4JGHA

Structure of the socs2-elongin bc complex bound to an n-terminal fragment of cullin5
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
173
structure length
163
Chain Sequence
b'HMDPEFQAARLAKALRELGQTGWYWGSMTVNEAKEKLKEAPEGTFLIRDSSHSDYLLTISVKTSAGPTNLRIEYQDGKFRLDSIICVKSKLKQFDSVVHLIDYYVQMCKDGTVHLYLTKPLYTSAPSLQHLCRLTINKCTGAIWGLPLPTRLKDYLEEYKFQV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Suppressor of cytokine signaling 2
publication title Structural basis of intersubunit recognition in elongin BC-cullin 5-SOCS box ubiquitin-protein ligase complexes.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 46
structure length 163
sequence length 173
ec nomenclature
pdb deposition date 2013-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00017 SH2 SH2 domain
A PF07525 SOCS_box SOCS box
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.750.20 Mainly Alpha Orthogonal Bundle Elongin C; Chain C, domain 1 Elongin C; Chain C, domain 1 4jghA02
3.30.505.10 Alpha Beta 2-Layer Sandwich SHC Adaptor Protein SH2 domain 4jghA01
2DM0A 3K2MA 3US4A 1CJ1A 4OHEA 3S8LA 2L3TA 1O47A 4EY0A 5EELA 1O46A 5I6VA 1JU5A 1FU6A 4JE4A 1BG1A 2EOBA 2L4KA 1A07A 1LKKA 2LCTA 1BLJA 1O43A 1A1BA 5HKYA 1AOTF 3OB1B 1A1EA 3CBLA 1O41A 5HKZA 3BUOB 1FMKA 2CI8A 1FHSA 4K45A 3VRZA 1CWDL 2CI9A 1O4PA 1JYRA 1R1SA 1K9AA 2ABLA 3OP0A 3TKZA 2LNXA 2PNBA 2HDVA 3PS5A 2ETZA 2IZVA 3ZNGA 5EG3B 2Y1MA 3ZKJA 5GJIA 4E68A 1M61A 2YU7A 1MILA 4F5BA 2H5KA 2IUHA 2HMHA 3VS4A 3VS5A 3HIZB 2CR4A 3N7YA 4OHLA 1FBZA 3PSKA 2B3OA 5DC4A 4JEGA 2CBLA 1O4OA 1SHDA 1XA6A 1A1CA 1D4WA 1D1ZA 3CXLA 1H9OA 4M4ZA 1O4AA 4DGPA 1X27A 1O4CA 3S8OA 4GWFA 2HCKA 1G83A 1I3ZA 4E93A 3MXCA 1NRVA 2YSXA 1BMBA 3VRPA 2EYZA 3VRRA 3BUNB 4WWQA 1AB2A 2PLDA 2MRJA 5AULA 3ZNIA 2RVFA 1O4IA 2KNOA 2DX0A 1BLKA 2OQ1A 4XZ0A 1SHBA 2FCIA 1BFIA 5D0JA 1QCFA 5EHPA 4XZ1A 1O4LA 2DCRA 2DLYA 3VRQA 1AOUF 5KAZA 3MXYA 2IUGA 4ROJA 1M27A 1ZFPE 2C0OA 4TZIA 3M7FA 1BM2A 1YVHA 2MRKA 1LUKA 2RSYA 4OHDA 4GPLB 3PQZA 1F2FA 4OHIA 1BFJA 2HUWA 3NHNA 1LCKA 5IBMA 3OV1A 1AD5A 1SHAA 1NZLA 2EYYA 3IN7A 3T04A 4D8KA 4QSYA 5IBSA 1O4QA 5GJHA 4X6SA 2H46E 2RORA 4H34A 1O4RA 1A1AA 2MC1A 1R1PA 3UYOA 3VROA 5HKWA 3VRYA 2Y1NA 1O4HA 4U17A 4U1PA 3QWYA 1OO4A 2DVJA 3EAZA 2SHPA 1RQQC 2PLEA 4F5AA 4NWGA 1IJRA 3GXXA 2MK2A 3OB2B 3TL0A 1D4TA 1GRIA 5EEQA 1Z3KA 3GXWA 5DF6A 2JYQA 2C0IA 3VRNA 3VS0A 3QWXX 1CSYA 2EL8A 1Y1UA 4K44A 1O42A 1UUSA 3IMDA 2C0TA 4A4CA 2AUGA 4EIHA 3VGOA 2BBUA 1AYBA 2KK6A 1B47A 2EKXA 1O4KA 1NZVA 3MAZA 2LQWA 4FBNA 4H1OA 3GQIB 3VS2A 1OPKA 1KSWA 4K11A 5DC0B 1LCJA 2EO3A 1O4EA 1CWEA 1RPYA 1OO3A 1KA7A 3PSJA 4FL2A 2GSBA 4P9VA 2XP1A 1LUMA 2LQNA 4A4BA 1BKLA 2ECDA 1SPRA 2IUIA 3PLFB 2H8HA 2CRHA 1YVLA 2C9WA 1O49A 1LKLA 1BF5A 1O44A 2DLZA 4JGHA 3IMJA 1KA6A 1R1QA 3S9KA 1MW4A 2K79B 2PNAA 1O45A 1QADA 4NWFA 1PICA 3UF4A 2EU0A 3OVEA 4FL3A 3VS6A 1BKMA 1IS0A 2VIFA 1O4FA 5AXIA 1O48A 2EYVA 3BUWB 2PTKA 1P13A 3VS1A 1O4NA 2RMXA 1A81A 1O4JA 4K2RA 1BHHA 3EACA 3CD3A 2FO0A 3HHMB 3VS3A 1A09A 1AYCA 2CIAA 1A08A 2CS0A 3N8MA 1CSZA 3N84A 2LNWA 1TZEE 1Y57A 1FBVA 1FU5A 1JYUA 2SRCA 4P9ZA 3PFVA 1BHFA 4OHHA 5BO4A 1O4GA 3IN8A 1BHHB 1HCSB 2K7AB 1AYAA 4DGXA 1SKJA 2OZOA 1O4MA 3BUMB 3HCKA 1GHUA 3WA4A 3PJPA 1LUIA 3BUXB 3BKBA 2Y3AB 1LUNA 1JWOA 1WQUA 3KFJA 5DC9A 1RJAA 1JYQA 3CWGA 3S8NA 3VS7A 5J3XA 1HCTB 1F1WA 2HDXA 1AYDA 3C7IA 1QG1E 1OPLA 4GL9E 1O4BA 5CDWA 1UURA 1O4DA 2L6KA 1TCEA 2EO6A 5EHRA 1X0NA 2AOAA 4LUDA 2QMSA 4LUEA 2GE9A 1SPSA 1FYRA 4F59A 2MQIA 1KC2A 4L1BB 1X6CA 2AOBA
chains in the Genus database with same CATH superfamily
2DM0A 3K2MA 4W9DC 3US4A 1CJ1A 4OHEA 3S8LA 2L3TA 1O47A 4EY0A 5EELA 1O46A 4W9IC 5I6VA 1JU5A 1FU6A 4JE4A 4BKTC 1BG1A 2EOBA 2L4KA 1A07A 1LKKA 2LCTA 1BLJA 1O43A 1A1BA 5HKYA 1AOTF 3OB1B 1A1EA 3CBLA 1O41A 5HKZA 3BUOB 1FMKA 2CI8A 1FHSA 4K45A 3VRZA 1CWDL 2CI9A 1O4PA 1JYRA 1R1SA 1K9AA 2ABLA 3OP0A 3TKZA 2LNXA 2PNBA 2HDVA 3PS5A 2ETZA 2IZVA 3ZNGA 5EG3B 2Y1MA 3ZKJA 5GJIA 4WQOA 4E68A 1M61A 2YU7A 1MILA 4F5BA 2H5KA 2IUHA 2HMHA 3VS4A 3VS5A 3HIZB 2CR4A 3N7YA 4OHLA 1FBZA 3PSKA 2B3OA 5DC4A 4JEGA 2CBLA 1O4OA 1SHDA 1XA6A 1A1CA 1D4WA 1D1ZA 3CXLA 1H9OA 4M4ZA 1O4AA 4DGPA 1LM8V 1X27A 1O4CA 3S8OA 4GWFA 2HCKA 1G83A 1I3ZA 4E93A 3MXCA 1NRVA 2YSXA 1BMBA 3VRPA 2EYZA 3VRRA 3BUNB 4WWQA 1AB2A 2PLDA 2MRJA 5AULA 3ZNIA 2RVFA 1O4IA 2KNOA 2DX0A 1BLKA 3K2TA 2OQ1A 4XZ0A 1SHBA 4W9HC 2FCIA 1BFIA 5D0JA 1QCFA 5EHPA 4XZ1A 1O4LA 2DCRA 2DLYA 3VRQA 1AOUF 5KAZA 3MXYA 2IUGA 4ROJA 1M27A 1ZFPE 2C0OA 4TZIA 4W9EC 3M7FA 1BM2A 1YVHA 2MRKA 1LUKA 2RSYA 4OHDA 4GPLB 3PQZA 1F2FA 4OHIA 1BFJA 2HUWA 3NHNA 1LCKA 5IBMA 3OV1A 1AD5A 1SHAA 1NZLA 2EYYA 3ZUNC 3IN7A 3T04A 4D8KA 3ZRFC 4QSYA 5IBSA 1O4QA 5GJHA 4X6SA 2H46E 2KGYA 2RORA 4H34A 1O4RA 1A1AA 4W9CC 2MC1A 1R1PA 3UYOA 3VROA 5HKWA 3VRYA 2Y1NA 1O4HA 4W9LC 4U17A 4U1PA 4W9GC 3QWYA 4AJYV 1OO4A 2DVJA 3EAZA 2SHPA 1RQQC 2PLEA 4F5AA 4NWGA 1IJRA 3GXXA 2MK2A 3OB2B 3TL0A 1D4TA 1GRIA 5EEQA 1Z3KA 3ZTDC 3GXWA 5DF6A 2JYQA 2C0IA 3VRNA 3VS0A 3QWXX 1CSYA 3LYVA 2EL8A 1Y1UA 4K44A 1O42A 1UUSA 3IMDA 2C0TA 4A4CA 2AUGA 4EIHA 3VGOA 2BBUA 1AYBA 2KK6A 1B47A 2EKXA 1O4KA 1NZVA 3MAZA 2LQWA 4FBNA 4H1OA 3GQIB 3VS2A 1OPKA 1KSWA 5LLIC 4K11A 5DC0B 1LCJA 2EO3A 1O4EA 1CWEA 1RPYA 1OO3A 1KA7A 3PSJA 4FL2A 2GSBA 4P9VA 2XP1A 1LUMA 2LQNA 4A4BA 1BKLA 2ECDA 1SPRA 2IUIA 4B95C 3PLFB 2H8HA 2CRHA 4B9KC 1YVLA 2C9WA 1O49A 1LKLA 1BF5A 1O44A 2DLZA 1LQBC 4JGHA 3IMJA 1KA6A 1R1QA 3S9KA 1MW4A 2K79B 2PNAA 1O45A 1QADA 4NWFA 1PICA 3UF4A 1VCBC 2EU0A 3OVEA 4FL3A 3VS6A 1BKMA 1IS0A 2VIFA 1O4FA 5AXIA 1O48A 2EYVA 3BUWB 2PTKA 1P13A 3VS1A 1O4NA 2RMXA 1A81A 1O4JA 4K2RA 1BHHA 3EACA 3CD3A 2FO0A 3HHMB 3VS3A 1A09A 1AYCA 2CIAA 4AWJC 1A08A 2CS0A 3N8MA 1CSZA 3N84A 2LNWA 1TZEE 3ZTCC 1Y57A 1FBVA 1FU5A 1JYUA 2SRCA 4P9ZA 3PFVA 1BHFA 4OHHA 5BO4A 1O4GA 3IN8A 1BHHB 1HCSB 2K7AB 1AYAA 4DGXA 1SKJA 4W9KC 2OZOA 1O4MA 3BUMB 2LRAA 3HCKA 1GHUA 3WA4A 3PJPA 1LUIA 3BUXB 3BKBA 2Y3AB 1LUNA 1JWOA 1WQUA 3KFJA 4W9FC 5DC9A 1RJAA 1JYQA 3CWGA 3S8NA 3VS7A 5J3XA 1HCTB 1F1WA 4BKSC 2HDXA 1AYDA 4W9JC 3C7IA 1QG1E 1OPLA 4GL9E 1O4BA 5CDWA 1UURA 1O4DA 2L6KA 1TCEA 2EO6A 5EHRA 1X0NA 2AOAA 4LUDA 2QMSA 4LUEA 2GE9A 1SPSA 1FYRA 3ZRCC 4F59A 2MQIA 1KC2A 4L1BB 1X6CA 2AOBA
chains in the Genus database with same CATH topology
2DM0A 3K2MA 3US4A 1CJ1A 4OHEA 3S8LA 2L3TA 1O47A 4EY0A 5EELA 1O46A 5I6VA 1JU5A 1FU6A 4JE4A 1BG1A 2EOBA 2L4KA 1A07A 1LKKA 2LCTA 1BLJA 1O43A 1A1BA 5HKYA 1AOTF 3OB1B 1A1EA 3CBLA 1O41A 5HKZA 3BUOB 1FMKA 2CI8A 1FHSA 4K45A 3VRZA 1CWDL 2CI9A 1O4PA 1JYRA 1R1SA 1K9AA 2ABLA 3OP0A 3TKZA 2LNXA 2PNBA 2HDVA 3PS5A 2ETZA 2IZVA 3ZNGA 5EG3B 2Y1MA 3ZKJA 5GJIA 4E68A 1M61A 2YU7A 1MILA 4F5BA 2H5KA 2IUHA 2HMHA 3VS4A 3VS5A 3HIZB 2CR4A 3N7YA 4OHLA 1FBZA 3PSKA 2B3OA 5DC4A 4JEGA 2CBLA 1O4OA 1SHDA 1XA6A 1A1CA 1D4WA 1D1ZA 3CXLA 1H9OA 4M4ZA 1O4AA 4DGPA 1X27A 1O4CA 3S8OA 4GWFA 2HCKA 1G83A 1I3ZA 4E93A 3MXCA 1NRVA 2YSXA 1BMBA 3VRPA 2EYZA 3VRRA 3BUNB 4WWQA 1AB2A 2PLDA 2MRJA 5AULA 3ZNIA 2RVFA 1O4IA 2KNOA 2DX0A 1BLKA 2OQ1A 4XZ0A 1SHBA 2FCIA 1BFIA 5D0JA 1QCFA 5EHPA 4XZ1A 1O4LA 2DCRA 2DLYA 3VRQA 1AOUF 5KAZA 3MXYA 2IUGA 4ROJA 1M27A 1ZFPE 2C0OA 4TZIA 3M7FA 1BM2A 1YVHA 2MRKA 1LUKA 2RSYA 4OHDA 4GPLB 3PQZA 1F2FA 4OHIA 1BFJA 2HUWA 3NHNA 1LCKA 5IBMA 3OV1A 1AD5A 1SHAA 1NZLA 2EYYA 3IN7A 3T04A 4D8KA 4QSYA 5IBSA 1O4QA 5GJHA 4X6SA 2H46E 2RORA 4H34A 1O4RA 1A1AA 2MC1A 1R1PA 3UYOA 3VROA 5HKWA 3VRYA 2Y1NA 1O4HA 4U17A 4U1PA 3QWYA 1OO4A 2DVJA 3EAZA 2SHPA 1RQQC 2PLEA 4F5AA 4NWGA 1IJRA 3GXXA 2MK2A 3OB2B 3TL0A 1D4TA 1GRIA 5EEQA 1Z3KA 3GXWA 5DF6A 2JYQA 2C0IA 3VRNA 3VS0A 3QWXX 1CSYA 2EL8A 1Y1UA 4K44A 1O42A 1UUSA 3IMDA 2C0TA 4A4CA 2AUGA 4EIHA 3VGOA 2BBUA 1AYBA 2KK6A 1B47A 2EKXA 1O4KA 1NZVA 3MAZA 2LQWA 4FBNA 4H1OA 3GQIB 3VS2A 1OPKA 1KSWA 4K11A 5DC0B 1LCJA 2EO3A 1O4EA 1CWEA 1RPYA 1OO3A 1KA7A 3PSJA 4FL2A 2GSBA 4P9VA 2XP1A 1LUMA 2LQNA 4A4BA 1BKLA 2ECDA 1SPRA 2IUIA 3PLFB 2H8HA 2CRHA 1YVLA 2C9WA 1O49A 1LKLA 1BF5A 1O44A 2DLZA 4JGHA 3IMJA 1KA6A 1R1QA 3S9KA 1MW4A 2K79B 2PNAA 1O45A 1QADA 4NWFA 1PICA 3UF4A 2EU0A 3OVEA 4FL3A 3VS6A 1BKMA 1IS0A 2VIFA 1O4FA 5AXIA 1O48A 2EYVA 3BUWB 2PTKA 1P13A 3VS1A 1O4NA 2RMXA 1A81A 1O4JA 4K2RA 1BHHA 3EACA 3CD3A 2FO0A 3HHMB 3VS3A 1A09A 1AYCA 2CIAA 1A08A 2CS0A 3N8MA 1CSZA 3N84A 2LNWA 1TZEE 1Y57A 1FBVA 1FU5A 1JYUA 2SRCA 4P9ZA 3PFVA 1BHFA 4OHHA 5BO4A 1O4GA 3IN8A 1BHHB 1HCSB 2K7AB 1AYAA 4DGXA 1SKJA 2OZOA 1O4MA 3BUMB 3HCKA 1GHUA 3WA4A 3PJPA 1LUIA 3BUXB 3BKBA 2Y3AB 1LUNA 1JWOA 1WQUA 3KFJA 5DC9A 1RJAA 1JYQA 3CWGA 3S8NA 3VS7A 5J3XA 1HCTB 1F1WA 2HDXA 1AYDA 3C7IA 1QG1E 1OPLA 4GL9E 1O4BA 5CDWA 1UURA 1O4DA 2L6KA 1TCEA 2EO6A 5EHRA 1X0NA 2AOAA 4LUDA 2QMSA 4LUEA 2GE9A 1SPSA 1FYRA 4F59A 2MQIA 1KC2A 4L1BB 1X6CA 2AOBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DM0 A;  3K2M A;  3US4 A;  1CJ1 A;  4OHE A;  3S8L A;  2L3T A;  1O47 A;  4EY0 A;  5EEL A;  1O46 A;  5I6V A;  1JU5 A;  1FU6 A;  4JE4 A;  1BG1 A;  2EOB A;  2L4K A;  1A07 A;  1LKK A;  2LCT A;  1BLJ A;  1O43 A;  1A1B A;  5HKY A;  1AOT F;  3OB1 B;  1A1E A;  3CBL A;  1O41 A;  5HKZ A;  3BUO B;  1FMK A;  2CI8 A;  1FHS A;  4K45 A;  3VRZ A;  1CWD L;  2CI9 A;  1O4P A;  1JYR A;  1R1S A;  1K9A A;  2ABL A;  3OP0 A;  3TKZ A;  2LNX A;  2PNB A;  2HDV A;  3PS5 A;  2ETZ A;  2IZV A;  3ZNG A;  5EG3 B;  2Y1M A;  3ZKJ A;  5GJI A;  4E68 A;  1M61 A;  2YU7 A;  1MIL A;  4F5B A;  2H5K A;  2IUH A;  2HMH A;  3VS4 A;  3VS5 A;  3HIZ B;  2CR4 A;  3N7Y A;  4OHL A;  1FBZ A;  3PSK A;  2B3O A;  5DC4 A;  4JEG A;  2CBL A;  1O4O A;  1SHD A;  1XA6 A;  1A1C A;  1D4W A;  1D1Z A;  3CXL A;  1H9O A;  4M4Z A;  1O4A A;  4DGP A;  1X27 A;  1O4C A;  3S8O A;  4GWF A;  2HCK A;  1G83 A;  1I3Z A;  4E93 A;  3MXC A;  1NRV A;  2YSX A;  1BMB A;  3VRP A;  2EYZ A;  3VRR A;  3BUN B;  4WWQ A;  1AB2 A;  2PLD A;  2MRJ A;  5AUL A;  3ZNI A;  2RVF A;  1O4I A;  2KNO A;  2DX0 A;  1BLK A;  2OQ1 A;  4XZ0 A;  1SHB A;  2FCI A;  1BFI A;  5D0J A;  1QCF A;  5EHP A;  4XZ1 A;  1O4L A;  2DCR A;  2DLY A;  3VRQ A;  1AOU F;  5KAZ A;  3MXY A;  2IUG A;  4ROJ A;  1M27 A;  1ZFP E;  2C0O A;  4TZI A;  3M7F A;  1BM2 A;  1YVH A;  2MRK A;  1LUK A;  2RSY A;  4OHD A;  4GPL B;  3PQZ A;  1F2F A;  4OHI A;  1BFJ A;  2HUW A;  3NHN A;  1LCK A;  5IBM A;  3OV1 A;  1AD5 A;  1SHA A;  1NZL A;  2EYY A;  3IN7 A;  3T04 A;  4D8K A;  4QSY A;  5IBS A;  1O4Q A;  5GJH A;  4X6S A;  2H46 E;  2ROR A;  4H34 A;  1O4R A;  1A1A A;  2MC1 A;  1R1P A;  3UYO A;  3VRO A;  5HKW A;  3VRY A;  2Y1N A;  1O4H A;  4U17 A;  4U1P A;  3QWY A;  1OO4 A;  2DVJ A;  3EAZ A;  2SHP A;  1RQQ C;  2PLE A;  4F5A A;  4NWG A;  1IJR A;  3GXX A;  2MK2 A;  3OB2 B;  3TL0 A;  1D4T A;  1GRI A;  5EEQ A;  1Z3K A;  3GXW A;  5DF6 A;  2JYQ A;  2C0I A;  3VRN A;  3VS0 A;  3QWX X;  1CSY A;  2EL8 A;  1Y1U A;  4K44 A;  1O42 A;  1UUS A;  3IMD A;  2C0T A;  4A4C A;  2AUG A;  4EIH A;  3VGO A;  2BBU A;  1AYB A;  2KK6 A;  1B47 A;  2EKX A;  1O4K A;  1NZV A;  3MAZ A;  2LQW A;  4FBN A;  4H1O A;  3GQI B;  3VS2 A;  1OPK A;  1KSW A;  4K11 A;  5DC0 B;  1LCJ A;  2EO3 A;  1O4E A;  1CWE A;  1RPY A;  1OO3 A;  1KA7 A;  3PSJ A;  4FL2 A;  2GSB A;  4P9V A;  2XP1 A;  1LUM A;  2LQN A;  4A4B A;  1BKL A;  2ECD A;  1SPR A;  2IUI A;  3PLF B;  2H8H A;  2CRH A;  1YVL A;  2C9W A;  1O49 A;  1LKL A;  1BF5 A;  1O44 A;  2DLZ A;  4JGH A;  3IMJ A;  1KA6 A;  1R1Q A;  3S9K A;  1MW4 A;  2K79 B;  2PNA A;  1O45 A;  1QAD A;  4NWF A;  1PIC A;  3UF4 A;  2EU0 A;  3OVE A;  4FL3 A;  3VS6 A;  1BKM A;  1IS0 A;  2VIF A;  1O4F A;  5AXI A;  1O48 A;  2EYV A;  3BUW B;  2PTK A;  1P13 A;  3VS1 A;  1O4N A;  2RMX A;  1A81 A;  1O4J A;  4K2R A;  1BHH A;  3EAC A;  3CD3 A;  2FO0 A;  3HHM B;  3VS3 A;  1A09 A;  1AYC A;  2CIA A;  1A08 A;  2CS0 A;  3N8M A;  1CSZ A;  3N84 A;  2LNW A;  1TZE E;  1Y57 A;  1FBV A;  1FU5 A;  1JYU A;  2SRC A;  4P9Z A;  3PFV A;  1BHF A;  4OHH A;  5BO4 A;  1O4G A;  3IN8 A;  1BHH B;  1HCS B;  2K7A B;  1AYA A;  4DGX A;  1SKJ A;  2OZO A;  1O4M A;  3BUM B;  3HCK A;  1GHU A;  3WA4 A;  3PJP A;  1LUI A;  3BUX B;  3BKB A;  2Y3A B;  1LUN A;  1JWO A;  1WQU A;  3KFJ A;  5DC9 A;  1RJA A;  1JYQ A;  3CWG A;  3S8N A;  3VS7 A;  5J3X A;  1HCT B;  1F1W A;  2HDX A;  1AYD A;  3C7I A;  1QG1 E;  1OPL A;  4GL9 E;  1O4B A;  5CDW A;  1UUR A;  1O4D A;  2L6K A;  1TCE A;  2EO6 A;  5EHR A;  1X0N A;  2AOA A;  4LUD A;  2QMS A;  4LUE A;  2GE9 A;  1SPS A;  1FYR A;  4F59 A;  2MQI A;  1KC2 A;  4L1B B;  1X6C A;  2AOB A; 
#chains in the Genus database with same CATH topology
 2DM0 A;  3K2M A;  4W9D C;  3US4 A;  1CJ1 A;  4OHE A;  3S8L A;  2L3T A;  1O47 A;  4EY0 A;  5EEL A;  1O46 A;  4W9I C;  5I6V A;  1JU5 A;  1FU6 A;  4JE4 A;  4BKT C;  1BG1 A;  2EOB A;  2L4K A;  1A07 A;  1LKK A;  2LCT A;  1BLJ A;  1O43 A;  1A1B A;  5HKY A;  1AOT F;  3OB1 B;  1A1E A;  3CBL A;  1O41 A;  5HKZ A;  3BUO B;  1FMK A;  2CI8 A;  1FHS A;  4K45 A;  3VRZ A;  1CWD L;  2CI9 A;  1O4P A;  1JYR A;  1R1S A;  1K9A A;  2ABL A;  3OP0 A;  3TKZ A;  2LNX A;  2PNB A;  2HDV A;  3PS5 A;  2ETZ A;  2IZV A;  3ZNG A;  5EG3 B;  2Y1M A;  3ZKJ A;  5GJI A;  4WQO A;  4E68 A;  1M61 A;  2YU7 A;  1MIL A;  4F5B A;  2H5K A;  2IUH A;  2HMH A;  3VS4 A;  3VS5 A;  3HIZ B;  2CR4 A;  3N7Y A;  4OHL A;  1FBZ A;  3PSK A;  2B3O A;  5DC4 A;  4JEG A;  2CBL A;  1O4O A;  1SHD A;  1XA6 A;  1A1C A;  1D4W A;  1D1Z A;  3CXL A;  1H9O A;  4M4Z A;  1O4A A;  4DGP A;  1LM8 V;  1X27 A;  1O4C A;  3S8O A;  4GWF A;  2HCK A;  1G83 A;  1I3Z A;  4E93 A;  3MXC A;  1NRV A;  2YSX A;  1BMB A;  3VRP A;  2EYZ A;  3VRR A;  3BUN B;  4WWQ A;  1AB2 A;  2PLD A;  2MRJ A;  5AUL A;  3ZNI A;  2RVF A;  1O4I A;  2KNO A;  2DX0 A;  1BLK A;  3K2T A;  2OQ1 A;  4XZ0 A;  1SHB A;  4W9H C;  2FCI A;  1BFI A;  5D0J A;  1QCF A;  5EHP A;  4XZ1 A;  1O4L A;  2DCR A;  2DLY A;  3VRQ A;  1AOU F;  5KAZ A;  3MXY A;  2IUG A;  4ROJ A;  1M27 A;  1ZFP E;  2C0O A;  4TZI A;  4W9E C;  3M7F A;  1BM2 A;  1YVH A;  2MRK A;  1LUK A;  2RSY A;  4OHD A;  4GPL B;  3PQZ A;  1F2F A;  4OHI A;  1BFJ A;  2HUW A;  3NHN A;  1LCK A;  5IBM A;  3OV1 A;  1AD5 A;  1SHA A;  1NZL A;  2EYY A;  3ZUN C;  3IN7 A;  3T04 A;  4D8K A;  3ZRF C;  4QSY A;  5IBS A;  1O4Q A;  5GJH A;  4X6S A;  2H46 E;  2KGY A;  2ROR A;  4H34 A;  1O4R A;  1A1A A;  4W9C C;  2MC1 A;  1R1P A;  3UYO A;  3VRO A;  5HKW A;  3VRY A;  2Y1N A;  1O4H A;  4W9L C;  4U17 A;  4U1P A;  4W9G C;  3QWY A;  4AJY V;  1OO4 A;  2DVJ A;  3EAZ A;  2SHP A;  1RQQ C;  2PLE A;  4F5A A;  4NWG A;  1IJR A;  3GXX A;  2MK2 A;  3OB2 B;  3TL0 A;  1D4T A;  1GRI A;  5EEQ A;  1Z3K A;  3ZTD C;  3GXW A;  5DF6 A;  2JYQ A;  2C0I A;  3VRN A;  3VS0 A;  3QWX X;  1CSY A;  3LYV A;  2EL8 A;  1Y1U A;  4K44 A;  1O42 A;  1UUS A;  3IMD A;  2C0T A;  4A4C A;  2AUG A;  4EIH A;  3VGO A;  2BBU A;  1AYB A;  2KK6 A;  1B47 A;  2EKX A;  1O4K A;  1NZV A;  3MAZ A;  2LQW A;  4FBN A;  4H1O A;  3GQI B;  3VS2 A;  1OPK A;  1KSW A;  5LLI C;  4K11 A;  5DC0 B;  1LCJ A;  2EO3 A;  1O4E A;  1CWE A;  1RPY A;  1OO3 A;  1KA7 A;  3PSJ A;  4FL2 A;  2GSB A;  4P9V A;  2XP1 A;  1LUM A;  2LQN A;  4A4B A;  1BKL A;  2ECD A;  1SPR A;  2IUI A;  4B95 C;  3PLF B;  2H8H A;  2CRH A;  4B9K C;  1YVL A;  2C9W A;  1O49 A;  1LKL A;  1BF5 A;  1O44 A;  2DLZ A;  1LQB C;  4JGH A;  3IMJ A;  1KA6 A;  1R1Q A;  3S9K A;  1MW4 A;  2K79 B;  2PNA A;  1O45 A;  1QAD A;  4NWF A;  1PIC A;  3UF4 A;  1VCB C;  2EU0 A;  3OVE A;  4FL3 A;  3VS6 A;  1BKM A;  1IS0 A;  2VIF A;  1O4F A;  5AXI A;  1O48 A;  2EYV A;  3BUW B;  2PTK A;  1P13 A;  3VS1 A;  1O4N A;  2RMX A;  1A81 A;  1O4J A;  4K2R A;  1BHH A;  3EAC A;  3CD3 A;  2FO0 A;  3HHM B;  3VS3 A;  1A09 A;  1AYC A;  2CIA A;  4AWJ C;  1A08 A;  2CS0 A;  3N8M A;  1CSZ A;  3N84 A;  2LNW A;  1TZE E;  3ZTC C;  1Y57 A;  1FBV A;  1FU5 A;  1JYU A;  2SRC A;  4P9Z A;  3PFV A;  1BHF A;  4OHH A;  5BO4 A;  1O4G A;  3IN8 A;  1BHH B;  1HCS B;  2K7A B;  1AYA A;  4DGX A;  1SKJ A;  4W9K C;  2OZO A;  1O4M A;  3BUM B;  2LRA A;  3HCK A;  1GHU A;  3WA4 A;  3PJP A;  1LUI A;  3BUX B;  3BKB A;  2Y3A B;  1LUN A;  1JWO A;  1WQU A;  3KFJ A;  4W9F C;  5DC9 A;  1RJA A;  1JYQ A;  3CWG A;  3S8N A;  3VS7 A;  5J3X A;  1HCT B;  1F1W A;  4BKS C;  2HDX A;  1AYD A;  4W9J C;  3C7I A;  1QG1 E;  1OPL A;  4GL9 E;  1O4B A;  5CDW A;  1UUR A;  1O4D A;  2L6K A;  1TCE A;  2EO6 A;  5EHR A;  1X0N A;  2AOA A;  4LUD A;  2QMS A;  4LUE A;  2GE9 A;  1SPS A;  1FYR A;  3ZRC C;  4F59 A;  2MQI A;  1KC2 A;  4L1B B;  1X6C A;  2AOB A; 
#chains in the Genus database with same CATH homology
 2DM0 A;  3K2M A;  3US4 A;  1CJ1 A;  4OHE A;  3S8L A;  2L3T A;  1O47 A;  4EY0 A;  5EEL A;  1O46 A;  5I6V A;  1JU5 A;  1FU6 A;  4JE4 A;  1BG1 A;  2EOB A;  2L4K A;  1A07 A;  1LKK A;  2LCT A;  1BLJ A;  1O43 A;  1A1B A;  5HKY A;  1AOT F;  3OB1 B;  1A1E A;  3CBL A;  1O41 A;  5HKZ A;  3BUO B;  1FMK A;  2CI8 A;  1FHS A;  4K45 A;  3VRZ A;  1CWD L;  2CI9 A;  1O4P A;  1JYR A;  1R1S A;  1K9A A;  2ABL A;  3OP0 A;  3TKZ A;  2LNX A;  2PNB A;  2HDV A;  3PS5 A;  2ETZ A;  2IZV A;  3ZNG A;  5EG3 B;  2Y1M A;  3ZKJ A;  5GJI A;  4E68 A;  1M61 A;  2YU7 A;  1MIL A;  4F5B A;  2H5K A;  2IUH A;  2HMH A;  3VS4 A;  3VS5 A;  3HIZ B;  2CR4 A;  3N7Y A;  4OHL A;  1FBZ A;  3PSK A;  2B3O A;  5DC4 A;  4JEG A;  2CBL A;  1O4O A;  1SHD A;  1XA6 A;  1A1C A;  1D4W A;  1D1Z A;  3CXL A;  1H9O A;  4M4Z A;  1O4A A;  4DGP A;  1X27 A;  1O4C A;  3S8O A;  4GWF A;  2HCK A;  1G83 A;  1I3Z A;  4E93 A;  3MXC A;  1NRV A;  2YSX A;  1BMB A;  3VRP A;  2EYZ A;  3VRR A;  3BUN B;  4WWQ A;  1AB2 A;  2PLD A;  2MRJ A;  5AUL A;  3ZNI A;  2RVF A;  1O4I A;  2KNO A;  2DX0 A;  1BLK A;  2OQ1 A;  4XZ0 A;  1SHB A;  2FCI A;  1BFI A;  5D0J A;  1QCF A;  5EHP A;  4XZ1 A;  1O4L A;  2DCR A;  2DLY A;  3VRQ A;  1AOU F;  5KAZ A;  3MXY A;  2IUG A;  4ROJ A;  1M27 A;  1ZFP E;  2C0O A;  4TZI A;  3M7F A;  1BM2 A;  1YVH A;  2MRK A;  1LUK A;  2RSY A;  4OHD A;  4GPL B;  3PQZ A;  1F2F A;  4OHI A;  1BFJ A;  2HUW A;  3NHN A;  1LCK A;  5IBM A;  3OV1 A;  1AD5 A;  1SHA A;  1NZL A;  2EYY A;  3IN7 A;  3T04 A;  4D8K A;  4QSY A;  5IBS A;  1O4Q A;  5GJH A;  4X6S A;  2H46 E;  2ROR A;  4H34 A;  1O4R A;  1A1A A;  2MC1 A;  1R1P A;  3UYO A;  3VRO A;  5HKW A;  3VRY A;  2Y1N A;  1O4H A;  4U17 A;  4U1P A;  3QWY A;  1OO4 A;  2DVJ A;  3EAZ A;  2SHP A;  1RQQ C;  2PLE A;  4F5A A;  4NWG A;  1IJR A;  3GXX A;  2MK2 A;  3OB2 B;  3TL0 A;  1D4T A;  1GRI A;  5EEQ A;  1Z3K A;  3GXW A;  5DF6 A;  2JYQ A;  2C0I A;  3VRN A;  3VS0 A;  3QWX X;  1CSY A;  2EL8 A;  1Y1U A;  4K44 A;  1O42 A;  1UUS A;  3IMD A;  2C0T A;  4A4C A;  2AUG A;  4EIH A;  3VGO A;  2BBU A;  1AYB A;  2KK6 A;  1B47 A;  2EKX A;  1O4K A;  1NZV A;  3MAZ A;  2LQW A;  4FBN A;  4H1O A;  3GQI B;  3VS2 A;  1OPK A;  1KSW A;  4K11 A;  5DC0 B;  1LCJ A;  2EO3 A;  1O4E A;  1CWE A;  1RPY A;  1OO3 A;  1KA7 A;  3PSJ A;  4FL2 A;  2GSB A;  4P9V A;  2XP1 A;  1LUM A;  2LQN A;  4A4B A;  1BKL A;  2ECD A;  1SPR A;  2IUI A;  3PLF B;  2H8H A;  2CRH A;  1YVL A;  2C9W A;  1O49 A;  1LKL A;  1BF5 A;  1O44 A;  2DLZ A;  4JGH A;  3IMJ A;  1KA6 A;  1R1Q A;  3S9K A;  1MW4 A;  2K79 B;  2PNA A;  1O45 A;  1QAD A;  4NWF A;  1PIC A;  3UF4 A;  2EU0 A;  3OVE A;  4FL3 A;  3VS6 A;  1BKM A;  1IS0 A;  2VIF A;  1O4F A;  5AXI A;  1O48 A;  2EYV A;  3BUW B;  2PTK A;  1P13 A;  3VS1 A;  1O4N A;  2RMX A;  1A81 A;  1O4J A;  4K2R A;  1BHH A;  3EAC A;  3CD3 A;  2FO0 A;  3HHM B;  3VS3 A;  1A09 A;  1AYC A;  2CIA A;  1A08 A;  2CS0 A;  3N8M A;  1CSZ A;  3N84 A;  2LNW A;  1TZE E;  1Y57 A;  1FBV A;  1FU5 A;  1JYU A;  2SRC A;  4P9Z A;  3PFV A;  1BHF A;  4OHH A;  5BO4 A;  1O4G A;  3IN8 A;  1BHH B;  1HCS B;  2K7A B;  1AYA A;  4DGX A;  1SKJ A;  2OZO A;  1O4M A;  3BUM B;  3HCK A;  1GHU A;  3WA4 A;  3PJP A;  1LUI A;  3BUX B;  3BKB A;  2Y3A B;  1LUN A;  1JWO A;  1WQU A;  3KFJ A;  5DC9 A;  1RJA A;  1JYQ A;  3CWG A;  3S8N A;  3VS7 A;  5J3X A;  1HCT B;  1F1W A;  2HDX A;  1AYD A;  3C7I A;  1QG1 E;  1OPL A;  4GL9 E;  1O4B A;  5CDW A;  1UUR A;  1O4D A;  2L6K A;  1TCE A;  2EO6 A;  5EHR A;  1X0N A;  2AOA A;  4LUD A;  2QMS A;  4LUE A;  2GE9 A;  1SPS A;  1FYR A;  4F59 A;  2MQI A;  1KC2 A;  4L1B B;  1X6C A;  2AOB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...