1O4HA

Crystal structure of sh2 in complex with ru79072.
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
106
structure length
106
Chain Sequence
b'SIQAEEWYFGKITRRESERLLLNAENPRGTFLVRESETTKGAYCLSVSDFDNAKGLNVKHYKIRKLDSGGFYITSRTQFNSLQQLVAYYSKHADGLCHRLTTVCPT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTO-ONCOGENE TYROSINE-PROTEIN KINASE SRC
publication title Requirements for specific binding of low affinity inhibitor fragments to the SH2 domain of (pp60)Src are identical to those for high affinity binding of full length inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 27
structure length 106
sequence length 106
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2003-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00017 SH2 SH2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.505.10 Alpha Beta 2-Layer Sandwich SHC Adaptor Protein SH2 domain 1o4hA00
5HKWA 3PLFB 5D0JA 2YU7A 1D4TA 1O4OA 2CS0A 2FCIA 5EHRA 1XA6A 3PQZA 1BFIA 1I3ZA 3MAZA 1AOUF 2CR4A 2EO3A 3CWGA 2JYQA 4WWQA 2GSBA 3VRQA 1AYAA 1O4QA 1A08A 1QCFA 1BG1A 5HKYA 5BO4A 3OP0A 3QWXX 1O4JA 2L3TA 1OO3A 1KA7A 2PNAA 3BKBA 2SRCA 5EHPA 1GRIA 1ZFPE 2EYYA 3PSJA 3TL0A 1A1BA 4K44A 4FL3A 2AOBA 1FHSA 1O4HA 4XZ0A 2XP1A 3TKZA 1BKMA 1IJRA 1LUNA 1LUKA 1O4EA 2DLZA 2PTKA 1AOTF 3BUWB 1O47A 4U17A 1R1QA 3CD3A 1O4CA 4EIHA 3PFVA 4E93A 1X6CA 1K9AA 1MILA 2EU0A 3IMDA 1FYRA 1A09A 3VRPA 2DLYA 2CIAA 2DX0A 4TZIA 1IS0A 1NRVA 1B47A 4K11A 4JGHA 3OB2B 3VRNA 1PICA 2EO6A 5AULA 2DM0A 5I6VA 4FL2A 5EELA 1A1CA 2LNXA 4U1PA 3VROA 5DC9A 2MRJA 3S9KA 2EL8A 1OPKA 1O49A 4F5BA 3S8NA 2RVFA 1YVHA 1CSZA 1O45A 3S8OA 1BLKA 4NWGA 1O4AA 1O4FA 1BF5A 1FMKA 4GPLB 2KNOA 2IUGA 3OV1A 1KSWA 1O4IA 3OVEA 3N7YA 2C0IA 4FBNA 1KC2A 1M61A 1SHAA 2RSYA 1O4KA 3N8MA 3PJPA 3ZNIA 1BKLA 1AYCA 2HUWA 1AD5A 1G83A 2PLEA 4D8KA 1BLJA 1JU5A 4JEGA 3KFJA 1TCEA 3VS4A 2EKXA 3MXCA 1WQUA 1Y57A 1MW4A 5DC0B 2MRKA 2VIFA 2H8HA 2HCKA 3QWYA 1FBZA 3PS5A 3K2MA 3PSKA 3HHMB 1CJ1A 5AXIA 1RQQC 1OPLA 1SPRA 3GQIB 3VGOA 3VS5A 2C0OA 1O41A 1BHFA 1BHHB 1YVLA 4F5AA 3HCKA 1AYDA 3N84A 1A1AA 1CWDL 4K45A 1GHUA 2IUHA 4H34A 3S8LA 3NHNA 2PLDA 3VS6A 1AB2A 1O4MA 1P13A 1TZEE 2Y1MA 3MXYA 1SHBA 1KA6A 1OO4A 1D4WA 2SHPA 2KK6A 2MQIA 3VS3A 4H1OA 1FU6A 4OHEA 1CSYA 2C0TA 1LCJA 4OHLA 3BUNB 2EOBA 2AOAA 3UYOA 1X0NA 2L6KA 1M27A 1JYUA 1O4DA 4GL9E 5EG3B 2H5KA 2QMSA 1X27A 2IZVA 3VS7A 1O43A 2L4KA 1BFJA 2MC1A 1NZLA 1O42A 2DCRA 1O4LA 4JE4A 1BMBA 2LQNA 1LUMA 4DGXA 2HDXA 3OB1B 1SKJA 3VRYA 1FBVA 3EAZA 3IN7A 5IBMA 2GE9A 2K7AB 1BM2A 2HDVA 5HKZA 3M7FA 1JWOA 4LUEA 2RMXA 1QG1E 2OQ1A 1A81A 3BUOB 1Y1UA 3VS0A 4A4BA 4E68A 2ECDA 1JYQA 2LNWA 4OHDA 5DF6A 2LCTA 1O4NA 2ETZA 1HCTB 1CWEA 3VRRA 5CDWA 1LCKA 3C7IA 2C9WA 4ROJA 4QSYA 1UUSA 3VRZA 2EYZA 2ABLA 1O4PA 2OZOA 2YSXA 4OHHA 3BUXB 3IN8A 3EACA 4OHIA 3GXXA 2H46E 1RJAA 2DVJA 3CXLA 1JYRA 1LKKA 2CRHA 1R1PA 2PNBA 2BBUA 4DGPA 2HMHA 5J3XA 3VS1A 2IUIA 1F1WA 1H9OA 2K79B 4M4ZA 1HCSB 2CI8A 1R1SA 2Y1NA 3BUMB 2CBLA 4F59A 3UF4A 5KAZA 2RORA 1NZVA 1AYBA 1LUIA 2EYVA 1D1ZA 2AUGA 1QADA 1O46A 1O4BA 1Z3KA 2MK2A 3GXWA 4LUDA 2B3OA 5GJIA 2LQWA 4L1BB 2Y3AB 1UURA 1O48A 5GJHA 3HIZB 1O4GA 3VS2A 4A4CA 4GWFA 1SPSA 4P9ZA 3US4A 4P9VA 1F2FA 1SHDA 1FU5A 5DC4A 1BHHA 1A1EA 1O44A 2CI9A 2FO0A 1LKLA 1RPYA 3CBLA 4X6SA 5IBSA 4XZ1A 5EEQA 4NWFA 4EY0A 4K2RA 1A07A 3IMJA 3WA4A 3T04A 1O4RA
chains in the Genus database with same CATH superfamily
5HKWA 3PLFB 5D0JA 2YU7A 1D4TA 1O4OA 2CS0A 2FCIA 5EHRA 1XA6A 3PQZA 1BFIA 1I3ZA 3MAZA 1AOUF 2CR4A 2EO3A 3CWGA 2JYQA 4WWQA 2GSBA 3VRQA 1AYAA 1O4QA 1A08A 1QCFA 1BG1A 5HKYA 5BO4A 3OP0A 3QWXX 1O4JA 2L3TA 1OO3A 1KA7A 2PNAA 3BKBA 2SRCA 5EHPA 1GRIA 1ZFPE 2EYYA 3PSJA 3TL0A 1A1BA 2LRAA 4K44A 4FL3A 2AOBA 1FHSA 1O4HA 4XZ0A 2XP1A 3TKZA 1BKMA 1IJRA 1LUNA 1LUKA 1O4EA 2DLZA 2PTKA 1AOTF 3BUWB 1O47A 4U17A 1R1QA 3CD3A 1O4CA 4EIHA 3PFVA 4E93A 1X6CA 1K9AA 1MILA 2EU0A 3IMDA 1FYRA 1A09A 3VRPA 2DLYA 2CIAA 2DX0A 4TZIA 1IS0A 1NRVA 1B47A 4K11A 4JGHA 3OB2B 3VRNA 1PICA 2EO6A 5AULA 2DM0A 5I6VA 4FL2A 5EELA 1A1CA 2LNXA 4U1PA 3VROA 5DC9A 2MRJA 3S9KA 2EL8A 1OPKA 1O49A 4F5BA 3S8NA 2RVFA 1YVHA 1CSZA 1O45A 3S8OA 1BLKA 4NWGA 1O4AA 1O4FA 1BF5A 1FMKA 4GPLB 2KNOA 2IUGA 3OV1A 1KSWA 1O4IA 3OVEA 3LYVA 3N7YA 2C0IA 4FBNA 1KC2A 1M61A 3K2TA 1SHAA 2RSYA 1O4KA 3N8MA 3PJPA 3ZNIA 1BKLA 1AYCA 2HUWA 1AD5A 1G83A 2PLEA 4D8KA 1BLJA 1JU5A 4JEGA 3KFJA 1TCEA 3VS4A 2EKXA 3MXCA 1WQUA 1Y57A 1MW4A 5DC0B 2MRKA 2VIFA 2H8HA 2HCKA 3QWYA 1FBZA 3PS5A 3K2MA 3PSKA 3HHMB 1CJ1A 5AXIA 1RQQC 1OPLA 1SPRA 3GQIB 3VGOA 3VS5A 2C0OA 1O41A 1BHFA 1BHHB 1YVLA 4F5AA 3HCKA 1AYDA 3N84A 1A1AA 1CWDL 4K45A 1GHUA 2IUHA 4H34A 3S8LA 3NHNA 2PLDA 3VS6A 1AB2A 1O4MA 1P13A 1TZEE 2Y1MA 3MXYA 1SHBA 1KA6A 1OO4A 1D4WA 2SHPA 2KK6A 2MQIA 3VS3A 4H1OA 1FU6A 4OHEA 1CSYA 2C0TA 1LCJA 4OHLA 3BUNB 2EOBA 2AOAA 3UYOA 1X0NA 2L6KA 1M27A 1JYUA 1O4DA 4GL9E 5EG3B 2H5KA 2QMSA 1X27A 2IZVA 3VS7A 1O43A 2L4KA 1BFJA 2MC1A 1NZLA 1O42A 2DCRA 1O4LA 4JE4A 1BMBA 2LQNA 1LUMA 4DGXA 2HDXA 3OB1B 1SKJA 3VRYA 1FBVA 3EAZA 3IN7A 5IBMA 2GE9A 2K7AB 1BM2A 2HDVA 5HKZA 3M7FA 1JWOA 4LUEA 2RMXA 1QG1E 2OQ1A 1A81A 3BUOB 1Y1UA 3VS0A 4A4BA 4E68A 2ECDA 1JYQA 2LNWA 4OHDA 5DF6A 2LCTA 1O4NA 2ETZA 1HCTB 1CWEA 3VRRA 5CDWA 1LCKA 3C7IA 2C9WA 4ROJA 4QSYA 1UUSA 3VRZA 2EYZA 2ABLA 1O4PA 2OZOA 2YSXA 4OHHA 3BUXB 3IN8A 3EACA 4OHIA 3GXXA 2H46E 1RJAA 2DVJA 3CXLA 1JYRA 1LKKA 2CRHA 1R1PA 2PNBA 2BBUA 4DGPA 2HMHA 5J3XA 3VS1A 2IUIA 1F1WA 1H9OA 2K79B 4M4ZA 1HCSB 2CI8A 1R1SA 2Y1NA 3BUMB 2CBLA 4F59A 3UF4A 5KAZA 2RORA 1NZVA 1AYBA 1LUIA 2EYVA 1D1ZA 2AUGA 1QADA 1O46A 1O4BA 2KGYA 1Z3KA 2MK2A 3GXWA 4LUDA 2B3OA 5GJIA 2LQWA 4L1BB 2Y3AB 1UURA 1O48A 5GJHA 3HIZB 1O4GA 3VS2A 4A4CA 4GWFA 1SPSA 4P9ZA 3US4A 4P9VA 1F2FA 1SHDA 1FU5A 5DC4A 1BHHA 1A1EA 1O44A 2CI9A 2FO0A 1LKLA 1RPYA 3CBLA 4X6SA 5IBSA 4XZ1A 5EEQA 4NWFA 4EY0A 4K2RA 1A07A 3IMJA 3WA4A 3T04A 1O4RA
chains in the Genus database with same CATH topology
5HKWA 3PLFB 5D0JA 2YU7A 1D4TA 1O4OA 2CS0A 2FCIA 5EHRA 1XA6A 3PQZA 1BFIA 1I3ZA 3MAZA 1AOUF 2CR4A 2EO3A 3CWGA 2JYQA 4WWQA 2GSBA 3VRQA 1AYAA 1O4QA 1A08A 1QCFA 1BG1A 5HKYA 5BO4A 3OP0A 3QWXX 1O4JA 2L3TA 1OO3A 1KA7A 2PNAA 3BKBA 2SRCA 5EHPA 1GRIA 1ZFPE 2EYYA 3PSJA 3TL0A 1A1BA 4K44A 4FL3A 2AOBA 1FHSA 1O4HA 4XZ0A 2XP1A 3TKZA 1BKMA 1IJRA 1LUNA 1LUKA 1O4EA 2DLZA 2PTKA 1AOTF 3BUWB 1O47A 4U17A 1R1QA 3CD3A 1O4CA 4EIHA 3PFVA 4E93A 1X6CA 1K9AA 1MILA 2EU0A 3IMDA 1FYRA 1A09A 3VRPA 2DLYA 2CIAA 2DX0A 4TZIA 1IS0A 1NRVA 1B47A 4K11A 4JGHA 3OB2B 3VRNA 1PICA 2EO6A 5AULA 2DM0A 5I6VA 4FL2A 5EELA 1A1CA 2LNXA 4U1PA 3VROA 5DC9A 2MRJA 3S9KA 2EL8A 1OPKA 1O49A 4F5BA 3S8NA 2RVFA 1YVHA 1CSZA 1O45A 3S8OA 1BLKA 4NWGA 1O4AA 1O4FA 1BF5A 1FMKA 4GPLB 2KNOA 2IUGA 3OV1A 1KSWA 1O4IA 3OVEA 3N7YA 2C0IA 4FBNA 1KC2A 1M61A 1SHAA 2RSYA 1O4KA 3N8MA 3PJPA 3ZNIA 1BKLA 1AYCA 2HUWA 1AD5A 1G83A 2PLEA 4D8KA 1BLJA 1JU5A 4JEGA 3KFJA 1TCEA 3VS4A 2EKXA 3MXCA 1WQUA 1Y57A 1MW4A 5DC0B 2MRKA 2VIFA 2H8HA 2HCKA 3QWYA 1FBZA 3PS5A 3K2MA 3PSKA 3HHMB 1CJ1A 5AXIA 1RQQC 1OPLA 1SPRA 3GQIB 3VGOA 3VS5A 2C0OA 1O41A 1BHFA 1BHHB 1YVLA 4F5AA 3HCKA 1AYDA 3N84A 1A1AA 1CWDL 4K45A 1GHUA 2IUHA 4H34A 3S8LA 3NHNA 2PLDA 3VS6A 1AB2A 1O4MA 1P13A 1TZEE 2Y1MA 3MXYA 1SHBA 1KA6A 1OO4A 1D4WA 2SHPA 2KK6A 2MQIA 3VS3A 4H1OA 1FU6A 4OHEA 1CSYA 2C0TA 1LCJA 4OHLA 3BUNB 2EOBA 2AOAA 3UYOA 1X0NA 2L6KA 1M27A 1JYUA 1O4DA 4GL9E 5EG3B 2H5KA 2QMSA 1X27A 2IZVA 3VS7A 1O43A 2L4KA 1BFJA 2MC1A 1NZLA 1O42A 2DCRA 1O4LA 4JE4A 1BMBA 2LQNA 1LUMA 4DGXA 2HDXA 3OB1B 1SKJA 3VRYA 1FBVA 3EAZA 3IN7A 5IBMA 2GE9A 2K7AB 1BM2A 2HDVA 5HKZA 3M7FA 1JWOA 4LUEA 2RMXA 1QG1E 2OQ1A 1A81A 3BUOB 1Y1UA 3VS0A 4A4BA 4E68A 2ECDA 1JYQA 2LNWA 4OHDA 5DF6A 2LCTA 1O4NA 2ETZA 1HCTB 1CWEA 3VRRA 5CDWA 1LCKA 3C7IA 2C9WA 4ROJA 4QSYA 1UUSA 3VRZA 2EYZA 2ABLA 1O4PA 2OZOA 2YSXA 4OHHA 3BUXB 3IN8A 3EACA 4OHIA 3GXXA 2H46E 1RJAA 2DVJA 3CXLA 1JYRA 1LKKA 2CRHA 1R1PA 2PNBA 2BBUA 4DGPA 2HMHA 5J3XA 3VS1A 2IUIA 1F1WA 1H9OA 2K79B 4M4ZA 1HCSB 2CI8A 1R1SA 2Y1NA 3BUMB 2CBLA 4F59A 3UF4A 5KAZA 2RORA 1NZVA 1AYBA 1LUIA 2EYVA 1D1ZA 2AUGA 1QADA 1O46A 1O4BA 1Z3KA 2MK2A 3GXWA 4LUDA 2B3OA 5GJIA 2LQWA 4L1BB 2Y3AB 1UURA 1O48A 5GJHA 3HIZB 1O4GA 3VS2A 4A4CA 4GWFA 1SPSA 4P9ZA 3US4A 4P9VA 1F2FA 1SHDA 1FU5A 5DC4A 1BHHA 1A1EA 1O44A 2CI9A 2FO0A 1LKLA 1RPYA 3CBLA 4X6SA 5IBSA 4XZ1A 5EEQA 4NWFA 4EY0A 4K2RA 1A07A 3IMJA 3WA4A 3T04A 1O4RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HKW A;  3PLF B;  5D0J A;  2YU7 A;  1D4T A;  1O4O A;  2CS0 A;  2FCI A;  5EHR A;  1XA6 A;  3PQZ A;  1BFI A;  1I3Z A;  3MAZ A;  1AOU F;  2CR4 A;  2EO3 A;  3CWG A;  2JYQ A;  4WWQ A;  2GSB A;  3VRQ A;  1AYA A;  1O4Q A;  1A08 A;  1QCF A;  1BG1 A;  5HKY A;  5BO4 A;  3OP0 A;  3QWX X;  1O4J A;  2L3T A;  1OO3 A;  1KA7 A;  2PNA A;  3BKB A;  2SRC A;  5EHP A;  1GRI A;  1ZFP E;  2EYY A;  3PSJ A;  3TL0 A;  1A1B A;  4K44 A;  4FL3 A;  2AOB A;  1FHS A;  1O4H A;  4XZ0 A;  2XP1 A;  3TKZ A;  1BKM A;  1IJR A;  1LUN A;  1LUK A;  1O4E A;  2DLZ A;  2PTK A;  1AOT F;  3BUW B;  1O47 A;  4U17 A;  1R1Q A;  3CD3 A;  1O4C A;  4EIH A;  3PFV A;  4E93 A;  1X6C A;  1K9A A;  1MIL A;  2EU0 A;  3IMD A;  1FYR A;  1A09 A;  3VRP A;  2DLY A;  2CIA A;  2DX0 A;  4TZI A;  1IS0 A;  1NRV A;  1B47 A;  4K11 A;  4JGH A;  3OB2 B;  3VRN A;  1PIC A;  2EO6 A;  5AUL A;  2DM0 A;  5I6V A;  4FL2 A;  5EEL A;  1A1C A;  2LNX A;  4U1P A;  3VRO A;  5DC9 A;  2MRJ A;  3S9K A;  2EL8 A;  1OPK A;  1O49 A;  4F5B A;  3S8N A;  2RVF A;  1YVH A;  1CSZ A;  1O45 A;  3S8O A;  1BLK A;  4NWG A;  1O4A A;  1O4F A;  1BF5 A;  1FMK A;  4GPL B;  2KNO A;  2IUG A;  3OV1 A;  1KSW A;  1O4I A;  3OVE A;  3N7Y A;  2C0I A;  4FBN A;  1KC2 A;  1M61 A;  1SHA A;  2RSY A;  1O4K A;  3N8M A;  3PJP A;  3ZNI A;  1BKL A;  1AYC A;  2HUW A;  1AD5 A;  1G83 A;  2PLE A;  4D8K A;  1BLJ A;  1JU5 A;  4JEG A;  3KFJ A;  1TCE A;  3VS4 A;  2EKX A;  3MXC A;  1WQU A;  1Y57 A;  1MW4 A;  5DC0 B;  2MRK A;  2VIF A;  2H8H A;  2HCK A;  3QWY A;  1FBZ A;  3PS5 A;  3K2M A;  3PSK A;  3HHM B;  1CJ1 A;  5AXI A;  1RQQ C;  1OPL A;  1SPR A;  3GQI B;  3VGO A;  3VS5 A;  2C0O A;  1O41 A;  1BHF A;  1BHH B;  1YVL A;  4F5A A;  3HCK A;  1AYD A;  3N84 A;  1A1A A;  1CWD L;  4K45 A;  1GHU A;  2IUH A;  4H34 A;  3S8L A;  3NHN A;  2PLD A;  3VS6 A;  1AB2 A;  1O4M A;  1P13 A;  1TZE E;  2Y1M A;  3MXY A;  1SHB A;  1KA6 A;  1OO4 A;  1D4W A;  2SHP A;  2KK6 A;  2MQI A;  3VS3 A;  4H1O A;  1FU6 A;  4OHE A;  1CSY A;  2C0T A;  1LCJ A;  4OHL A;  3BUN B;  2EOB A;  2AOA A;  3UYO A;  1X0N A;  2L6K A;  1M27 A;  1JYU A;  1O4D A;  4GL9 E;  5EG3 B;  2H5K A;  2QMS A;  1X27 A;  2IZV A;  3VS7 A;  1O43 A;  2L4K A;  1BFJ A;  2MC1 A;  1NZL A;  1O42 A;  2DCR A;  1O4L A;  4JE4 A;  1BMB A;  2LQN A;  1LUM A;  4DGX A;  2HDX A;  3OB1 B;  1SKJ A;  3VRY A;  1FBV A;  3EAZ A;  3IN7 A;  5IBM A;  2GE9 A;  2K7A B;  1BM2 A;  2HDV A;  5HKZ A;  3M7F A;  1JWO A;  4LUE A;  2RMX A;  1QG1 E;  2OQ1 A;  1A81 A;  3BUO B;  1Y1U A;  3VS0 A;  4A4B A;  4E68 A;  2ECD A;  1JYQ A;  2LNW A;  4OHD A;  5DF6 A;  2LCT A;  1O4N A;  2ETZ A;  1HCT B;  1CWE A;  3VRR A;  5CDW A;  1LCK A;  3C7I A;  2C9W A;  4ROJ A;  4QSY A;  1UUS A;  3VRZ A;  2EYZ A;  2ABL A;  1O4P A;  2OZO A;  2YSX A;  4OHH A;  3BUX B;  3IN8 A;  3EAC A;  4OHI A;  3GXX A;  2H46 E;  1RJA A;  2DVJ A;  3CXL A;  1JYR A;  1LKK A;  2CRH A;  1R1P A;  2PNB A;  2BBU A;  4DGP A;  2HMH A;  5J3X A;  3VS1 A;  2IUI A;  1F1W A;  1H9O A;  2K79 B;  4M4Z A;  1HCS B;  2CI8 A;  1R1S A;  2Y1N A;  3BUM B;  2CBL A;  4F59 A;  3UF4 A;  5KAZ A;  2ROR A;  1NZV A;  1AYB A;  1LUI A;  2EYV A;  1D1Z A;  2AUG A;  1QAD A;  1O46 A;  1O4B A;  1Z3K A;  2MK2 A;  3GXW A;  4LUD A;  2B3O A;  5GJI A;  2LQW A;  4L1B B;  2Y3A B;  1UUR A;  1O48 A;  5GJH A;  3HIZ B;  1O4G A;  3VS2 A;  4A4C A;  4GWF A;  1SPS A;  4P9Z A;  3US4 A;  4P9V A;  1F2F A;  1SHD A;  1FU5 A;  5DC4 A;  1BHH A;  1A1E A;  1O44 A;  2CI9 A;  2FO0 A;  1LKL A;  1RPY A;  3CBL A;  4X6S A;  5IBS A;  4XZ1 A;  5EEQ A;  4NWF A;  4EY0 A;  4K2R A;  1A07 A;  3IMJ A;  3WA4 A;  3T04 A;  1O4R A; 
#chains in the Genus database with same CATH topology
 5HKW A;  3PLF B;  5D0J A;  2YU7 A;  1D4T A;  1O4O A;  2CS0 A;  2FCI A;  5EHR A;  1XA6 A;  3PQZ A;  1BFI A;  1I3Z A;  3MAZ A;  1AOU F;  2CR4 A;  2EO3 A;  3CWG A;  2JYQ A;  4WWQ A;  2GSB A;  3VRQ A;  1AYA A;  1O4Q A;  1A08 A;  1QCF A;  1BG1 A;  5HKY A;  5BO4 A;  3OP0 A;  3QWX X;  1O4J A;  2L3T A;  1OO3 A;  1KA7 A;  2PNA A;  3BKB A;  2SRC A;  5EHP A;  1GRI A;  1ZFP E;  2EYY A;  3PSJ A;  3TL0 A;  1A1B A;  2LRA A;  4K44 A;  4FL3 A;  2AOB A;  1FHS A;  1O4H A;  4XZ0 A;  2XP1 A;  3TKZ A;  1BKM A;  1IJR A;  1LUN A;  1LUK A;  1O4E A;  2DLZ A;  2PTK A;  1AOT F;  3BUW B;  1O47 A;  4U17 A;  1R1Q A;  3CD3 A;  1O4C A;  4EIH A;  3PFV A;  4E93 A;  1X6C A;  1K9A A;  1MIL A;  2EU0 A;  3IMD A;  1FYR A;  1A09 A;  3VRP A;  2DLY A;  2CIA A;  2DX0 A;  4TZI A;  1IS0 A;  1NRV A;  1B47 A;  4K11 A;  4JGH A;  3OB2 B;  3VRN A;  1PIC A;  2EO6 A;  5AUL A;  2DM0 A;  5I6V A;  4FL2 A;  5EEL A;  1A1C A;  2LNX A;  4U1P A;  3VRO A;  5DC9 A;  2MRJ A;  3S9K A;  2EL8 A;  1OPK A;  1O49 A;  4F5B A;  3S8N A;  2RVF A;  1YVH A;  1CSZ A;  1O45 A;  3S8O A;  1BLK A;  4NWG A;  1O4A A;  1O4F A;  1BF5 A;  1FMK A;  4GPL B;  2KNO A;  2IUG A;  3OV1 A;  1KSW A;  1O4I A;  3OVE A;  3LYV A;  3N7Y A;  2C0I A;  4FBN A;  1KC2 A;  1M61 A;  3K2T A;  1SHA A;  2RSY A;  1O4K A;  3N8M A;  3PJP A;  3ZNI A;  1BKL A;  1AYC A;  2HUW A;  1AD5 A;  1G83 A;  2PLE A;  4D8K A;  1BLJ A;  1JU5 A;  4JEG A;  3KFJ A;  1TCE A;  3VS4 A;  2EKX A;  3MXC A;  1WQU A;  1Y57 A;  1MW4 A;  5DC0 B;  2MRK A;  2VIF A;  2H8H A;  2HCK A;  3QWY A;  1FBZ A;  3PS5 A;  3K2M A;  3PSK A;  3HHM B;  1CJ1 A;  5AXI A;  1RQQ C;  1OPL A;  1SPR A;  3GQI B;  3VGO A;  3VS5 A;  2C0O A;  1O41 A;  1BHF A;  1BHH B;  1YVL A;  4F5A A;  3HCK A;  1AYD A;  3N84 A;  1A1A A;  1CWD L;  4K45 A;  1GHU A;  2IUH A;  4H34 A;  3S8L A;  3NHN A;  2PLD A;  3VS6 A;  1AB2 A;  1O4M A;  1P13 A;  1TZE E;  2Y1M A;  3MXY A;  1SHB A;  1KA6 A;  1OO4 A;  1D4W A;  2SHP A;  2KK6 A;  2MQI A;  3VS3 A;  4H1O A;  1FU6 A;  4OHE A;  1CSY A;  2C0T A;  1LCJ A;  4OHL A;  3BUN B;  2EOB A;  2AOA A;  3UYO A;  1X0N A;  2L6K A;  1M27 A;  1JYU A;  1O4D A;  4GL9 E;  5EG3 B;  2H5K A;  2QMS A;  1X27 A;  2IZV A;  3VS7 A;  1O43 A;  2L4K A;  1BFJ A;  2MC1 A;  1NZL A;  1O42 A;  2DCR A;  1O4L A;  4JE4 A;  1BMB A;  2LQN A;  1LUM A;  4DGX A;  2HDX A;  3OB1 B;  1SKJ A;  3VRY A;  1FBV A;  3EAZ A;  3IN7 A;  5IBM A;  2GE9 A;  2K7A B;  1BM2 A;  2HDV A;  5HKZ A;  3M7F A;  1JWO A;  4LUE A;  2RMX A;  1QG1 E;  2OQ1 A;  1A81 A;  3BUO B;  1Y1U A;  3VS0 A;  4A4B A;  4E68 A;  2ECD A;  1JYQ A;  2LNW A;  4OHD A;  5DF6 A;  2LCT A;  1O4N A;  2ETZ A;  1HCT B;  1CWE A;  3VRR A;  5CDW A;  1LCK A;  3C7I A;  2C9W A;  4ROJ A;  4QSY A;  1UUS A;  3VRZ A;  2EYZ A;  2ABL A;  1O4P A;  2OZO A;  2YSX A;  4OHH A;  3BUX B;  3IN8 A;  3EAC A;  4OHI A;  3GXX A;  2H46 E;  1RJA A;  2DVJ A;  3CXL A;  1JYR A;  1LKK A;  2CRH A;  1R1P A;  2PNB A;  2BBU A;  4DGP A;  2HMH A;  5J3X A;  3VS1 A;  2IUI A;  1F1W A;  1H9O A;  2K79 B;  4M4Z A;  1HCS B;  2CI8 A;  1R1S A;  2Y1N A;  3BUM B;  2CBL A;  4F59 A;  3UF4 A;  5KAZ A;  2ROR A;  1NZV A;  1AYB A;  1LUI A;  2EYV A;  1D1Z A;  2AUG A;  1QAD A;  1O46 A;  1O4B A;  2KGY A;  1Z3K A;  2MK2 A;  3GXW A;  4LUD A;  2B3O A;  5GJI A;  2LQW A;  4L1B B;  2Y3A B;  1UUR A;  1O48 A;  5GJH A;  3HIZ B;  1O4G A;  3VS2 A;  4A4C A;  4GWF A;  1SPS A;  4P9Z A;  3US4 A;  4P9V A;  1F2F A;  1SHD A;  1FU5 A;  5DC4 A;  1BHH A;  1A1E A;  1O44 A;  2CI9 A;  2FO0 A;  1LKL A;  1RPY A;  3CBL A;  4X6S A;  5IBS A;  4XZ1 A;  5EEQ A;  4NWF A;  4EY0 A;  4K2R A;  1A07 A;  3IMJ A;  3WA4 A;  3T04 A;  1O4R A; 
#chains in the Genus database with same CATH homology
 5HKW A;  3PLF B;  5D0J A;  2YU7 A;  1D4T A;  1O4O A;  2CS0 A;  2FCI A;  5EHR A;  1XA6 A;  3PQZ A;  1BFI A;  1I3Z A;  3MAZ A;  1AOU F;  2CR4 A;  2EO3 A;  3CWG A;  2JYQ A;  4WWQ A;  2GSB A;  3VRQ A;  1AYA A;  1O4Q A;  1A08 A;  1QCF A;  1BG1 A;  5HKY A;  5BO4 A;  3OP0 A;  3QWX X;  1O4J A;  2L3T A;  1OO3 A;  1KA7 A;  2PNA A;  3BKB A;  2SRC A;  5EHP A;  1GRI A;  1ZFP E;  2EYY A;  3PSJ A;  3TL0 A;  1A1B A;  4K44 A;  4FL3 A;  2AOB A;  1FHS A;  1O4H A;  4XZ0 A;  2XP1 A;  3TKZ A;  1BKM A;  1IJR A;  1LUN A;  1LUK A;  1O4E A;  2DLZ A;  2PTK A;  1AOT F;  3BUW B;  1O47 A;  4U17 A;  1R1Q A;  3CD3 A;  1O4C A;  4EIH A;  3PFV A;  4E93 A;  1X6C A;  1K9A A;  1MIL A;  2EU0 A;  3IMD A;  1FYR A;  1A09 A;  3VRP A;  2DLY A;  2CIA A;  2DX0 A;  4TZI A;  1IS0 A;  1NRV A;  1B47 A;  4K11 A;  4JGH A;  3OB2 B;  3VRN A;  1PIC A;  2EO6 A;  5AUL A;  2DM0 A;  5I6V A;  4FL2 A;  5EEL A;  1A1C A;  2LNX A;  4U1P A;  3VRO A;  5DC9 A;  2MRJ A;  3S9K A;  2EL8 A;  1OPK A;  1O49 A;  4F5B A;  3S8N A;  2RVF A;  1YVH A;  1CSZ A;  1O45 A;  3S8O A;  1BLK A;  4NWG A;  1O4A A;  1O4F A;  1BF5 A;  1FMK A;  4GPL B;  2KNO A;  2IUG A;  3OV1 A;  1KSW A;  1O4I A;  3OVE A;  3N7Y A;  2C0I A;  4FBN A;  1KC2 A;  1M61 A;  1SHA A;  2RSY A;  1O4K A;  3N8M A;  3PJP A;  3ZNI A;  1BKL A;  1AYC A;  2HUW A;  1AD5 A;  1G83 A;  2PLE A;  4D8K A;  1BLJ A;  1JU5 A;  4JEG A;  3KFJ A;  1TCE A;  3VS4 A;  2EKX A;  3MXC A;  1WQU A;  1Y57 A;  1MW4 A;  5DC0 B;  2MRK A;  2VIF A;  2H8H A;  2HCK A;  3QWY A;  1FBZ A;  3PS5 A;  3K2M A;  3PSK A;  3HHM B;  1CJ1 A;  5AXI A;  1RQQ C;  1OPL A;  1SPR A;  3GQI B;  3VGO A;  3VS5 A;  2C0O A;  1O41 A;  1BHF A;  1BHH B;  1YVL A;  4F5A A;  3HCK A;  1AYD A;  3N84 A;  1A1A A;  1CWD L;  4K45 A;  1GHU A;  2IUH A;  4H34 A;  3S8L A;  3NHN A;  2PLD A;  3VS6 A;  1AB2 A;  1O4M A;  1P13 A;  1TZE E;  2Y1M A;  3MXY A;  1SHB A;  1KA6 A;  1OO4 A;  1D4W A;  2SHP A;  2KK6 A;  2MQI A;  3VS3 A;  4H1O A;  1FU6 A;  4OHE A;  1CSY A;  2C0T A;  1LCJ A;  4OHL A;  3BUN B;  2EOB A;  2AOA A;  3UYO A;  1X0N A;  2L6K A;  1M27 A;  1JYU A;  1O4D A;  4GL9 E;  5EG3 B;  2H5K A;  2QMS A;  1X27 A;  2IZV A;  3VS7 A;  1O43 A;  2L4K A;  1BFJ A;  2MC1 A;  1NZL A;  1O42 A;  2DCR A;  1O4L A;  4JE4 A;  1BMB A;  2LQN A;  1LUM A;  4DGX A;  2HDX A;  3OB1 B;  1SKJ A;  3VRY A;  1FBV A;  3EAZ A;  3IN7 A;  5IBM A;  2GE9 A;  2K7A B;  1BM2 A;  2HDV A;  5HKZ A;  3M7F A;  1JWO A;  4LUE A;  2RMX A;  1QG1 E;  2OQ1 A;  1A81 A;  3BUO B;  1Y1U A;  3VS0 A;  4A4B A;  4E68 A;  2ECD A;  1JYQ A;  2LNW A;  4OHD A;  5DF6 A;  2LCT A;  1O4N A;  2ETZ A;  1HCT B;  1CWE A;  3VRR A;  5CDW A;  1LCK A;  3C7I A;  2C9W A;  4ROJ A;  4QSY A;  1UUS A;  3VRZ A;  2EYZ A;  2ABL A;  1O4P A;  2OZO A;  2YSX A;  4OHH A;  3BUX B;  3IN8 A;  3EAC A;  4OHI A;  3GXX A;  2H46 E;  1RJA A;  2DVJ A;  3CXL A;  1JYR A;  1LKK A;  2CRH A;  1R1P A;  2PNB A;  2BBU A;  4DGP A;  2HMH A;  5J3X A;  3VS1 A;  2IUI A;  1F1W A;  1H9O A;  2K79 B;  4M4Z A;  1HCS B;  2CI8 A;  1R1S A;  2Y1N A;  3BUM B;  2CBL A;  4F59 A;  3UF4 A;  5KAZ A;  2ROR A;  1NZV A;  1AYB A;  1LUI A;  2EYV A;  1D1Z A;  2AUG A;  1QAD A;  1O46 A;  1O4B A;  1Z3K A;  2MK2 A;  3GXW A;  4LUD A;  2B3O A;  5GJI A;  2LQW A;  4L1B B;  2Y3A B;  1UUR A;  1O48 A;  5GJH A;  3HIZ B;  1O4G A;  3VS2 A;  4A4C A;  4GWF A;  1SPS A;  4P9Z A;  3US4 A;  4P9V A;  1F2F A;  1SHD A;  1FU5 A;  5DC4 A;  1BHH A;  1A1E A;  1O44 A;  2CI9 A;  2FO0 A;  1LKL A;  1RPY A;  3CBL A;  4X6S A;  5IBS A;  4XZ1 A;  5EEQ A;  4NWF A;  4EY0 A;  4K2R A;  1A07 A;  3IMJ A;  3WA4 A;  3T04 A;  1O4R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...