2MK2A

Solution nmr structure of n-terminal domain (sh2 domain) of human inositol polyphosphate phosphatase-like protein 1 (inppl1) (fragment 20-117), northeast structural genomics consortium target hr9134a
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
109
structure length
109
Chain Sequence
b'MGHHHHHHSHMSWYHRDLSRAAAEELLARAGRDGSFLVRDSESVAGAFALCVLYQKHVHTYRILPDGEDFLAVQTSQGVPVRRFQTLGELIGLYAQPNQGLVCALLLPV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 2
publication title Solution NMR structure of N-terminal domain (SH2 domain) of human Inositol polyphosphate phosphatase-like protein 1 (INPPL1) (fragment 20-117), Northeast Structural Genomics Consortium Target HR9134A.
rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 18
structure length 109
sequence length 109
ec nomenclature ec 3.1.3.86: Phosphatidylinositol-3,4,5-trisphosphate 5-phosphatase.
pdb deposition date 2014-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00017 SH2 SH2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.505.10 Alpha Beta 2-Layer Sandwich SHC Adaptor Protein SH2 domain 2mk2A00
1B47A 4F59A 3PJPA 1O49A 1NRVA 2HDVA 5HKWA 1FHSA 3HIZB 1SPSA 2EO3A 2IUIA 1O4RA 2L3TA 1O45A 2RSYA 2MK2A 1O4LA 1O4CA 2VIFA 3TL0A 1AB2A 3VS7A 3K2MA 2LNWA 1G83A 1BFIA 1O4BA 1UURA 1D1ZA 1BHFA 3BUWB 2XP1A 3IN8A 1BM2A 1Y1UA 1Y57A 1M27A 2RVFA 1GRIA 1TZEE 3S8NA 2PNBA 2LQWA 1O4HA 1O4FA 1R1SA 4H1OA 1SKJA 1LCKA 1YVHA 2HCKA 1LUNA 4EY0A 4LUEA 4NWGA 2DVJA 1M61A 2ETZA 3VS1A 1R1QA 2RORA 3IMDA 3S8LA 4D8KA 3VS5A 1RJAA 5BO4A 2EL8A 4OHHA 4OHLA 1SHBA 1O4GA 3PLFB 5D0JA 3VRPA 1AYCA 1GHUA 2L6KA 4DGXA 2DLZA 1LKKA 4GWFA 1A81A 5DC9A 3MXYA 1A07A 1AYAA 2AOBA 3EAZA 3HCKA 1LUIA 4TZIA 3OP0A 2H46E 5EEQA 3VRYA 1LUMA 1ZFPE 3VGOA 3BUOB 4JGHA 1D4WA 3OV1A 1A1EA 5IBMA 1KA6A 5AXIA 2H5KA 2JYQA 1XA6A 2LQNA 2DX0A 1QADA 2EKXA 2IUGA 1SPRA 2EO6A 1O41A 2K79B 4FL2A 1O4JA 2DCRA 2IZVA 5KAZA 1KSWA 3CXLA 3S9KA 2CI8A 2SHPA 1BMBA 3CBLA 3N84A 1CWEA 2MQIA 1A1BA 2RMXA 1FU5A 3CD3A 5EHRA 2MRKA 5IBSA 1AOTF 3GXXA 5GJHA 4GPLB 4FL3A 3BUNB 3VS2A 1O4KA 1IS0A 2BBUA 2EU0A 4JE4A 1BLJA 3ZNIA 4K44A 1A1AA 1O4AA 4P9ZA 1BHHA 3OB2B 1RPYA 1K9AA 2LNXA 3N8MA 1AYDA 5DF6A 3UYOA 1Z3KA 1I3ZA 1BKMA 2C0OA 2ABLA 2EYZA 1RQQC 1KC2A 1OO3A 1BG1A 2HMHA 2SRCA 3VRQA 2OQ1A 4X6SA 4XZ0A 1FBZA 2PTKA 4H34A 1BHHB 1O4MA 5CDWA 1F2FA 1F1WA 4M4ZA 4EIHA 3EACA 1JWOA 4U17A 2CR4A 3VRNA 4F5AA 1OPKA 1AOUF 1CSZA 5I6VA 2CBLA 3MXCA 1UUSA 4DGPA 1FYRA 1O4QA 3BUXB 2FO0A 2KK6A 1BKLA 1LUKA 1HCTB 3HHMB 3US4A 3T04A 1O4IA 2PNAA 2HUWA 1KA7A 1X27A 3VS6A 1H9OA 4LUDA 2EOBA 4FBNA 1CJ1A 2C0IA 1YVLA 1PICA 3VROA 1O44A 3OB1B 4F5BA 2CS0A 1NZLA 1A1CA 2AOAA 4K11A 2K7AB 1LCJA 5HKZA 1JYUA 2EYVA 3WA4A 3PS5A 2QMSA 5GJIA 2B3OA 2C9WA 4A4BA 1O42A 3BUMB 1FBVA 1QG1E 4OHEA 4E68A 5EHPA 1TCEA 1D4TA 1LKLA 2PLEA 1OPLA 4A4CA 3GXWA 1O4PA 2Y1NA 3N7YA 3BKBA 3TKZA 3UF4A 1A09A 1AD5A 2YSXA 2CIAA 4U1PA 5DC4A 1SHAA 1O4EA 4L1BB 2HDXA 1FMKA 3PFVA 2KNOA 1X6CA 1AYBA 4OHIA 2Y1MA 3VRZA 1BLKA 1O43A 5J3XA 2ECDA 3PSJA 2CRHA 3QWYA 2FCIA 3C7IA 2CI9A 4NWFA 2IUHA 3S8OA 1CSYA 1O4NA 1R1PA 2H8HA 3IMJA 2Y3AB 3VS4A 1A08A 2AUGA 1X0NA 2DLYA 1P13A 3NHNA 1OO4A 1O48A 1O4OA 4GL9E 1HCSB 1JYRA 4K45A 3VS0A 5AULA 1IJRA 3OVEA 1O47A 2GE9A 3PQZA 2OZOA 1SHDA 3MAZA 4ROJA 2MC1A 5DC0B 1MW4A 3GQIB 2GSBA 4WWQA 1FU6A 4XZ1A 2YU7A 3IN7A 4QSYA 1O4DA 2EYYA 3M7FA 5HKYA 3KFJA 1CWDL 3PSKA 2L4KA 1BFJA 3VRRA 1JYQA 3VS3A 2PLDA 3CWGA 1WQUA 1NZVA 2MRJA 2DM0A 1BF5A 4OHDA 1O46A 1JU5A 5EELA 1MILA 4K2RA 4E93A 2C0TA 5EG3B 3QWXX 4JEGA 1QCFA 2LCTA 4P9VA
chains in the Genus database with same CATH superfamily
1B47A 4F59A 3PJPA 1O49A 1NRVA 2HDVA 5HKWA 1FHSA 3HIZB 1SPSA 2EO3A 2IUIA 1O4RA 2L3TA 1O45A 2RSYA 2MK2A 1O4LA 1O4CA 2VIFA 3TL0A 1AB2A 3VS7A 3K2MA 2LNWA 1G83A 1BFIA 1O4BA 1UURA 1D1ZA 1BHFA 3BUWB 2XP1A 3IN8A 1BM2A 1Y1UA 1Y57A 1M27A 2RVFA 1GRIA 1TZEE 3S8NA 2PNBA 2LQWA 1O4HA 1O4FA 1R1SA 4H1OA 1SKJA 1LCKA 1YVHA 2HCKA 1LUNA 4EY0A 4LUEA 4NWGA 2DVJA 1M61A 2ETZA 3VS1A 1R1QA 2RORA 3IMDA 3S8LA 4D8KA 3VS5A 1RJAA 5BO4A 2EL8A 4OHHA 4OHLA 1SHBA 1O4GA 3PLFB 5D0JA 3VRPA 1AYCA 1GHUA 2L6KA 4DGXA 2DLZA 1LKKA 4GWFA 1A81A 5DC9A 3MXYA 1A07A 1AYAA 2AOBA 3EAZA 3HCKA 1LUIA 4TZIA 3OP0A 2H46E 5EEQA 3VRYA 1LUMA 1ZFPE 3VGOA 3LYVA 3BUOB 4JGHA 1D4WA 3OV1A 1A1EA 5IBMA 1KA6A 5AXIA 2H5KA 2JYQA 1XA6A 2LQNA 2DX0A 1QADA 2EKXA 2IUGA 1SPRA 2EO6A 1O41A 2K79B 4FL2A 1O4JA 2DCRA 2IZVA 5KAZA 1KSWA 3CXLA 3S9KA 2CI8A 2SHPA 1BMBA 3CBLA 3N84A 1CWEA 2MQIA 1A1BA 2RMXA 1FU5A 3CD3A 5EHRA 2MRKA 5IBSA 1AOTF 3GXXA 5GJHA 4GPLB 4FL3A 3BUNB 3VS2A 1O4KA 1IS0A 2BBUA 2EU0A 4JE4A 1BLJA 3ZNIA 4K44A 1A1AA 1O4AA 4P9ZA 1BHHA 3OB2B 1RPYA 1K9AA 2LNXA 3N8MA 1AYDA 5DF6A 3UYOA 1Z3KA 1I3ZA 1BKMA 2C0OA 2ABLA 2EYZA 1RQQC 1KC2A 1OO3A 1BG1A 2HMHA 2SRCA 3VRQA 2OQ1A 4X6SA 4XZ0A 1FBZA 2PTKA 4H34A 1BHHB 1O4MA 5CDWA 1F2FA 1F1WA 4M4ZA 4EIHA 3EACA 1JWOA 4U17A 2CR4A 3VRNA 4F5AA 1OPKA 1AOUF 1CSZA 5I6VA 2CBLA 3MXCA 1UUSA 4DGPA 2LRAA 1FYRA 1O4QA 3BUXB 2FO0A 2KK6A 1BKLA 1LUKA 1HCTB 3HHMB 3US4A 3T04A 1O4IA 2PNAA 2HUWA 1KA7A 1X27A 3VS6A 1H9OA 4LUDA 2EOBA 4FBNA 1CJ1A 2C0IA 1YVLA 1PICA 3VROA 1O44A 3OB1B 4F5BA 2CS0A 1NZLA 1A1CA 2AOAA 4K11A 2K7AB 1LCJA 5HKZA 1JYUA 2EYVA 3WA4A 3PS5A 2QMSA 5GJIA 2B3OA 2C9WA 4A4BA 1O42A 3BUMB 1FBVA 1QG1E 4OHEA 4E68A 5EHPA 1TCEA 1D4TA 1LKLA 2PLEA 1OPLA 4A4CA 3GXWA 1O4PA 2Y1NA 3N7YA 3BKBA 3TKZA 3UF4A 1A09A 1AD5A 2YSXA 2CIAA 4U1PA 5DC4A 1SHAA 1O4EA 4L1BB 2HDXA 1FMKA 3PFVA 2KNOA 1X6CA 1AYBA 4OHIA 2Y1MA 3VRZA 1BLKA 1O43A 5J3XA 2ECDA 3PSJA 2CRHA 3QWYA 2FCIA 3C7IA 2CI9A 4NWFA 2IUHA 3S8OA 1CSYA 1O4NA 1R1PA 2H8HA 3IMJA 2Y3AB 3VS4A 1A08A 2AUGA 1X0NA 2DLYA 1P13A 3NHNA 1OO4A 1O48A 1O4OA 4GL9E 1HCSB 1JYRA 4K45A 3VS0A 5AULA 1IJRA 3OVEA 1O47A 2GE9A 3PQZA 2OZOA 1SHDA 3MAZA 4ROJA 2MC1A 5DC0B 1MW4A 3GQIB 2GSBA 4WWQA 1FU6A 3K2TA 4XZ1A 2YU7A 3IN7A 4QSYA 1O4DA 2EYYA 2KGYA 3M7FA 5HKYA 3KFJA 1CWDL 3PSKA 2L4KA 1BFJA 3VRRA 1JYQA 3VS3A 2PLDA 3CWGA 1WQUA 1NZVA 2MRJA 2DM0A 1BF5A 4OHDA 1O46A 1JU5A 5EELA 1MILA 4K2RA 4E93A 2C0TA 5EG3B 3QWXX 4JEGA 1QCFA 2LCTA 4P9VA
chains in the Genus database with same CATH topology
1B47A 4F59A 3PJPA 1O49A 1NRVA 2HDVA 5HKWA 1FHSA 3HIZB 1SPSA 2EO3A 2IUIA 1O4RA 2L3TA 1O45A 2RSYA 2MK2A 1O4LA 1O4CA 2VIFA 3TL0A 1AB2A 3VS7A 3K2MA 2LNWA 1G83A 1BFIA 1O4BA 1UURA 1D1ZA 1BHFA 3BUWB 2XP1A 3IN8A 1BM2A 1Y1UA 1Y57A 1M27A 2RVFA 1GRIA 1TZEE 3S8NA 2PNBA 2LQWA 1O4HA 1O4FA 1R1SA 4H1OA 1SKJA 1LCKA 1YVHA 2HCKA 1LUNA 4EY0A 4LUEA 4NWGA 2DVJA 1M61A 2ETZA 3VS1A 1R1QA 2RORA 3IMDA 3S8LA 4D8KA 3VS5A 1RJAA 5BO4A 2EL8A 4OHHA 4OHLA 1SHBA 1O4GA 3PLFB 5D0JA 3VRPA 1AYCA 1GHUA 2L6KA 4DGXA 2DLZA 1LKKA 4GWFA 1A81A 5DC9A 3MXYA 1A07A 1AYAA 2AOBA 3EAZA 3HCKA 1LUIA 4TZIA 3OP0A 2H46E 5EEQA 3VRYA 1LUMA 1ZFPE 3VGOA 3BUOB 4JGHA 1D4WA 3OV1A 1A1EA 5IBMA 1KA6A 5AXIA 2H5KA 2JYQA 1XA6A 2LQNA 2DX0A 1QADA 2EKXA 2IUGA 1SPRA 2EO6A 1O41A 2K79B 4FL2A 1O4JA 2DCRA 2IZVA 5KAZA 1KSWA 3CXLA 3S9KA 2CI8A 2SHPA 1BMBA 3CBLA 3N84A 1CWEA 2MQIA 1A1BA 2RMXA 1FU5A 3CD3A 5EHRA 2MRKA 5IBSA 1AOTF 3GXXA 5GJHA 4GPLB 4FL3A 3BUNB 3VS2A 1O4KA 1IS0A 2BBUA 2EU0A 4JE4A 1BLJA 3ZNIA 4K44A 1A1AA 1O4AA 4P9ZA 1BHHA 3OB2B 1RPYA 1K9AA 2LNXA 3N8MA 1AYDA 5DF6A 3UYOA 1Z3KA 1I3ZA 1BKMA 2C0OA 2ABLA 2EYZA 1RQQC 1KC2A 1OO3A 1BG1A 2HMHA 2SRCA 3VRQA 2OQ1A 4X6SA 4XZ0A 1FBZA 2PTKA 4H34A 1BHHB 1O4MA 5CDWA 1F2FA 1F1WA 4M4ZA 4EIHA 3EACA 1JWOA 4U17A 2CR4A 3VRNA 4F5AA 1OPKA 1AOUF 1CSZA 5I6VA 2CBLA 3MXCA 1UUSA 4DGPA 1FYRA 1O4QA 3BUXB 2FO0A 2KK6A 1BKLA 1LUKA 1HCTB 3HHMB 3US4A 3T04A 1O4IA 2PNAA 2HUWA 1KA7A 1X27A 3VS6A 1H9OA 4LUDA 2EOBA 4FBNA 1CJ1A 2C0IA 1YVLA 1PICA 3VROA 1O44A 3OB1B 4F5BA 2CS0A 1NZLA 1A1CA 2AOAA 4K11A 2K7AB 1LCJA 5HKZA 1JYUA 2EYVA 3WA4A 3PS5A 2QMSA 5GJIA 2B3OA 2C9WA 4A4BA 1O42A 3BUMB 1FBVA 1QG1E 4OHEA 4E68A 5EHPA 1TCEA 1D4TA 1LKLA 2PLEA 1OPLA 4A4CA 3GXWA 1O4PA 2Y1NA 3N7YA 3BKBA 3TKZA 3UF4A 1A09A 1AD5A 2YSXA 2CIAA 4U1PA 5DC4A 1SHAA 1O4EA 4L1BB 2HDXA 1FMKA 3PFVA 2KNOA 1X6CA 1AYBA 4OHIA 2Y1MA 3VRZA 1BLKA 1O43A 5J3XA 2ECDA 3PSJA 2CRHA 3QWYA 2FCIA 3C7IA 2CI9A 4NWFA 2IUHA 3S8OA 1CSYA 1O4NA 1R1PA 2H8HA 3IMJA 2Y3AB 3VS4A 1A08A 2AUGA 1X0NA 2DLYA 1P13A 3NHNA 1OO4A 1O48A 1O4OA 4GL9E 1HCSB 1JYRA 4K45A 3VS0A 5AULA 1IJRA 3OVEA 1O47A 2GE9A 3PQZA 2OZOA 1SHDA 3MAZA 4ROJA 2MC1A 5DC0B 1MW4A 3GQIB 2GSBA 4WWQA 1FU6A 4XZ1A 2YU7A 3IN7A 4QSYA 1O4DA 2EYYA 3M7FA 5HKYA 3KFJA 1CWDL 3PSKA 2L4KA 1BFJA 3VRRA 1JYQA 3VS3A 2PLDA 3CWGA 1WQUA 1NZVA 2MRJA 2DM0A 1BF5A 4OHDA 1O46A 1JU5A 5EELA 1MILA 4K2RA 4E93A 2C0TA 5EG3B 3QWXX 4JEGA 1QCFA 2LCTA 4P9VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1B47 A;  4F59 A;  3PJP A;  1O49 A;  1NRV A;  2HDV A;  5HKW A;  1FHS A;  3HIZ B;  1SPS A;  2EO3 A;  2IUI A;  1O4R A;  2L3T A;  1O45 A;  2RSY A;  2MK2 A;  1O4L A;  1O4C A;  2VIF A;  3TL0 A;  1AB2 A;  3VS7 A;  3K2M A;  2LNW A;  1G83 A;  1BFI A;  1O4B A;  1UUR A;  1D1Z A;  1BHF A;  3BUW B;  2XP1 A;  3IN8 A;  1BM2 A;  1Y1U A;  1Y57 A;  1M27 A;  2RVF A;  1GRI A;  1TZE E;  3S8N A;  2PNB A;  2LQW A;  1O4H A;  1O4F A;  1R1S A;  4H1O A;  1SKJ A;  1LCK A;  1YVH A;  2HCK A;  1LUN A;  4EY0 A;  4LUE A;  4NWG A;  2DVJ A;  1M61 A;  2ETZ A;  3VS1 A;  1R1Q A;  2ROR A;  3IMD A;  3S8L A;  4D8K A;  3VS5 A;  1RJA A;  5BO4 A;  2EL8 A;  4OHH A;  4OHL A;  1SHB A;  1O4G A;  3PLF B;  5D0J A;  3VRP A;  1AYC A;  1GHU A;  2L6K A;  4DGX A;  2DLZ A;  1LKK A;  4GWF A;  1A81 A;  5DC9 A;  3MXY A;  1A07 A;  1AYA A;  2AOB A;  3EAZ A;  3HCK A;  1LUI A;  4TZI A;  3OP0 A;  2H46 E;  5EEQ A;  3VRY A;  1LUM A;  1ZFP E;  3VGO A;  3BUO B;  4JGH A;  1D4W A;  3OV1 A;  1A1E A;  5IBM A;  1KA6 A;  5AXI A;  2H5K A;  2JYQ A;  1XA6 A;  2LQN A;  2DX0 A;  1QAD A;  2EKX A;  2IUG A;  1SPR A;  2EO6 A;  1O41 A;  2K79 B;  4FL2 A;  1O4J A;  2DCR A;  2IZV A;  5KAZ A;  1KSW A;  3CXL A;  3S9K A;  2CI8 A;  2SHP A;  1BMB A;  3CBL A;  3N84 A;  1CWE A;  2MQI A;  1A1B A;  2RMX A;  1FU5 A;  3CD3 A;  5EHR A;  2MRK A;  5IBS A;  1AOT F;  3GXX A;  5GJH A;  4GPL B;  4FL3 A;  3BUN B;  3VS2 A;  1O4K A;  1IS0 A;  2BBU A;  2EU0 A;  4JE4 A;  1BLJ A;  3ZNI A;  4K44 A;  1A1A A;  1O4A A;  4P9Z A;  1BHH A;  3OB2 B;  1RPY A;  1K9A A;  2LNX A;  3N8M A;  1AYD A;  5DF6 A;  3UYO A;  1Z3K A;  1I3Z A;  1BKM A;  2C0O A;  2ABL A;  2EYZ A;  1RQQ C;  1KC2 A;  1OO3 A;  1BG1 A;  2HMH A;  2SRC A;  3VRQ A;  2OQ1 A;  4X6S A;  4XZ0 A;  1FBZ A;  2PTK A;  4H34 A;  1BHH B;  1O4M A;  5CDW A;  1F2F A;  1F1W A;  4M4Z A;  4EIH A;  3EAC A;  1JWO A;  4U17 A;  2CR4 A;  3VRN A;  4F5A A;  1OPK A;  1AOU F;  1CSZ A;  5I6V A;  2CBL A;  3MXC A;  1UUS A;  4DGP A;  1FYR A;  1O4Q A;  3BUX B;  2FO0 A;  2KK6 A;  1BKL A;  1LUK A;  1HCT B;  3HHM B;  3US4 A;  3T04 A;  1O4I A;  2PNA A;  2HUW A;  1KA7 A;  1X27 A;  3VS6 A;  1H9O A;  4LUD A;  2EOB A;  4FBN A;  1CJ1 A;  2C0I A;  1YVL A;  1PIC A;  3VRO A;  1O44 A;  3OB1 B;  4F5B A;  2CS0 A;  1NZL A;  1A1C A;  2AOA A;  4K11 A;  2K7A B;  1LCJ A;  5HKZ A;  1JYU A;  2EYV A;  3WA4 A;  3PS5 A;  2QMS A;  5GJI A;  2B3O A;  2C9W A;  4A4B A;  1O42 A;  3BUM B;  1FBV A;  1QG1 E;  4OHE A;  4E68 A;  5EHP A;  1TCE A;  1D4T A;  1LKL A;  2PLE A;  1OPL A;  4A4C A;  3GXW A;  1O4P A;  2Y1N A;  3N7Y A;  3BKB A;  3TKZ A;  3UF4 A;  1A09 A;  1AD5 A;  2YSX A;  2CIA A;  4U1P A;  5DC4 A;  1SHA A;  1O4E A;  4L1B B;  2HDX A;  1FMK A;  3PFV A;  2KNO A;  1X6C A;  1AYB A;  4OHI A;  2Y1M A;  3VRZ A;  1BLK A;  1O43 A;  5J3X A;  2ECD A;  3PSJ A;  2CRH A;  3QWY A;  2FCI A;  3C7I A;  2CI9 A;  4NWF A;  2IUH A;  3S8O A;  1CSY A;  1O4N A;  1R1P A;  2H8H A;  3IMJ A;  2Y3A B;  3VS4 A;  1A08 A;  2AUG A;  1X0N A;  2DLY A;  1P13 A;  3NHN A;  1OO4 A;  1O48 A;  1O4O A;  4GL9 E;  1HCS B;  1JYR A;  4K45 A;  3VS0 A;  5AUL A;  1IJR A;  3OVE A;  1O47 A;  2GE9 A;  3PQZ A;  2OZO A;  1SHD A;  3MAZ A;  4ROJ A;  2MC1 A;  5DC0 B;  1MW4 A;  3GQI B;  2GSB A;  4WWQ A;  1FU6 A;  4XZ1 A;  2YU7 A;  3IN7 A;  4QSY A;  1O4D A;  2EYY A;  3M7F A;  5HKY A;  3KFJ A;  1CWD L;  3PSK A;  2L4K A;  1BFJ A;  3VRR A;  1JYQ A;  3VS3 A;  2PLD A;  3CWG A;  1WQU A;  1NZV A;  2MRJ A;  2DM0 A;  1BF5 A;  4OHD A;  1O46 A;  1JU5 A;  5EEL A;  1MIL A;  4K2R A;  4E93 A;  2C0T A;  5EG3 B;  3QWX X;  4JEG A;  1QCF A;  2LCT A;  4P9V A; 
#chains in the Genus database with same CATH topology
 1B47 A;  4F59 A;  3PJP A;  1O49 A;  1NRV A;  2HDV A;  5HKW A;  1FHS A;  3HIZ B;  1SPS A;  2EO3 A;  2IUI A;  1O4R A;  2L3T A;  1O45 A;  2RSY A;  2MK2 A;  1O4L A;  1O4C A;  2VIF A;  3TL0 A;  1AB2 A;  3VS7 A;  3K2M A;  2LNW A;  1G83 A;  1BFI A;  1O4B A;  1UUR A;  1D1Z A;  1BHF A;  3BUW B;  2XP1 A;  3IN8 A;  1BM2 A;  1Y1U A;  1Y57 A;  1M27 A;  2RVF A;  1GRI A;  1TZE E;  3S8N A;  2PNB A;  2LQW A;  1O4H A;  1O4F A;  1R1S A;  4H1O A;  1SKJ A;  1LCK A;  1YVH A;  2HCK A;  1LUN A;  4EY0 A;  4LUE A;  4NWG A;  2DVJ A;  1M61 A;  2ETZ A;  3VS1 A;  1R1Q A;  2ROR A;  3IMD A;  3S8L A;  4D8K A;  3VS5 A;  1RJA A;  5BO4 A;  2EL8 A;  4OHH A;  4OHL A;  1SHB A;  1O4G A;  3PLF B;  5D0J A;  3VRP A;  1AYC A;  1GHU A;  2L6K A;  4DGX A;  2DLZ A;  1LKK A;  4GWF A;  1A81 A;  5DC9 A;  3MXY A;  1A07 A;  1AYA A;  2AOB A;  3EAZ A;  3HCK A;  1LUI A;  4TZI A;  3OP0 A;  2H46 E;  5EEQ A;  3VRY A;  1LUM A;  1ZFP E;  3VGO A;  3LYV A;  3BUO B;  4JGH A;  1D4W A;  3OV1 A;  1A1E A;  5IBM A;  1KA6 A;  5AXI A;  2H5K A;  2JYQ A;  1XA6 A;  2LQN A;  2DX0 A;  1QAD A;  2EKX A;  2IUG A;  1SPR A;  2EO6 A;  1O41 A;  2K79 B;  4FL2 A;  1O4J A;  2DCR A;  2IZV A;  5KAZ A;  1KSW A;  3CXL A;  3S9K A;  2CI8 A;  2SHP A;  1BMB A;  3CBL A;  3N84 A;  1CWE A;  2MQI A;  1A1B A;  2RMX A;  1FU5 A;  3CD3 A;  5EHR A;  2MRK A;  5IBS A;  1AOT F;  3GXX A;  5GJH A;  4GPL B;  4FL3 A;  3BUN B;  3VS2 A;  1O4K A;  1IS0 A;  2BBU A;  2EU0 A;  4JE4 A;  1BLJ A;  3ZNI A;  4K44 A;  1A1A A;  1O4A A;  4P9Z A;  1BHH A;  3OB2 B;  1RPY A;  1K9A A;  2LNX A;  3N8M A;  1AYD A;  5DF6 A;  3UYO A;  1Z3K A;  1I3Z A;  1BKM A;  2C0O A;  2ABL A;  2EYZ A;  1RQQ C;  1KC2 A;  1OO3 A;  1BG1 A;  2HMH A;  2SRC A;  3VRQ A;  2OQ1 A;  4X6S A;  4XZ0 A;  1FBZ A;  2PTK A;  4H34 A;  1BHH B;  1O4M A;  5CDW A;  1F2F A;  1F1W A;  4M4Z A;  4EIH A;  3EAC A;  1JWO A;  4U17 A;  2CR4 A;  3VRN A;  4F5A A;  1OPK A;  1AOU F;  1CSZ A;  5I6V A;  2CBL A;  3MXC A;  1UUS A;  4DGP A;  2LRA A;  1FYR A;  1O4Q A;  3BUX B;  2FO0 A;  2KK6 A;  1BKL A;  1LUK A;  1HCT B;  3HHM B;  3US4 A;  3T04 A;  1O4I A;  2PNA A;  2HUW A;  1KA7 A;  1X27 A;  3VS6 A;  1H9O A;  4LUD A;  2EOB A;  4FBN A;  1CJ1 A;  2C0I A;  1YVL A;  1PIC A;  3VRO A;  1O44 A;  3OB1 B;  4F5B A;  2CS0 A;  1NZL A;  1A1C A;  2AOA A;  4K11 A;  2K7A B;  1LCJ A;  5HKZ A;  1JYU A;  2EYV A;  3WA4 A;  3PS5 A;  2QMS A;  5GJI A;  2B3O A;  2C9W A;  4A4B A;  1O42 A;  3BUM B;  1FBV A;  1QG1 E;  4OHE A;  4E68 A;  5EHP A;  1TCE A;  1D4T A;  1LKL A;  2PLE A;  1OPL A;  4A4C A;  3GXW A;  1O4P A;  2Y1N A;  3N7Y A;  3BKB A;  3TKZ A;  3UF4 A;  1A09 A;  1AD5 A;  2YSX A;  2CIA A;  4U1P A;  5DC4 A;  1SHA A;  1O4E A;  4L1B B;  2HDX A;  1FMK A;  3PFV A;  2KNO A;  1X6C A;  1AYB A;  4OHI A;  2Y1M A;  3VRZ A;  1BLK A;  1O43 A;  5J3X A;  2ECD A;  3PSJ A;  2CRH A;  3QWY A;  2FCI A;  3C7I A;  2CI9 A;  4NWF A;  2IUH A;  3S8O A;  1CSY A;  1O4N A;  1R1P A;  2H8H A;  3IMJ A;  2Y3A B;  3VS4 A;  1A08 A;  2AUG A;  1X0N A;  2DLY A;  1P13 A;  3NHN A;  1OO4 A;  1O48 A;  1O4O A;  4GL9 E;  1HCS B;  1JYR A;  4K45 A;  3VS0 A;  5AUL A;  1IJR A;  3OVE A;  1O47 A;  2GE9 A;  3PQZ A;  2OZO A;  1SHD A;  3MAZ A;  4ROJ A;  2MC1 A;  5DC0 B;  1MW4 A;  3GQI B;  2GSB A;  4WWQ A;  1FU6 A;  3K2T A;  4XZ1 A;  2YU7 A;  3IN7 A;  4QSY A;  1O4D A;  2EYY A;  2KGY A;  3M7F A;  5HKY A;  3KFJ A;  1CWD L;  3PSK A;  2L4K A;  1BFJ A;  3VRR A;  1JYQ A;  3VS3 A;  2PLD A;  3CWG A;  1WQU A;  1NZV A;  2MRJ A;  2DM0 A;  1BF5 A;  4OHD A;  1O46 A;  1JU5 A;  5EEL A;  1MIL A;  4K2R A;  4E93 A;  2C0T A;  5EG3 B;  3QWX X;  4JEG A;  1QCF A;  2LCT A;  4P9V A; 
#chains in the Genus database with same CATH homology
 1B47 A;  4F59 A;  3PJP A;  1O49 A;  1NRV A;  2HDV A;  5HKW A;  1FHS A;  3HIZ B;  1SPS A;  2EO3 A;  2IUI A;  1O4R A;  2L3T A;  1O45 A;  2RSY A;  2MK2 A;  1O4L A;  1O4C A;  2VIF A;  3TL0 A;  1AB2 A;  3VS7 A;  3K2M A;  2LNW A;  1G83 A;  1BFI A;  1O4B A;  1UUR A;  1D1Z A;  1BHF A;  3BUW B;  2XP1 A;  3IN8 A;  1BM2 A;  1Y1U A;  1Y57 A;  1M27 A;  2RVF A;  1GRI A;  1TZE E;  3S8N A;  2PNB A;  2LQW A;  1O4H A;  1O4F A;  1R1S A;  4H1O A;  1SKJ A;  1LCK A;  1YVH A;  2HCK A;  1LUN A;  4EY0 A;  4LUE A;  4NWG A;  2DVJ A;  1M61 A;  2ETZ A;  3VS1 A;  1R1Q A;  2ROR A;  3IMD A;  3S8L A;  4D8K A;  3VS5 A;  1RJA A;  5BO4 A;  2EL8 A;  4OHH A;  4OHL A;  1SHB A;  1O4G A;  3PLF B;  5D0J A;  3VRP A;  1AYC A;  1GHU A;  2L6K A;  4DGX A;  2DLZ A;  1LKK A;  4GWF A;  1A81 A;  5DC9 A;  3MXY A;  1A07 A;  1AYA A;  2AOB A;  3EAZ A;  3HCK A;  1LUI A;  4TZI A;  3OP0 A;  2H46 E;  5EEQ A;  3VRY A;  1LUM A;  1ZFP E;  3VGO A;  3BUO B;  4JGH A;  1D4W A;  3OV1 A;  1A1E A;  5IBM A;  1KA6 A;  5AXI A;  2H5K A;  2JYQ A;  1XA6 A;  2LQN A;  2DX0 A;  1QAD A;  2EKX A;  2IUG A;  1SPR A;  2EO6 A;  1O41 A;  2K79 B;  4FL2 A;  1O4J A;  2DCR A;  2IZV A;  5KAZ A;  1KSW A;  3CXL A;  3S9K A;  2CI8 A;  2SHP A;  1BMB A;  3CBL A;  3N84 A;  1CWE A;  2MQI A;  1A1B A;  2RMX A;  1FU5 A;  3CD3 A;  5EHR A;  2MRK A;  5IBS A;  1AOT F;  3GXX A;  5GJH A;  4GPL B;  4FL3 A;  3BUN B;  3VS2 A;  1O4K A;  1IS0 A;  2BBU A;  2EU0 A;  4JE4 A;  1BLJ A;  3ZNI A;  4K44 A;  1A1A A;  1O4A A;  4P9Z A;  1BHH A;  3OB2 B;  1RPY A;  1K9A A;  2LNX A;  3N8M A;  1AYD A;  5DF6 A;  3UYO A;  1Z3K A;  1I3Z A;  1BKM A;  2C0O A;  2ABL A;  2EYZ A;  1RQQ C;  1KC2 A;  1OO3 A;  1BG1 A;  2HMH A;  2SRC A;  3VRQ A;  2OQ1 A;  4X6S A;  4XZ0 A;  1FBZ A;  2PTK A;  4H34 A;  1BHH B;  1O4M A;  5CDW A;  1F2F A;  1F1W A;  4M4Z A;  4EIH A;  3EAC A;  1JWO A;  4U17 A;  2CR4 A;  3VRN A;  4F5A A;  1OPK A;  1AOU F;  1CSZ A;  5I6V A;  2CBL A;  3MXC A;  1UUS A;  4DGP A;  1FYR A;  1O4Q A;  3BUX B;  2FO0 A;  2KK6 A;  1BKL A;  1LUK A;  1HCT B;  3HHM B;  3US4 A;  3T04 A;  1O4I A;  2PNA A;  2HUW A;  1KA7 A;  1X27 A;  3VS6 A;  1H9O A;  4LUD A;  2EOB A;  4FBN A;  1CJ1 A;  2C0I A;  1YVL A;  1PIC A;  3VRO A;  1O44 A;  3OB1 B;  4F5B A;  2CS0 A;  1NZL A;  1A1C A;  2AOA A;  4K11 A;  2K7A B;  1LCJ A;  5HKZ A;  1JYU A;  2EYV A;  3WA4 A;  3PS5 A;  2QMS A;  5GJI A;  2B3O A;  2C9W A;  4A4B A;  1O42 A;  3BUM B;  1FBV A;  1QG1 E;  4OHE A;  4E68 A;  5EHP A;  1TCE A;  1D4T A;  1LKL A;  2PLE A;  1OPL A;  4A4C A;  3GXW A;  1O4P A;  2Y1N A;  3N7Y A;  3BKB A;  3TKZ A;  3UF4 A;  1A09 A;  1AD5 A;  2YSX A;  2CIA A;  4U1P A;  5DC4 A;  1SHA A;  1O4E A;  4L1B B;  2HDX A;  1FMK A;  3PFV A;  2KNO A;  1X6C A;  1AYB A;  4OHI A;  2Y1M A;  3VRZ A;  1BLK A;  1O43 A;  5J3X A;  2ECD A;  3PSJ A;  2CRH A;  3QWY A;  2FCI A;  3C7I A;  2CI9 A;  4NWF A;  2IUH A;  3S8O A;  1CSY A;  1O4N A;  1R1P A;  2H8H A;  3IMJ A;  2Y3A B;  3VS4 A;  1A08 A;  2AUG A;  1X0N A;  2DLY A;  1P13 A;  3NHN A;  1OO4 A;  1O48 A;  1O4O A;  4GL9 E;  1HCS B;  1JYR A;  4K45 A;  3VS0 A;  5AUL A;  1IJR A;  3OVE A;  1O47 A;  2GE9 A;  3PQZ A;  2OZO A;  1SHD A;  3MAZ A;  4ROJ A;  2MC1 A;  5DC0 B;  1MW4 A;  3GQI B;  2GSB A;  4WWQ A;  1FU6 A;  4XZ1 A;  2YU7 A;  3IN7 A;  4QSY A;  1O4D A;  2EYY A;  3M7F A;  5HKY A;  3KFJ A;  1CWD L;  3PSK A;  2L4K A;  1BFJ A;  3VRR A;  1JYQ A;  3VS3 A;  2PLD A;  3CWG A;  1WQU A;  1NZV A;  2MRJ A;  2DM0 A;  1BF5 A;  4OHD A;  1O46 A;  1JU5 A;  5EEL A;  1MIL A;  4K2R A;  4E93 A;  2C0T A;  5EG3 B;  3QWX X;  4JEG A;  1QCF A;  2LCT A;  4P9V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...