1WQUA

Solution structure of the human fes sh2 domain
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
114
structure length
114
Chain Sequence
b'GSSGSSGEVQKPLHEQLWYHGAIPRAEVAELLVHSGDFLVRESQGKQEYVLSVLWDGLPRHFIIQSLDNLYRLEGEGFPSIPLLIDHLLSTQQPLTKKSGVVLHRAVPSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Proto-oncogene tyrosine-protein kinase FES/FPS
publication title Solution structure of the Src homology 2 domain from the human feline sarcoma oncogene Fes
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 18
structure length 114
sequence length 114
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2004-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00017 SH2 SH2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.505.10 Alpha Beta 2-Layer Sandwich SHC Adaptor Protein SH2 domain 1wquA00
3PSJA 1O41A 1BKMA 4U17A 4F5BA 1AYBA 1SHDA 3OB1B 4TZIA 1GHUA 4FL3A 1JWOA 5DF6A 2EKXA 5CDWA 2EYZA 1MILA 1BLJA 5HKZA 1Y57A 5HKYA 1RPYA 4F5AA 2DX0A 3EAZA 3M7FA 4EIHA 4U1PA 4OHDA 5IBSA 2K7AB 1O45A 1FBVA 1LKLA 1R1QA 3MXYA 1HCTB 1O4CA 2IZVA 5J3XA 1X6CA 1O4FA 2EOBA 2DM0A 1GRIA 2Y1MA 2YU7A 3VGOA 4ROJA 1H9OA 2SRCA 1BHHA 1NZVA 1JYQA 2LQWA 4GWFA 3HHMB 4DGPA 1G83A 1YVLA 2AUGA 2EO3A 1I3ZA 1O4OA 1BLKA 2LNXA 4P9VA 3CXLA 4QSYA 4DGXA 1SHBA 1M27A 1O4MA 1LUIA 1AOUF 2RSYA 2MQIA 2LNWA 3BUXB 1QADA 3IN7A 1F1WA 5EHPA 4JEGA 3N7YA 1RQQC 1BMBA 1AD5A 2DLYA 1FBZA 1BG1A 5DC4A 3C7IA 2C0IA 1O4RA 4K2RA 3S9KA 1JYRA 3S8NA 3OV1A 3OP0A 3UF4A 1FYRA 2CIAA 5I6VA 1P13A 1SPRA 1LUKA 1O4AA 3ZNIA 4A4CA 2RVFA 2PTKA 5GJHA 2IUHA 1CSZA 3VRRA 1UUSA 2C0OA 1KA6A 1Y1UA 3VS7A 2CI8A 3VROA 2IUIA 2PNAA 5D0JA 2AOAA 3PSKA 1O4NA 2Y1NA 2LCTA 5AULA 2FCIA 4JE4A 3S8LA 4H1OA 1AYAA 2QMSA 1IS0A 3TL0A 3IN8A 4L1BB 2L4KA 2DCRA 4OHHA 1M61A 3QWYA 1AYDA 4OHIA 5KAZA 2HUWA 1KSWA 1JYUA 2EYVA 2HDXA 3PJPA 2Y3AB 1FMKA 1BF5A 2JYQA 1LKKA 4E68A 4NWGA 1R1PA 2GSBA 1O44A 3VRQA 5BO4A 1UURA 1LUMA 1Z3KA 1O4KA 5DC0B 3BUNB 4EY0A 1R1SA 1A1BA 1BFIA 3VS2A 2YSXA 1A1CA 1CWEA 2HMHA 3WA4A 2L6KA 3VRYA 1QCFA 3MXCA 1NZLA 4XZ1A 4LUEA 4OHEA 3KFJA 2VIFA 5EG3B 3PQZA 1RJAA 2CI9A 2CR4A 4GL9E 1TCEA 3T04A 1K9AA 3K2MA 1LUNA 3PFVA 1KA7A 4OHLA 3N84A 1SPSA 3VS0A 4M4ZA 2H46E 1AOTF 1O4GA 2C0TA 2BBUA 1O4QA 3VRZA 1BFJA 3IMDA 1O46A 2OZOA 5EELA 2MK2A 3N8MA 3BUWB 4GPLB 3VS5A 5IBMA 2ETZA 1CWDL 1O4IA 2FO0A 1BM2A 1O4EA 1O4HA 2RMXA 4JGHA 3UYOA 1D4TA 1O48A 4X6SA 3CD3A 1A1EA 1BKLA 2DVJA 3GXXA 2H5KA 3GQIB 2IUGA 4K45A 1LCJA 3QWXX 2CBLA 1CJ1A 3GXWA 2PNBA 5AXIA 1A1AA 4P9ZA 4F59A 2RORA 2HDVA 5GJIA 1FHSA 1OO3A 2KK6A 3CBLA 1O4LA 1FU5A 1TZEE 1HCSB 1A07A 2OQ1A 4D8KA 1D1ZA 2HCKA 4FBNA 5EHRA 1O47A 2PLDA 3S8OA 1XA6A 3NHNA 2H8HA 2ABLA 1ZFPE 2XP1A 3PS5A 1A09A 1O4JA 1O49A 1IJRA 3VS6A 1X27A 1LCKA 1QG1E 3CWGA 3PLFB 1F2FA 1JU5A 4K44A 4LUDA 2B3OA 2MC1A 3BKBA 2SHPA 5HKWA 3IMJA 1O4PA 3VS4A 1AB2A 2L3TA 3US4A 2CRHA 2EU0A 1MW4A 1PICA 3HIZB 1O4BA 2DLZA 2KNOA 2EO6A 4K11A 1BHHB 1SKJA 1O42A 4A4BA 2AOBA 2CS0A 3VS3A 2LQNA 3VRPA 2K79B 2ECDA 3VS1A 4WWQA 3OB2B 1OO4A 1SHAA 4NWFA 3TKZA 2PLEA 4FL2A 2EYYA 2GE9A 3BUMB 4H34A 1X0NA 1BHFA 2EL8A 4XZ0A 1OPKA 1CSYA 5DC9A 1AYCA 3MAZA 1O4DA 1NRVA 3HCKA 1D4WA 1O43A 1KC2A 1FU6A 3VRNA 1A08A 2MRKA 1WQUA 4E93A 1YVHA 5EEQA 1B47A 3EACA 1A81A 2MRJA 1OPLA 3BUOB 2C9WA 3OVEA
chains in the Genus database with same CATH superfamily
3PSJA 1O41A 1BKMA 4U17A 4F5BA 1AYBA 1SHDA 3OB1B 4TZIA 1GHUA 4FL3A 1JWOA 5DF6A 2EKXA 5CDWA 2EYZA 1MILA 1BLJA 5HKZA 1Y57A 5HKYA 1RPYA 4F5AA 2DX0A 3EAZA 3M7FA 4EIHA 4U1PA 4OHDA 5IBSA 2K7AB 1O45A 1FBVA 1LKLA 1R1QA 3MXYA 1HCTB 1O4CA 2IZVA 5J3XA 1X6CA 1O4FA 2EOBA 2DM0A 1GRIA 2Y1MA 2YU7A 3VGOA 4ROJA 3LYVA 1H9OA 2SRCA 1BHHA 1NZVA 1JYQA 2LQWA 4GWFA 3HHMB 4DGPA 1G83A 1YVLA 2AUGA 2EO3A 1I3ZA 1O4OA 1BLKA 2LNXA 4P9VA 3CXLA 4QSYA 4DGXA 1SHBA 1M27A 1O4MA 1LUIA 1AOUF 2RSYA 2MQIA 2LNWA 3BUXB 1QADA 3IN7A 3K2TA 1F1WA 5EHPA 4JEGA 3N7YA 1RQQC 1BMBA 1AD5A 2DLYA 1FBZA 1BG1A 5DC4A 3C7IA 2C0IA 1O4RA 4K2RA 3S9KA 1JYRA 3S8NA 3OV1A 3OP0A 3UF4A 1FYRA 2CIAA 5I6VA 1P13A 1SPRA 1LUKA 1O4AA 3ZNIA 4A4CA 2RVFA 2PTKA 5GJHA 2IUHA 1CSZA 3VRRA 1UUSA 2C0OA 1KA6A 1Y1UA 3VS7A 2LRAA 2KGYA 2CI8A 3VROA 2IUIA 2PNAA 5D0JA 2AOAA 3PSKA 1O4NA 2Y1NA 2LCTA 5AULA 2FCIA 4JE4A 3S8LA 4H1OA 1AYAA 2QMSA 1IS0A 3TL0A 3IN8A 4L1BB 2L4KA 2DCRA 4OHHA 1M61A 3QWYA 1AYDA 4OHIA 5KAZA 2HUWA 1KSWA 1JYUA 2EYVA 2HDXA 3PJPA 2Y3AB 1FMKA 1BF5A 2JYQA 1LKKA 4E68A 4NWGA 1R1PA 2GSBA 1O44A 3VRQA 5BO4A 1UURA 1LUMA 1Z3KA 1O4KA 5DC0B 3BUNB 4EY0A 1R1SA 1A1BA 1BFIA 3VS2A 2YSXA 1A1CA 1CWEA 2HMHA 3WA4A 2L6KA 3VRYA 1QCFA 3MXCA 1NZLA 4XZ1A 4LUEA 4OHEA 3KFJA 2VIFA 5EG3B 3PQZA 1RJAA 2CI9A 2CR4A 4GL9E 1TCEA 3T04A 1K9AA 3K2MA 1LUNA 3PFVA 1KA7A 4OHLA 3N84A 1SPSA 3VS0A 4M4ZA 2H46E 1AOTF 1O4GA 2C0TA 2BBUA 1O4QA 3VRZA 1BFJA 3IMDA 1O46A 2OZOA 5EELA 2MK2A 3N8MA 3BUWB 4GPLB 3VS5A 5IBMA 2ETZA 1CWDL 1O4IA 2FO0A 1BM2A 1O4EA 1O4HA 2RMXA 4JGHA 3UYOA 1D4TA 1O48A 4X6SA 3CD3A 1A1EA 1BKLA 2DVJA 3GXXA 2H5KA 3GQIB 2IUGA 4K45A 1LCJA 3QWXX 2CBLA 1CJ1A 3GXWA 2PNBA 5AXIA 1A1AA 4P9ZA 4F59A 2RORA 2HDVA 5GJIA 1FHSA 1OO3A 2KK6A 3CBLA 1O4LA 1FU5A 1TZEE 1HCSB 1A07A 2OQ1A 4D8KA 1D1ZA 2HCKA 4FBNA 5EHRA 1O47A 2PLDA 3S8OA 1XA6A 3NHNA 2H8HA 2ABLA 1ZFPE 2XP1A 3PS5A 1A09A 1O4JA 1O49A 1IJRA 3VS6A 1X27A 1LCKA 1QG1E 3CWGA 3PLFB 1F2FA 1JU5A 4K44A 4LUDA 2B3OA 2MC1A 3BKBA 2SHPA 5HKWA 3IMJA 1O4PA 3VS4A 1AB2A 2L3TA 3US4A 2CRHA 2EU0A 1MW4A 1PICA 3HIZB 1O4BA 2DLZA 2KNOA 2EO6A 4K11A 1BHHB 1SKJA 1O42A 4A4BA 2AOBA 2CS0A 3VS3A 2LQNA 3VRPA 2K79B 2ECDA 3VS1A 4WWQA 3OB2B 1OO4A 1SHAA 4NWFA 3TKZA 2PLEA 4FL2A 2EYYA 2GE9A 3BUMB 4H34A 1X0NA 1BHFA 2EL8A 4XZ0A 1OPKA 1CSYA 5DC9A 1AYCA 3MAZA 1O4DA 1NRVA 3HCKA 1D4WA 1O43A 1KC2A 1FU6A 3VRNA 1A08A 2MRKA 1WQUA 4E93A 1YVHA 5EEQA 1B47A 3EACA 1A81A 2MRJA 1OPLA 3BUOB 2C9WA 3OVEA
chains in the Genus database with same CATH topology
3PSJA 1O41A 1BKMA 4U17A 4F5BA 1AYBA 1SHDA 3OB1B 4TZIA 1GHUA 4FL3A 1JWOA 5DF6A 2EKXA 5CDWA 2EYZA 1MILA 1BLJA 5HKZA 1Y57A 5HKYA 1RPYA 4F5AA 2DX0A 3EAZA 3M7FA 4EIHA 4U1PA 4OHDA 5IBSA 2K7AB 1O45A 1FBVA 1LKLA 1R1QA 3MXYA 1HCTB 1O4CA 2IZVA 5J3XA 1X6CA 1O4FA 2EOBA 2DM0A 1GRIA 2Y1MA 2YU7A 3VGOA 4ROJA 1H9OA 2SRCA 1BHHA 1NZVA 1JYQA 2LQWA 4GWFA 3HHMB 4DGPA 1G83A 1YVLA 2AUGA 2EO3A 1I3ZA 1O4OA 1BLKA 2LNXA 4P9VA 3CXLA 4QSYA 4DGXA 1SHBA 1M27A 1O4MA 1LUIA 1AOUF 2RSYA 2MQIA 2LNWA 3BUXB 1QADA 3IN7A 1F1WA 5EHPA 4JEGA 3N7YA 1RQQC 1BMBA 1AD5A 2DLYA 1FBZA 1BG1A 5DC4A 3C7IA 2C0IA 1O4RA 4K2RA 3S9KA 1JYRA 3S8NA 3OV1A 3OP0A 3UF4A 1FYRA 2CIAA 5I6VA 1P13A 1SPRA 1LUKA 1O4AA 3ZNIA 4A4CA 2RVFA 2PTKA 5GJHA 2IUHA 1CSZA 3VRRA 1UUSA 2C0OA 1KA6A 1Y1UA 3VS7A 2CI8A 3VROA 2IUIA 2PNAA 5D0JA 2AOAA 3PSKA 1O4NA 2Y1NA 2LCTA 5AULA 2FCIA 4JE4A 3S8LA 4H1OA 1AYAA 2QMSA 1IS0A 3TL0A 3IN8A 4L1BB 2L4KA 2DCRA 4OHHA 1M61A 3QWYA 1AYDA 4OHIA 5KAZA 2HUWA 1KSWA 1JYUA 2EYVA 2HDXA 3PJPA 2Y3AB 1FMKA 1BF5A 2JYQA 1LKKA 4E68A 4NWGA 1R1PA 2GSBA 1O44A 3VRQA 5BO4A 1UURA 1LUMA 1Z3KA 1O4KA 5DC0B 3BUNB 4EY0A 1R1SA 1A1BA 1BFIA 3VS2A 2YSXA 1A1CA 1CWEA 2HMHA 3WA4A 2L6KA 3VRYA 1QCFA 3MXCA 1NZLA 4XZ1A 4LUEA 4OHEA 3KFJA 2VIFA 5EG3B 3PQZA 1RJAA 2CI9A 2CR4A 4GL9E 1TCEA 3T04A 1K9AA 3K2MA 1LUNA 3PFVA 1KA7A 4OHLA 3N84A 1SPSA 3VS0A 4M4ZA 2H46E 1AOTF 1O4GA 2C0TA 2BBUA 1O4QA 3VRZA 1BFJA 3IMDA 1O46A 2OZOA 5EELA 2MK2A 3N8MA 3BUWB 4GPLB 3VS5A 5IBMA 2ETZA 1CWDL 1O4IA 2FO0A 1BM2A 1O4EA 1O4HA 2RMXA 4JGHA 3UYOA 1D4TA 1O48A 4X6SA 3CD3A 1A1EA 1BKLA 2DVJA 3GXXA 2H5KA 3GQIB 2IUGA 4K45A 1LCJA 3QWXX 2CBLA 1CJ1A 3GXWA 2PNBA 5AXIA 1A1AA 4P9ZA 4F59A 2RORA 2HDVA 5GJIA 1FHSA 1OO3A 2KK6A 3CBLA 1O4LA 1FU5A 1TZEE 1HCSB 1A07A 2OQ1A 4D8KA 1D1ZA 2HCKA 4FBNA 5EHRA 1O47A 2PLDA 3S8OA 1XA6A 3NHNA 2H8HA 2ABLA 1ZFPE 2XP1A 3PS5A 1A09A 1O4JA 1O49A 1IJRA 3VS6A 1X27A 1LCKA 1QG1E 3CWGA 3PLFB 1F2FA 1JU5A 4K44A 4LUDA 2B3OA 2MC1A 3BKBA 2SHPA 5HKWA 3IMJA 1O4PA 3VS4A 1AB2A 2L3TA 3US4A 2CRHA 2EU0A 1MW4A 1PICA 3HIZB 1O4BA 2DLZA 2KNOA 2EO6A 4K11A 1BHHB 1SKJA 1O42A 4A4BA 2AOBA 2CS0A 3VS3A 2LQNA 3VRPA 2K79B 2ECDA 3VS1A 4WWQA 3OB2B 1OO4A 1SHAA 4NWFA 3TKZA 2PLEA 4FL2A 2EYYA 2GE9A 3BUMB 4H34A 1X0NA 1BHFA 2EL8A 4XZ0A 1OPKA 1CSYA 5DC9A 1AYCA 3MAZA 1O4DA 1NRVA 3HCKA 1D4WA 1O43A 1KC2A 1FU6A 3VRNA 1A08A 2MRKA 1WQUA 4E93A 1YVHA 5EEQA 1B47A 3EACA 1A81A 2MRJA 1OPLA 3BUOB 2C9WA 3OVEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PSJ A;  1O41 A;  1BKM A;  4U17 A;  4F5B A;  1AYB A;  1SHD A;  3OB1 B;  4TZI A;  1GHU A;  4FL3 A;  1JWO A;  5DF6 A;  2EKX A;  5CDW A;  2EYZ A;  1MIL A;  1BLJ A;  5HKZ A;  1Y57 A;  5HKY A;  1RPY A;  4F5A A;  2DX0 A;  3EAZ A;  3M7F A;  4EIH A;  4U1P A;  4OHD A;  5IBS A;  2K7A B;  1O45 A;  1FBV A;  1LKL A;  1R1Q A;  3MXY A;  1HCT B;  1O4C A;  2IZV A;  5J3X A;  1X6C A;  1O4F A;  2EOB A;  2DM0 A;  1GRI A;  2Y1M A;  2YU7 A;  3VGO A;  4ROJ A;  1H9O A;  2SRC A;  1BHH A;  1NZV A;  1JYQ A;  2LQW A;  4GWF A;  3HHM B;  4DGP A;  1G83 A;  1YVL A;  2AUG A;  2EO3 A;  1I3Z A;  1O4O A;  1BLK A;  2LNX A;  4P9V A;  3CXL A;  4QSY A;  4DGX A;  1SHB A;  1M27 A;  1O4M A;  1LUI A;  1AOU F;  2RSY A;  2MQI A;  2LNW A;  3BUX B;  1QAD A;  3IN7 A;  1F1W A;  5EHP A;  4JEG A;  3N7Y A;  1RQQ C;  1BMB A;  1AD5 A;  2DLY A;  1FBZ A;  1BG1 A;  5DC4 A;  3C7I A;  2C0I A;  1O4R A;  4K2R A;  3S9K A;  1JYR A;  3S8N A;  3OV1 A;  3OP0 A;  3UF4 A;  1FYR A;  2CIA A;  5I6V A;  1P13 A;  1SPR A;  1LUK A;  1O4A A;  3ZNI A;  4A4C A;  2RVF A;  2PTK A;  5GJH A;  2IUH A;  1CSZ A;  3VRR A;  1UUS A;  2C0O A;  1KA6 A;  1Y1U A;  3VS7 A;  2CI8 A;  3VRO A;  2IUI A;  2PNA A;  5D0J A;  2AOA A;  3PSK A;  1O4N A;  2Y1N A;  2LCT A;  5AUL A;  2FCI A;  4JE4 A;  3S8L A;  4H1O A;  1AYA A;  2QMS A;  1IS0 A;  3TL0 A;  3IN8 A;  4L1B B;  2L4K A;  2DCR A;  4OHH A;  1M61 A;  3QWY A;  1AYD A;  4OHI A;  5KAZ A;  2HUW A;  1KSW A;  1JYU A;  2EYV A;  2HDX A;  3PJP A;  2Y3A B;  1FMK A;  1BF5 A;  2JYQ A;  1LKK A;  4E68 A;  4NWG A;  1R1P A;  2GSB A;  1O44 A;  3VRQ A;  5BO4 A;  1UUR A;  1LUM A;  1Z3K A;  1O4K A;  5DC0 B;  3BUN B;  4EY0 A;  1R1S A;  1A1B A;  1BFI A;  3VS2 A;  2YSX A;  1A1C A;  1CWE A;  2HMH A;  3WA4 A;  2L6K A;  3VRY A;  1QCF A;  3MXC A;  1NZL A;  4XZ1 A;  4LUE A;  4OHE A;  3KFJ A;  2VIF A;  5EG3 B;  3PQZ A;  1RJA A;  2CI9 A;  2CR4 A;  4GL9 E;  1TCE A;  3T04 A;  1K9A A;  3K2M A;  1LUN A;  3PFV A;  1KA7 A;  4OHL A;  3N84 A;  1SPS A;  3VS0 A;  4M4Z A;  2H46 E;  1AOT F;  1O4G A;  2C0T A;  2BBU A;  1O4Q A;  3VRZ A;  1BFJ A;  3IMD A;  1O46 A;  2OZO A;  5EEL A;  2MK2 A;  3N8M A;  3BUW B;  4GPL B;  3VS5 A;  5IBM A;  2ETZ A;  1CWD L;  1O4I A;  2FO0 A;  1BM2 A;  1O4E A;  1O4H A;  2RMX A;  4JGH A;  3UYO A;  1D4T A;  1O48 A;  4X6S A;  3CD3 A;  1A1E A;  1BKL A;  2DVJ A;  3GXX A;  2H5K A;  3GQI B;  2IUG A;  4K45 A;  1LCJ A;  3QWX X;  2CBL A;  1CJ1 A;  3GXW A;  2PNB A;  5AXI A;  1A1A A;  4P9Z A;  4F59 A;  2ROR A;  2HDV A;  5GJI A;  1FHS A;  1OO3 A;  2KK6 A;  3CBL A;  1O4L A;  1FU5 A;  1TZE E;  1HCS B;  1A07 A;  2OQ1 A;  4D8K A;  1D1Z A;  2HCK A;  4FBN A;  5EHR A;  1O47 A;  2PLD A;  3S8O A;  1XA6 A;  3NHN A;  2H8H A;  2ABL A;  1ZFP E;  2XP1 A;  3PS5 A;  1A09 A;  1O4J A;  1O49 A;  1IJR A;  3VS6 A;  1X27 A;  1LCK A;  1QG1 E;  3CWG A;  3PLF B;  1F2F A;  1JU5 A;  4K44 A;  4LUD A;  2B3O A;  2MC1 A;  3BKB A;  2SHP A;  5HKW A;  3IMJ A;  1O4P A;  3VS4 A;  1AB2 A;  2L3T A;  3US4 A;  2CRH A;  2EU0 A;  1MW4 A;  1PIC A;  3HIZ B;  1O4B A;  2DLZ A;  2KNO A;  2EO6 A;  4K11 A;  1BHH B;  1SKJ A;  1O42 A;  4A4B A;  2AOB A;  2CS0 A;  3VS3 A;  2LQN A;  3VRP A;  2K79 B;  2ECD A;  3VS1 A;  4WWQ A;  3OB2 B;  1OO4 A;  1SHA A;  4NWF A;  3TKZ A;  2PLE A;  4FL2 A;  2EYY A;  2GE9 A;  3BUM B;  4H34 A;  1X0N A;  1BHF A;  2EL8 A;  4XZ0 A;  1OPK A;  1CSY A;  5DC9 A;  1AYC A;  3MAZ A;  1O4D A;  1NRV A;  3HCK A;  1D4W A;  1O43 A;  1KC2 A;  1FU6 A;  3VRN A;  1A08 A;  2MRK A;  1WQU A;  4E93 A;  1YVH A;  5EEQ A;  1B47 A;  3EAC A;  1A81 A;  2MRJ A;  1OPL A;  3BUO B;  2C9W A;  3OVE A; 
#chains in the Genus database with same CATH topology
 3PSJ A;  1O41 A;  1BKM A;  4U17 A;  4F5B A;  1AYB A;  1SHD A;  3OB1 B;  4TZI A;  1GHU A;  4FL3 A;  1JWO A;  5DF6 A;  2EKX A;  5CDW A;  2EYZ A;  1MIL A;  1BLJ A;  5HKZ A;  1Y57 A;  5HKY A;  1RPY A;  4F5A A;  2DX0 A;  3EAZ A;  3M7F A;  4EIH A;  4U1P A;  4OHD A;  5IBS A;  2K7A B;  1O45 A;  1FBV A;  1LKL A;  1R1Q A;  3MXY A;  1HCT B;  1O4C A;  2IZV A;  5J3X A;  1X6C A;  1O4F A;  2EOB A;  2DM0 A;  1GRI A;  2Y1M A;  2YU7 A;  3VGO A;  4ROJ A;  3LYV A;  1H9O A;  2SRC A;  1BHH A;  1NZV A;  1JYQ A;  2LQW A;  4GWF A;  3HHM B;  4DGP A;  1G83 A;  1YVL A;  2AUG A;  2EO3 A;  1I3Z A;  1O4O A;  1BLK A;  2LNX A;  4P9V A;  3CXL A;  4QSY A;  4DGX A;  1SHB A;  1M27 A;  1O4M A;  1LUI A;  1AOU F;  2RSY A;  2MQI A;  2LNW A;  3BUX B;  1QAD A;  3IN7 A;  3K2T A;  1F1W A;  5EHP A;  4JEG A;  3N7Y A;  1RQQ C;  1BMB A;  1AD5 A;  2DLY A;  1FBZ A;  1BG1 A;  5DC4 A;  3C7I A;  2C0I A;  1O4R A;  4K2R A;  3S9K A;  1JYR A;  3S8N A;  3OV1 A;  3OP0 A;  3UF4 A;  1FYR A;  2CIA A;  5I6V A;  1P13 A;  1SPR A;  1LUK A;  1O4A A;  3ZNI A;  4A4C A;  2RVF A;  2PTK A;  5GJH A;  2IUH A;  1CSZ A;  3VRR A;  1UUS A;  2C0O A;  1KA6 A;  1Y1U A;  3VS7 A;  2LRA A;  2KGY A;  2CI8 A;  3VRO A;  2IUI A;  2PNA A;  5D0J A;  2AOA A;  3PSK A;  1O4N A;  2Y1N A;  2LCT A;  5AUL A;  2FCI A;  4JE4 A;  3S8L A;  4H1O A;  1AYA A;  2QMS A;  1IS0 A;  3TL0 A;  3IN8 A;  4L1B B;  2L4K A;  2DCR A;  4OHH A;  1M61 A;  3QWY A;  1AYD A;  4OHI A;  5KAZ A;  2HUW A;  1KSW A;  1JYU A;  2EYV A;  2HDX A;  3PJP A;  2Y3A B;  1FMK A;  1BF5 A;  2JYQ A;  1LKK A;  4E68 A;  4NWG A;  1R1P A;  2GSB A;  1O44 A;  3VRQ A;  5BO4 A;  1UUR A;  1LUM A;  1Z3K A;  1O4K A;  5DC0 B;  3BUN B;  4EY0 A;  1R1S A;  1A1B A;  1BFI A;  3VS2 A;  2YSX A;  1A1C A;  1CWE A;  2HMH A;  3WA4 A;  2L6K A;  3VRY A;  1QCF A;  3MXC A;  1NZL A;  4XZ1 A;  4LUE A;  4OHE A;  3KFJ A;  2VIF A;  5EG3 B;  3PQZ A;  1RJA A;  2CI9 A;  2CR4 A;  4GL9 E;  1TCE A;  3T04 A;  1K9A A;  3K2M A;  1LUN A;  3PFV A;  1KA7 A;  4OHL A;  3N84 A;  1SPS A;  3VS0 A;  4M4Z A;  2H46 E;  1AOT F;  1O4G A;  2C0T A;  2BBU A;  1O4Q A;  3VRZ A;  1BFJ A;  3IMD A;  1O46 A;  2OZO A;  5EEL A;  2MK2 A;  3N8M A;  3BUW B;  4GPL B;  3VS5 A;  5IBM A;  2ETZ A;  1CWD L;  1O4I A;  2FO0 A;  1BM2 A;  1O4E A;  1O4H A;  2RMX A;  4JGH A;  3UYO A;  1D4T A;  1O48 A;  4X6S A;  3CD3 A;  1A1E A;  1BKL A;  2DVJ A;  3GXX A;  2H5K A;  3GQI B;  2IUG A;  4K45 A;  1LCJ A;  3QWX X;  2CBL A;  1CJ1 A;  3GXW A;  2PNB A;  5AXI A;  1A1A A;  4P9Z A;  4F59 A;  2ROR A;  2HDV A;  5GJI A;  1FHS A;  1OO3 A;  2KK6 A;  3CBL A;  1O4L A;  1FU5 A;  1TZE E;  1HCS B;  1A07 A;  2OQ1 A;  4D8K A;  1D1Z A;  2HCK A;  4FBN A;  5EHR A;  1O47 A;  2PLD A;  3S8O A;  1XA6 A;  3NHN A;  2H8H A;  2ABL A;  1ZFP E;  2XP1 A;  3PS5 A;  1A09 A;  1O4J A;  1O49 A;  1IJR A;  3VS6 A;  1X27 A;  1LCK A;  1QG1 E;  3CWG A;  3PLF B;  1F2F A;  1JU5 A;  4K44 A;  4LUD A;  2B3O A;  2MC1 A;  3BKB A;  2SHP A;  5HKW A;  3IMJ A;  1O4P A;  3VS4 A;  1AB2 A;  2L3T A;  3US4 A;  2CRH A;  2EU0 A;  1MW4 A;  1PIC A;  3HIZ B;  1O4B A;  2DLZ A;  2KNO A;  2EO6 A;  4K11 A;  1BHH B;  1SKJ A;  1O42 A;  4A4B A;  2AOB A;  2CS0 A;  3VS3 A;  2LQN A;  3VRP A;  2K79 B;  2ECD A;  3VS1 A;  4WWQ A;  3OB2 B;  1OO4 A;  1SHA A;  4NWF A;  3TKZ A;  2PLE A;  4FL2 A;  2EYY A;  2GE9 A;  3BUM B;  4H34 A;  1X0N A;  1BHF A;  2EL8 A;  4XZ0 A;  1OPK A;  1CSY A;  5DC9 A;  1AYC A;  3MAZ A;  1O4D A;  1NRV A;  3HCK A;  1D4W A;  1O43 A;  1KC2 A;  1FU6 A;  3VRN A;  1A08 A;  2MRK A;  1WQU A;  4E93 A;  1YVH A;  5EEQ A;  1B47 A;  3EAC A;  1A81 A;  2MRJ A;  1OPL A;  3BUO B;  2C9W A;  3OVE A; 
#chains in the Genus database with same CATH homology
 3PSJ A;  1O41 A;  1BKM A;  4U17 A;  4F5B A;  1AYB A;  1SHD A;  3OB1 B;  4TZI A;  1GHU A;  4FL3 A;  1JWO A;  5DF6 A;  2EKX A;  5CDW A;  2EYZ A;  1MIL A;  1BLJ A;  5HKZ A;  1Y57 A;  5HKY A;  1RPY A;  4F5A A;  2DX0 A;  3EAZ A;  3M7F A;  4EIH A;  4U1P A;  4OHD A;  5IBS A;  2K7A B;  1O45 A;  1FBV A;  1LKL A;  1R1Q A;  3MXY A;  1HCT B;  1O4C A;  2IZV A;  5J3X A;  1X6C A;  1O4F A;  2EOB A;  2DM0 A;  1GRI A;  2Y1M A;  2YU7 A;  3VGO A;  4ROJ A;  1H9O A;  2SRC A;  1BHH A;  1NZV A;  1JYQ A;  2LQW A;  4GWF A;  3HHM B;  4DGP A;  1G83 A;  1YVL A;  2AUG A;  2EO3 A;  1I3Z A;  1O4O A;  1BLK A;  2LNX A;  4P9V A;  3CXL A;  4QSY A;  4DGX A;  1SHB A;  1M27 A;  1O4M A;  1LUI A;  1AOU F;  2RSY A;  2MQI A;  2LNW A;  3BUX B;  1QAD A;  3IN7 A;  1F1W A;  5EHP A;  4JEG A;  3N7Y A;  1RQQ C;  1BMB A;  1AD5 A;  2DLY A;  1FBZ A;  1BG1 A;  5DC4 A;  3C7I A;  2C0I A;  1O4R A;  4K2R A;  3S9K A;  1JYR A;  3S8N A;  3OV1 A;  3OP0 A;  3UF4 A;  1FYR A;  2CIA A;  5I6V A;  1P13 A;  1SPR A;  1LUK A;  1O4A A;  3ZNI A;  4A4C A;  2RVF A;  2PTK A;  5GJH A;  2IUH A;  1CSZ A;  3VRR A;  1UUS A;  2C0O A;  1KA6 A;  1Y1U A;  3VS7 A;  2CI8 A;  3VRO A;  2IUI A;  2PNA A;  5D0J A;  2AOA A;  3PSK A;  1O4N A;  2Y1N A;  2LCT A;  5AUL A;  2FCI A;  4JE4 A;  3S8L A;  4H1O A;  1AYA A;  2QMS A;  1IS0 A;  3TL0 A;  3IN8 A;  4L1B B;  2L4K A;  2DCR A;  4OHH A;  1M61 A;  3QWY A;  1AYD A;  4OHI A;  5KAZ A;  2HUW A;  1KSW A;  1JYU A;  2EYV A;  2HDX A;  3PJP A;  2Y3A B;  1FMK A;  1BF5 A;  2JYQ A;  1LKK A;  4E68 A;  4NWG A;  1R1P A;  2GSB A;  1O44 A;  3VRQ A;  5BO4 A;  1UUR A;  1LUM A;  1Z3K A;  1O4K A;  5DC0 B;  3BUN B;  4EY0 A;  1R1S A;  1A1B A;  1BFI A;  3VS2 A;  2YSX A;  1A1C A;  1CWE A;  2HMH A;  3WA4 A;  2L6K A;  3VRY A;  1QCF A;  3MXC A;  1NZL A;  4XZ1 A;  4LUE A;  4OHE A;  3KFJ A;  2VIF A;  5EG3 B;  3PQZ A;  1RJA A;  2CI9 A;  2CR4 A;  4GL9 E;  1TCE A;  3T04 A;  1K9A A;  3K2M A;  1LUN A;  3PFV A;  1KA7 A;  4OHL A;  3N84 A;  1SPS A;  3VS0 A;  4M4Z A;  2H46 E;  1AOT F;  1O4G A;  2C0T A;  2BBU A;  1O4Q A;  3VRZ A;  1BFJ A;  3IMD A;  1O46 A;  2OZO A;  5EEL A;  2MK2 A;  3N8M A;  3BUW B;  4GPL B;  3VS5 A;  5IBM A;  2ETZ A;  1CWD L;  1O4I A;  2FO0 A;  1BM2 A;  1O4E A;  1O4H A;  2RMX A;  4JGH A;  3UYO A;  1D4T A;  1O48 A;  4X6S A;  3CD3 A;  1A1E A;  1BKL A;  2DVJ A;  3GXX A;  2H5K A;  3GQI B;  2IUG A;  4K45 A;  1LCJ A;  3QWX X;  2CBL A;  1CJ1 A;  3GXW A;  2PNB A;  5AXI A;  1A1A A;  4P9Z A;  4F59 A;  2ROR A;  2HDV A;  5GJI A;  1FHS A;  1OO3 A;  2KK6 A;  3CBL A;  1O4L A;  1FU5 A;  1TZE E;  1HCS B;  1A07 A;  2OQ1 A;  4D8K A;  1D1Z A;  2HCK A;  4FBN A;  5EHR A;  1O47 A;  2PLD A;  3S8O A;  1XA6 A;  3NHN A;  2H8H A;  2ABL A;  1ZFP E;  2XP1 A;  3PS5 A;  1A09 A;  1O4J A;  1O49 A;  1IJR A;  3VS6 A;  1X27 A;  1LCK A;  1QG1 E;  3CWG A;  3PLF B;  1F2F A;  1JU5 A;  4K44 A;  4LUD A;  2B3O A;  2MC1 A;  3BKB A;  2SHP A;  5HKW A;  3IMJ A;  1O4P A;  3VS4 A;  1AB2 A;  2L3T A;  3US4 A;  2CRH A;  2EU0 A;  1MW4 A;  1PIC A;  3HIZ B;  1O4B A;  2DLZ A;  2KNO A;  2EO6 A;  4K11 A;  1BHH B;  1SKJ A;  1O42 A;  4A4B A;  2AOB A;  2CS0 A;  3VS3 A;  2LQN A;  3VRP A;  2K79 B;  2ECD A;  3VS1 A;  4WWQ A;  3OB2 B;  1OO4 A;  1SHA A;  4NWF A;  3TKZ A;  2PLE A;  4FL2 A;  2EYY A;  2GE9 A;  3BUM B;  4H34 A;  1X0N A;  1BHF A;  2EL8 A;  4XZ0 A;  1OPK A;  1CSY A;  5DC9 A;  1AYC A;  3MAZ A;  1O4D A;  1NRV A;  3HCK A;  1D4W A;  1O43 A;  1KC2 A;  1FU6 A;  3VRN A;  1A08 A;  2MRK A;  1WQU A;  4E93 A;  1YVH A;  5EEQ A;  1B47 A;  3EAC A;  1A81 A;  2MRJ A;  1OPL A;  3BUO B;  2C9W A;  3OVE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...