3K2TA

Crystal structure of lmo2511 protein from listeria monocytogenes, northeast structural genomics consortium target lkr84a
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
56
structure length
53
Chain Sequence
b'EIVRTKQKPMDSEEAVLQMNLLGHSFYVYTDAETNGTNIVYSRKDGKYGLIET'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lmo2511 protein
publication title Crystal structure of Lmo2511 protein from Listeria monocytogenes, northeast structural genomics consortium target LkR84A
rcsb
source organism Listeria monocytogenes
molecule tags Structural genomics, unknown function
total genus 8
structure length 53
sequence length 56
ec nomenclature
pdb deposition date 2009-09-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.505.50 Alpha Beta 2-Layer Sandwich SHC Adaptor Protein SHC Adaptor Protein 3k2tA01
3LYVA 3K2TA
chains in the Genus database with same CATH superfamily
1O4PA 1O47A 4JGHA 3VRRA 1O4NA 4D8KA 3VS4A 1CWEA 4LUEA 1BLJA 4JEGA 1A1BA 2Y1MA 2PNBA 3CWGA 5EEQA 4A4CA 2PLDA 3K2MA 2H8HA 2QMSA 3IN7A 2IUGA 1SHDA 3IMJA 4M4ZA 4OHHA 4GWFA 3OV1A 1A1EA 4E93A 2FO0A 2PTKA 3N7YA 5DF6A 5I6VA 2AUGA 1LKKA 1FU5A 1A07A 1OPKA 1G83A 3VS0A 4GL9E 1BKMA 3VS2A 3VRQA 1CSYA 1HCSB 2ABLA 1IS0A 1AYCA 1AD5A 3PLFB 3OVEA 2K7AB 5AXIA 5EELA 3MXCA 1A1AA 1WQUA 3VRNA 2CS0A 4U17A 5EG3B 2DLYA 3HCKA 1SHBA 4K44A 2GSBA 1FU6A 2EYVA 1QCFA 5GJHA 3IMDA 1BFIA 1GHUA 4X6SA 2IZVA 2MRJA 1K9AA 3OB2B 1CSZA 1O49A 4OHDA 1BFJA 1O45A 3UYOA 1A1CA 1LCJA 1QADA 2PLEA 1I3ZA 3VRZA 1B47A 2LNWA 2EKXA 2B3OA 2LQWA 2FCIA 5DC9A 1SHAA 3KFJA 1LUKA 5CDWA 3VRPA 1UUSA 1O46A 3BUWB 3HIZB 4U1PA 1LCKA 2EYZA 4GPLB 2H5KA 1O4HA 2LNXA 5EHRA 1O48A 1IJRA 2SHPA 1Y57A 3VS3A 1KA7A 2EL8A 3US4A 4XZ0A 4F5BA 1JYUA 1SPSA 2K79B 1P13A 2LRAA 3BUXB 1A08A 3BUOB 2EU0A 3GXWA 2KNOA 4DGPA 3TL0A 2L3TA 1LKLA 1BMBA 1R1PA 2Y3AB 1O4FA 1JYRA 1O4LA 1AB2A 2OZOA 1QG1E 3GXXA 1MILA 4K2RA 5DC4A 4ROJA 1R1QA 2C0IA 1BG1A 1O4JA 2HDVA 2AOBA 2ECDA 1RJAA 4P9VA 4E68A 4OHIA 1R1SA 3VRYA 1RPYA 1CJ1A 3PFVA 1BM2A 3VROA 2BBUA 1FHSA 1BHFA 2YSXA 3VS6A 1LUNA 4EY0A 2DX0A 2CRHA 3QWYA 1O4MA 3T04A 1Y1UA 1X0NA 3BUMB 3BUNB 1BHHA 1O4EA 5HKYA 1KSWA 2RORA 5KAZA 3VS1A 1LUIA 3S8NA 3M7FA 2C9WA 2CI8A 2Y1NA 3K2TA 1AYDA 2DM0A 1O4KA 1KC2A 4JE4A 1X6CA 4NWGA 1O4BA 4K45A 2CR4A 4XZ1A 3LYVA 3WA4A 1AYBA 1YVLA 3VS5A 4H34A 1FBZA 1A09A 2AOAA 4F5AA 1O43A 2CIAA 1TCEA 2L6KA 1BF5A 3PJPA 2EOBA 1M61A 1O4OA 3CBLA 2HDXA 2DCRA 1BHHB 4WWQA 2GE9A 1X27A 1O4DA 1H9OA 1TZEE 3GQIB 1HCTB 2JYQA 1OPLA 1O42A 2LQNA 1D4WA 4F59A 1AOTF 1GRIA 3VGOA 1FMKA 1FYRA 3MAZA 3PSKA 4OHLA 2HCKA 1SPRA 2MC1A 3IN8A 2CBLA 2PNAA 2RVFA 1BKLA 4FL3A 1O4GA 5D0JA 1O4AA 1AOUF 2MQIA 4K11A 2IUHA 2C0OA 3VS7A 1O4CA 1YVHA 1JWOA 4NWFA 1O4IA 5IBSA 2KK6A 1NRVA 2HUWA 3N84A 1PICA 1D1ZA 4TZIA 3N8MA 1UURA 5EHPA 2CI9A 1ZFPE 5HKWA 1NZLA 2EO6A 4QSYA 3MXYA 3C7IA 1O4QA 2H46E 2EO3A 3PS5A 1O41A 3OB1B 3EACA 2LCTA 1M27A 2XP1A 3HHMB 4OHEA 2DVJA 3EAZA 3NHNA 3CD3A 4EIHA 4LUDA 1F2FA 2RSYA 2L4KA 4FBNA 4FL2A 5BO4A 3QWXX 2VIFA 1Z3KA 2DLZA 1OO3A 4L1BB 3CXLA 1JU5A 1A81A 3S8LA 3PQZA 3BKBA 5DC0B 2RMXA 1XA6A 2KGYA 1BLKA 2OQ1A 3OP0A 1OO4A 1F1WA 1MW4A 1JYQA 1FBVA 4H1OA 4DGXA 4P9ZA 3ZNIA 5AULA 1AYAA 2IUIA 3S9KA 1CWDL 2YU7A 1RQQC 1NZVA 2HMHA 2SRCA 1O44A 2MRKA 3S8OA 1D4TA 2C0TA 5IBMA 1LUMA 1SKJA 2EYYA 3PSJA 5J3XA 3UF4A 4A4BA 5HKZA 1O4RA 1KA6A 2MK2A 2ETZA 5GJIA 3TKZA
chains in the Genus database with same CATH topology
3LYVA 2LRAA 2CI8A 3K2TA 2KGYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LYV A;  3K2T A; 
#chains in the Genus database with same CATH topology
 1O4P A;  1O47 A;  4JGH A;  3VRR A;  1O4N A;  4D8K A;  3VS4 A;  1CWE A;  4LUE A;  1BLJ A;  4JEG A;  1A1B A;  2Y1M A;  2PNB A;  3CWG A;  5EEQ A;  4A4C A;  2PLD A;  3K2M A;  2H8H A;  2QMS A;  3IN7 A;  2IUG A;  1SHD A;  3IMJ A;  4M4Z A;  4OHH A;  4GWF A;  3OV1 A;  1A1E A;  4E93 A;  2FO0 A;  2PTK A;  3N7Y A;  5DF6 A;  5I6V A;  2AUG A;  1LKK A;  1FU5 A;  1A07 A;  1OPK A;  1G83 A;  3VS0 A;  4GL9 E;  1BKM A;  3VS2 A;  3VRQ A;  1CSY A;  1HCS B;  2ABL A;  1IS0 A;  1AYC A;  1AD5 A;  3PLF B;  3OVE A;  2K7A B;  5AXI A;  5EEL A;  3MXC A;  1A1A A;  1WQU A;  3VRN A;  2CS0 A;  4U17 A;  5EG3 B;  2DLY A;  3HCK A;  1SHB A;  4K44 A;  2GSB A;  1FU6 A;  2EYV A;  1QCF A;  5GJH A;  3IMD A;  1BFI A;  1GHU A;  4X6S A;  2IZV A;  2MRJ A;  1K9A A;  3OB2 B;  1CSZ A;  1O49 A;  4OHD A;  1BFJ A;  1O45 A;  3UYO A;  1A1C A;  1LCJ A;  1QAD A;  2PLE A;  1I3Z A;  3VRZ A;  1B47 A;  2LNW A;  2EKX A;  2B3O A;  2LQW A;  2FCI A;  5DC9 A;  1SHA A;  3KFJ A;  1LUK A;  5CDW A;  3VRP A;  1UUS A;  1O46 A;  3BUW B;  3HIZ B;  4U1P A;  1LCK A;  2EYZ A;  4GPL B;  2H5K A;  1O4H A;  2LNX A;  5EHR A;  1O48 A;  1IJR A;  2SHP A;  1Y57 A;  3VS3 A;  1KA7 A;  2EL8 A;  3US4 A;  4XZ0 A;  4F5B A;  1JYU A;  1SPS A;  2K79 B;  1P13 A;  2LRA A;  3BUX B;  1A08 A;  3BUO B;  2EU0 A;  3GXW A;  2KNO A;  4DGP A;  3TL0 A;  2L3T A;  1LKL A;  1BMB A;  1R1P A;  2Y3A B;  1O4F A;  1JYR A;  1O4L A;  1AB2 A;  2OZO A;  1QG1 E;  3GXX A;  1MIL A;  4K2R A;  5DC4 A;  4ROJ A;  1R1Q A;  2C0I A;  1BG1 A;  1O4J A;  2HDV A;  2AOB A;  2ECD A;  1RJA A;  4P9V A;  4E68 A;  4OHI A;  1R1S A;  3VRY A;  1RPY A;  1CJ1 A;  3PFV A;  1BM2 A;  3VRO A;  2BBU A;  1FHS A;  1BHF A;  2YSX A;  3VS6 A;  1LUN A;  4EY0 A;  2DX0 A;  2CRH A;  3QWY A;  1O4M A;  3T04 A;  1Y1U A;  1X0N A;  3BUM B;  3BUN B;  1BHH A;  1O4E A;  5HKY A;  1KSW A;  2ROR A;  5KAZ A;  3VS1 A;  1LUI A;  3S8N A;  3M7F A;  2C9W A;  2CI8 A;  2Y1N A;  3K2T A;  1AYD A;  2DM0 A;  1O4K A;  1KC2 A;  4JE4 A;  1X6C A;  4NWG A;  1O4B A;  4K45 A;  2CR4 A;  4XZ1 A;  3LYV A;  3WA4 A;  1AYB A;  1YVL A;  3VS5 A;  4H34 A;  1FBZ A;  1A09 A;  2AOA A;  4F5A A;  1O43 A;  2CIA A;  1TCE A;  2L6K A;  1BF5 A;  3PJP A;  2EOB A;  1M61 A;  1O4O A;  3CBL A;  2HDX A;  2DCR A;  1BHH B;  4WWQ A;  2GE9 A;  1X27 A;  1O4D A;  1H9O A;  1TZE E;  3GQI B;  1HCT B;  2JYQ A;  1OPL A;  1O42 A;  2LQN A;  1D4W A;  4F59 A;  1AOT F;  1GRI A;  3VGO A;  1FMK A;  1FYR A;  3MAZ A;  3PSK A;  4OHL A;  2HCK A;  1SPR A;  2MC1 A;  3IN8 A;  2CBL A;  2PNA A;  2RVF A;  1BKL A;  4FL3 A;  1O4G A;  5D0J A;  1O4A A;  1AOU F;  2MQI A;  4K11 A;  2IUH A;  2C0O A;  3VS7 A;  1O4C A;  1YVH A;  1JWO A;  4NWF A;  1O4I A;  5IBS A;  2KK6 A;  1NRV A;  2HUW A;  3N84 A;  1PIC A;  1D1Z A;  4TZI A;  3N8M A;  1UUR A;  5EHP A;  2CI9 A;  1ZFP E;  5HKW A;  1NZL A;  2EO6 A;  4QSY A;  3MXY A;  3C7I A;  1O4Q A;  2H46 E;  2EO3 A;  3PS5 A;  1O41 A;  3OB1 B;  3EAC A;  2LCT A;  1M27 A;  2XP1 A;  3HHM B;  4OHE A;  2DVJ A;  3EAZ A;  3NHN A;  3CD3 A;  4EIH A;  4LUD A;  1F2F A;  2RSY A;  2L4K A;  4FBN A;  4FL2 A;  5BO4 A;  3QWX X;  2VIF A;  1Z3K A;  2DLZ A;  1OO3 A;  4L1B B;  3CXL A;  1JU5 A;  1A81 A;  3S8L A;  3PQZ A;  3BKB A;  5DC0 B;  2RMX A;  1XA6 A;  2KGY A;  1BLK A;  2OQ1 A;  3OP0 A;  1OO4 A;  1F1W A;  1MW4 A;  1JYQ A;  1FBV A;  4H1O A;  4DGX A;  4P9Z A;  3ZNI A;  5AUL A;  1AYA A;  2IUI A;  3S9K A;  1CWD L;  2YU7 A;  1RQQ C;  1NZV A;  2HMH A;  2SRC A;  1O44 A;  2MRK A;  3S8O A;  1D4T A;  2C0T A;  5IBM A;  1LUM A;  1SKJ A;  2EYY A;  3PSJ A;  5J3X A;  3UF4 A;  4A4B A;  5HKZ A;  1O4R A;  1KA6 A;  2MK2 A;  2ETZ A;  5GJI A;  3TKZ A; 
#chains in the Genus database with same CATH homology
 3LYV A;  2LRA A;  2CI8 A;  3K2T A;  2KGY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...