A;  1P13 A;  3VRZ A;  1F2F A;  1FU5 A;  2MRJ A;  1SPR A;  1GHU A;  2IUG A;  2IUI A;  1O4K A;  3BUW B;  1SHD A;  3PSK A;  1FBV A;  3GQI B;  2CBL A;  1CWD L;  2MK2 A;  1BFJ A;  1TCE A;  2EL8 A;  1HCS B;  4OHH A;  3MXC A;  2CRH A;  1JYU A;  1HCT B;  1M61 A;  2LNX A;  1CSZ A;  2K7A B;  1D4T A;  3LYV A;  2C0I A;  2SRC A;  1SPS A;  3VS5 A;  2OQ1 A;  3VRR A;  4DGX A;  1K9A A;  1O4L A;  2OZO A;  5EG3 B;  2HMH A;  1F1W A;  1M27 A;  1MIL A;  1LKL A;  1O4A A; 
#chains in the Genus database with same CATH homology
 5HKW A;  5BO4 A;  4FL3 A;  2RSY A;  1NZL A;  3HCK A;  2XP1 A;  3KFJ A;  3VRQ A;  2LNW A;  3BUM B;  5DC4 A;  3S8L A;  3CWG A;  1O4P A;  1A09 A;  3PFV A;  5AXI A;  3QWY A;  4D8K A;  1JYQ A;  1FYR A;  1JYR A;  2B3O A;  3M7F A;  4LUD A;  1Z3K A;  1LCJ A;  2YU7 A;  3VS1 A;  1QCF A;  2FCI A;  2YSX A;  3PJP A;  1O4J A;  2EO3 A;  1YVH A;  1UUR A;  3HHM B;  1BLJ A;  3T04 A;  1I3Z A;  2CIA A;  3MXY A;  4H34 A;  1LUK A;  3PLF B;  2HUW A;  2VIF A;  1WQU A;  1A1A A;  3OB2 B;  5EEL A;  3PQZ A;  3BUX B;  2MRK A;  1BMB A;  5D0J A;  1BHH A;  4XZ1 A;  3S8O A;  5IBS A;  1TZE E;  4A4C A;  4P9Z A;  1Y1U A;  1O4I A;  1IJR A;  2PLE A;  1O4F A;  5HKY A;  1O45 A;  1O42 A;  4OHL A;  4F59 A;  3MAZ A;  1UUS A;  2LQN A;  2ECD A;  4K2R A;  1FHS A;  1ZFP E;  2DCR A;  3TL0 A;  2C0O A;  1D1Z A;  1CSY A;  2H5K A;  5EHR A;  1O4C A;  4M4Z A;  1AYA A;  3OV1 A;  1BFI A;  1R1Q A;  3UF4 A;  1QAD A;  2ABL A;  1O4M A;  1A1B A;  1A1C A;  3OP0 A;  4L1B B;  2CR4 A;  3HIZ B;  5EHP A;  5HKZ A;  2KNO A;  2EU0 A;  1BG1 A;  2RMX A;  1QG1 E;  1GRI A;  2AOB A;  2DX0 A;  2CI9 A;  1X27 A;  4F5B A;  3VS2 A;  3VS7 A;  1BHH B;  3VRP A;  5AUL A;  1MW4 A;  4JGH A;  2BBU A;  3WA4 A;  1AYB A;  2CS0 A;  3VS6 A;  4GL9 E;  3IMD A;  2Y1M A;  3CD3 A;  2AOA A;  2PNA A;  1OPK A;  2SHP A;  4DGP A;  5GJI A;  1AB2 A;  5J3X A;  2MQI A;  1O4N A;  2ROR A;  4A4B A;  1AOT F;  3VRN A;  4OHD A;  4OHI A;  2CI8 A;  4WWQ A;  1B47 A;  2H8H A;  1KSW A;  1OO3 A;  1A08 A;  1A81 A;  5I6V A;  2EKX A;  5DC9 A;  2JYQ A;  1D4W A;  2IZV A;  1YVL A;  1SHA A;  5CDW A;  3VRO A;  2KK6 A;  1BLK A;  2AUG A;  1O4D A;  1BHF A;  5KAZ A;  4JE4 A;  4NWG A;  1O4O A;  3US4 A;  4P9V A;  1BF5 A;  4GWF A;  1O43 A;  1CJ1 A;  3IN8 A;  4H1O A;  2PNB A;  2QMS A;  1BKL A;  1RJA A;  2K79 B;  2DLZ A;  1Y57 A;  5IBM A;  3TKZ A;  3IN7 A;  4OHE A;  3C7I A;  2GSB A;  3UYO A;  2C9W A;  2C0T A;  3ZNI A;  1LKK A;  1PIC A;  2MC1 A;  1KA7 A;  3CXL A;  1NZV A;  1G83 A;  3VS4 A;  4FL2 A;  2HDV A;  3BUN B;  2PTK A;  2LQW A;  2HCK A;  1O4Q A;  1XA6 A;  4U1P A;  1FMK A;  1LUN A;  4K11 A;  4NWF A;  1RPY A;  3OVE A;  3PS5 A;  2L4K A;  1O48 A;  3IMJ A;  2LCT A;  1O4H A;  3QWX X;  2DVJ A;  2L6K A;  4TZI A;  1AYD A;  1IS0 A;  2GE9 A;  1CWE A;  3NHN A;  1RQQ C;  3VS3 A;  1A1E A;  1JU5 A;  1AYC A;  1H9O A;  3VS0 A;  4E93 A;  2H46 E;  4EIH A;  2EYZ A;  1O46 A;  1O4R A;  1OO4 A;  1AD5 A;  1NRV A;  3N8M A;  3BKB A;  1JWO A;  1O4E A;  4E68 A;  4GPL B;  3GXX A;  3VRY A;  2Y1N A;  4K45 A;  1KA6 A;  1SHB A;  1R1S A;  1FU6 A;  1A07 A;  1R1P A;  4LUE A;  3VGO A;  1O44 A;  1O4G A;  1BKM A;  2EYY A;  1O47 A;  5GJH A;  4F5A A;  3N7Y A;  3OB1 B;  1SKJ A;  4JEG A;  4QSY A;  2FO0 A;  2RVF A;  3N84 A;  3EAZ A;  2IUH A;  1LUI A;  4EY0 A;  1O41 A;  4X6S A;  2ETZ A;  1LCK A;  5EEQ A;  2EOB A;  2EYV A;  4ROJ A;  3S8N A;  2L3T A;  1KC2 A;  4XZ0 A;  2DM0 A;  4FBN A;  4K44 A;  1FBZ A;  2PLD A;  4U17 A;  2EO6 A;  3K2M A;  5DC0 B;  3BUO B;  1LUM A;  2HDX A;  2DLY A;  1BM2 A;  3CBL A;  1O4B A;  1X0N A;  1X6C A;  1OPL A;  3EAC A;  3PSJ A;  5DF6 A;  1AOU F;  2Y3A B;  3GXW A;  1O49 A;  3S9K A;  1P13 A;  3VRZ A;  1F2F A;  1FU5 A;  2MRJ A;  1SPR A;  1GHU A;  2IUG A;  2IUI A;  1O4K A;  3BUW B;  1SHD A;  3PSK A;  1FBV A;  3GQI B;  2CBL A;  1CWD L;  2MK2 A;  1BFJ A;  1TCE A;  2EL8 A;  1HCS B;  4OHH A;  3MXC A;  2CRH A;  1JYU A;  1HCT B;  1M61 A;  2LNX A;  1CSZ A;  2K7A B;  1D4T A;  2C0I A;  2SRC A;  1SPS A;  3VS5 A;  2OQ1 A;  3VRR A;  4DGX A;  1K9A A;  1O4L A;  2OZO A;  5EG3 B;  2HMH A;  1F1W A;  1M27 A;  1MIL A;  1LKL A;  1O4A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...