1O4HA

Crystal structure of sh2 in complex with ru79072.
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
106
structure length
106
Chain Sequence
SIQAEEWYFGKITRRESERLLLNAENPRGTFLVRESETTKGAYCLSVSDFDNAKGLNVKHYKIRKLDSGGFYITSRTQFNSLQQLVAYYSKHADGLCHRLTTVCPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Requirements for specific binding of low affinity inhibitor fragments to the SH2 domain of (pp60)Src are identical to those for high affinity binding of full length inhibitors.
pubmed doi rcsb
molecule keywords PROTO-ONCOGENE TYROSINE-PROTEIN KINASE SRC
molecule tags Signaling protein
source organism Homo sapiens
total genus 27
structure length 106
sequence length 106
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2003-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00017 SH2 SH2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.505.10 Alpha Beta 2-Layer Sandwich SHC Adaptor Protein SH2 domain 1o4hA00
1A81A 5GJIA 1M27A 2EYVA 5I6VA 1BLJA 3WA4A 1MW4A 4OHEA 1LUIA 5EG3B 1M61A 4FL3A 4EIHA 3OB2B 1BF5A 1BHHA 1A07A 1R1QA 5DC9A 2DM0A 1LUNA 2YSXA 1CSYA 4JGHA 1Z3KA 1O4RA 1KSWA 3PSKA 4DGPA 2H8HA 1AD5A 4X6SA 3PLFB 1XA6A 3N84A 1MILA 4JEGA 4NWFA 3HCKA 2L6KA 1O43A 5IBSA 3VRNA 1SHBA 1BHHB 1HCSB 1X27A 5EEQA 4NWGA 1O4IA 4U1PA 1KA7A 1JYRA 2OQ1A 1CSZA 2LNXA 1FU5A 1BHFA 4K11A 1I3ZA 1D4WA 2L4KA 4GL9E 4QSYA 4ROJA 3BUMB 3S9KA 1O45A 2MRJA 1AYCA 2HDXA 2MK2A 1A1EA 1O46A 1D1ZA 2H5KA 1LCJA 1FU6A 2PNBA 3IMJA 3K2MA 1BG1A 1UURA 2EO3A 2CRHA 1F1WA 1X6CA 1SKJA 4XZ0A 1P13A 5EHRA 2ECDA 1K9AA 4XZ1A 2PLDA 1WQUA 2DLYA 1B47A 1NZVA 2EOBA 4OHHA 1AYDA 3BUXB 4GPLB 1SHDA 1OPLA 3VS4A 1BM2A 2EO6A 3HHMB 3C7IA 3BKBA 1CWEA 3UYOA 5DC4A 2LQWA 4EY0A 2H46E 2RMXA 1JWOA 3PQZA 1BLKA 1O4FA 3VS7A 1O4QA 1YVHA 1O4JA 1O4GA 2VIFA 1AB2A 1AYBA 5KAZA 1TZEE 4A4CA 1O4BA 2PLEA 3PS5A 2AOBA 3MAZA 5IBMA 3VRYA 2EU0A 2L3TA 1LKKA 1LUMA 2RSYA 3M7FA 2PNAA 1JYQA 1KA6A 1O4HA 4E93A 4E68A 2K79B 3UF4A 3OB1B 1JU5A 2ABLA 5EHPA 2HUWA 3OP0A 1FMKA 1A1AA 1LCKA 3OV1A 1BKLA 4OHDA 3EAZA 1FHSA 4K2RA 3QWYA 1OO3A 2EL8A 4OHIA 1FYRA 3EACA 5DC0B 3TKZA 1O49A 3CD3A 1FBVA 1O4LA 3VRQA 4WWQA 3VRZA 2DCRA 2OZOA 1SHAA 3BUOB 1SPSA 3NHNA 1R1PA 3MXCA 3VS2A 1O47A 5DF6A 1G83A 1BMBA 1X0NA 1O4PA 2C0TA 2IZVA 2CI8A 1A09A 2BBUA 3IMDA 2KNOA 2KK6A 2Y1NA 3N7YA 1OPKA 5AXIA 5HKZA 2LCTA 2HDVA 1FBZA 4TZIA 1O41A 2EKXA 4FBNA 3GQIB 4OHLA 1YVLA 4P9ZA 5J3XA 1O4MA 3TL0A 2PTKA 1O4OA 2DVJA 1F2FA 4LUEA 4DGXA 3S8NA 2HMHA 1AYAA 3ZNIA 1TCEA 1IJRA 3VS1A 3VS0A 2AOAA 1O4AA 1Y1UA 4K44A 5BO4A 3CBLA 1O48A 1O4DA 4H1OA 2FO0A 3HIZB 4H34A 4F59A 1A1BA 2EYYA 4L1BB 3PFVA 2RORA 4F5BA 1SPRA 2GE9A 3MXYA 1NZLA 2YU7A 1OO4A 3CWGA 2C9WA 3PSJA 4GWFA 3S8LA 4FL2A 2JYQA 2IUGA 1A1CA 1QADA 2LNWA 1O44A 5GJHA 4F5AA 2CBLA 5HKYA 3QWXX 2MQIA 1RJAA 1R1SA 2CI9A 1ZFPE 2CS0A 3T04A 3PJPA 1RQQC 4D8KA 3IN7A 2LQNA 1CJ1A 3GXWA 2XP1A 4K45A 2CR4A 3IN8A 1A08A 2SRCA 3CXLA 1BFIA 1IS0A 1QG1E 2C0IA 2ETZA 2RVFA 4A4BA 3VROA 1O4KA 3S8OA 1Y57A 2AUGA 1H9OA 2CIAA 2IUHA 3BUWB 2C0OA 1CWDL 3KFJA 3VS6A 2MC1A 3GXXA 3OVEA 1AOTF 4M4ZA 2QMSA 2MRKA 1GRIA 4LUDA 1KC2A 1BKMA 3VGOA 3US4A 2DX0A 2IUIA 5AULA 1LKLA 3VRPA 1GHUA 1UUSA 1O4EA 1O4NA 1QCFA 1PICA 1RPYA 2SHPA 2FCIA 5D0JA 1NRVA 3VRRA 2EYZA 1LUKA 1BFJA 5HKWA 1O4CA 2DLZA 2B3OA 3BUNB 1O42A 3VS3A 5EELA 1JYUA 1HCTB 4U17A 2GSBA 2Y1MA 2Y3AB 4JE4A 5CDWA 1D4TA 2HCKA 2K7AB 1AOUF 3N8MA 3VS5A 4P9VA
chains in the Genus database with same CATH superfamily
1A81A 5GJIA 1M27A 2EYVA 5I6VA 1BLJA 3WA4A 1MW4A 4OHEA 1LUIA 5EG3B 1M61A 4FL3A 4EIHA 3OB2B 1BF5A 1BHHA 1A07A 1R1QA 5DC9A 2DM0A 1LUNA 2YSXA 1CSYA 4JGHA 1Z3KA 1O4RA 1KSWA 3PSKA 4DGPA 2H8HA 1AD5A 4X6SA 3PLFB 1XA6A 3N84A 1MILA 4JEGA 4NWFA 3HCKA 2L6KA 1O43A 5IBSA 3VRNA 1SHBA 1BHHB 1HCSB 1X27A 5EEQA 4NWGA 1O4IA 4U1PA 1KA7A 1JYRA 2OQ1A 1CSZA 2LNXA 1FU5A 1BHFA 4K11A 1I3ZA 1D4WA 2L4KA 4GL9E 4QSYA 4ROJA 3BUMB 3S9KA 1O45A 2MRJA 1AYCA 2HDXA 2MK2A 1A1EA 1O46A 1D1ZA 2H5KA 1LCJA 1FU6A 2PNBA 3IMJA 3K2MA 1BG1A 1UURA 2EO3A 2CRHA 1F1WA 1X6CA 1SKJA 4XZ0A 1P13A 5EHRA 2ECDA 1K9AA 4XZ1A 2PLDA 1WQUA 2DLYA 1B47A 2KGYA 1NZVA 2EOBA 4OHHA 1AYDA 3BUXB 4GPLB 1SHDA 1OPLA 3VS4A 1BM2A 2EO6A 3HHMB 3C7IA 3BKBA 1CWEA 3UYOA 5DC4A 2LQWA 4EY0A 2H46E 2RMXA 1JWOA 3PQZA 1BLKA 1O4FA 3VS7A 1O4QA 1YVHA 1O4JA 1O4GA 2VIFA 1AB2A 1AYBA 5KAZA 1TZEE 4A4CA 1O4BA 2PLEA 3PS5A 2AOBA 3MAZA 5IBMA 3VRYA 2EU0A 2L3TA 1LKKA 1LUMA 2RSYA 3M7FA 2PNAA 1JYQA 1KA6A 1O4HA 4E93A 4E68A 2K79B 3UF4A 3OB1B 1JU5A 2ABLA 5EHPA 2HUWA 3OP0A 1FMKA 1A1AA 1LCKA 3OV1A 1BKLA 4OHDA 3EAZA 1FHSA 4K2RA 3QWYA 1OO3A 2EL8A 4OHIA 1FYRA 3EACA 5DC0B 3TKZA 1O49A 3CD3A 1FBVA 1O4LA 3VRQA 4WWQA 3VRZA 2DCRA 2OZOA 1SHAA 3BUOB 1SPSA 3NHNA 1R1PA 3MXCA 3VS2A 1O47A 5DF6A 1G83A 1BMBA 1X0NA 1O4PA 2C0TA 2IZVA 2CI8A 1A09A 2BBUA 3IMDA 2KNOA 2KK6A 2Y1NA 3N7YA 1OPKA 5AXIA 5HKZA 2LCTA 2HDVA 1FBZA 4TZIA 1O41A 2EKXA 4FBNA 3GQIB 4OHLA 1YVLA 4P9ZA 5J3XA 1O4MA 3TL0A 2PTKA 1O4OA 2DVJA 1F2FA 4LUEA 4DGXA 3S8NA 2HMHA 1AYAA 3ZNIA 1TCEA 1IJRA 3VS1A 3VS0A 2AOAA 1O4AA 1Y1UA 4K44A 5BO4A 3CBLA 1O48A 1O4DA 4H1OA 2FO0A 3HIZB 4H34A 4F59A 1A1BA 2EYYA 4L1BB 3PFVA 2RORA 2LRAA 4F5BA 1SPRA 2GE9A 3MXYA 1NZLA 2YU7A 1OO4A 3CWGA 2C9WA 3PSJA 4GWFA 3S8LA 4FL2A 2JYQA 2IUGA 1A1CA 1QADA 2LNWA 1O44A 5GJHA 4F5AA 2CBLA 5HKYA 3QWXX 2MQIA 1RJAA 1R1SA 2CI9A 1ZFPE 2CS0A 3T04A 3PJPA 1RQQC 4D8KA 3IN7A 2LQNA 1CJ1A 3GXWA 2XP1A 4K45A 2CR4A 3LYVA 3IN8A 1A08A 2SRCA 3CXLA 1BFIA 1IS0A 1QG1E 2C0IA 2ETZA 2RVFA 4A4BA 3VROA 1O4KA 3S8OA 1Y57A 2AUGA 1H9OA 2CIAA 2IUHA 3BUWB 2C0OA 1CWDL 3KFJA 3VS6A 2MC1A 3GXXA 3OVEA 1AOTF 4M4ZA 2QMSA 2MRKA 1GRIA 4LUDA 1KC2A 1BKMA 3VGOA 3US4A 2DX0A 2IUIA 5AULA 1LKLA 3VRPA 1GHUA 1UUSA 1O4EA 1O4NA 1QCFA 1PICA 1RPYA 2SHPA 2FCIA 5D0JA 1NRVA 3VRRA 2EYZA 1LUKA 1BFJA 5HKWA 1O4CA 2DLZA 2B3OA 3BUNB 1O42A 3VS3A 5EELA 3K2TA 1JYUA 1HCTB 4U17A 2GSBA 2Y1MA 2Y3AB 4JE4A 5CDWA 1D4TA 2HCKA 2K7AB 1AOUF 3N8MA 3VS5A 4P9VA
chains in the Genus database with same CATH topology
1A81A 5GJIA 1M27A 2EYVA 5I6VA 1BLJA 3WA4A 1MW4A 4OHEA 1LUIA 5EG3B 1M61A 4FL3A 4EIHA 3OB2B 1BF5A 1BHHA 1A07A 1R1QA 5DC9A 2DM0A 1LUNA 2YSXA 1CSYA 4JGHA 1Z3KA 1O4RA 1KSWA 3PSKA 4DGPA 2H8HA 1AD5A 4X6SA 3PLFB 1XA6A 3N84A 1MILA 4JEGA 4NWFA 3HCKA 2L6KA 1O43A 5IBSA 3VRNA 1SHBA 1BHHB 1HCSB 1X27A 5EEQA 4NWGA 1O4IA 4U1PA 1KA7A 1JYRA 2OQ1A 1CSZA 2LNXA 1FU5A 1BHFA 4K11A 1I3ZA 1D4WA 2L4KA 4GL9E 4QSYA 4ROJA 3BUMB 3S9KA 1O45A 2MRJA 1AYCA 2HDXA 2MK2A 1A1EA 1O46A 1D1ZA 2H5KA 1LCJA 1FU6A 2PNBA 3IMJA 3K2MA 1BG1A 1UURA 2EO3A 2CRHA 1F1WA 1X6CA 1SKJA 4XZ0A 1P13A 5EHRA 2ECDA 1K9AA 4XZ1A 2PLDA 1WQUA 2DLYA 1B47A 1NZVA 2EOBA 4OHHA 1AYDA 3BUXB 4GPLB 1SHDA 1OPLA 3VS4A 1BM2A 2EO6A 3HHMB 3C7IA 3BKBA 1CWEA 3UYOA 5DC4A 2LQWA 4EY0A 2H46E 2RMXA 1JWOA 3PQZA 1BLKA 1O4FA 3VS7A 1O4QA 1YVHA 1O4JA 1O4GA 2VIFA 1AB2A 1AYBA 5KAZA 1TZEE 4A4CA 1O4BA 2PLEA 3PS5A 2AOBA 3MAZA 5IBMA 3VRYA 2EU0A 2L3TA 1LKKA 1LUMA 2RSYA 3M7FA 2PNAA 1JYQA 1KA6A 1O4HA 4E93A 4E68A 2K79B 3UF4A 3OB1B 1JU5A 2ABLA 5EHPA 2HUWA 3OP0A 1FMKA 1A1AA 1LCKA 3OV1A 1BKLA 4OHDA 3EAZA 1FHSA 4K2RA 3QWYA 1OO3A 2EL8A 4OHIA 1FYRA 3EACA 5DC0B 3TKZA 1O49A 3CD3A 1FBVA 1O4LA 3VRQA 4WWQA 3VRZA 2DCRA 2OZOA 1SHAA 3BUOB 1SPSA 3NHNA 1R1PA 3MXCA 3VS2A 1O47A 5DF6A 1G83A 1BMBA 1X0NA 1O4PA 2C0TA 2IZVA 2CI8A 1A09A 2BBUA 3IMDA 2KNOA 2KK6A 2Y1NA 3N7YA 1OPKA 5AXIA 5HKZA 2LCTA 2HDVA 1FBZA 4TZIA 1O41A 2EKXA 4FBNA 3GQIB 4OHLA 1YVLA 4P9ZA 5J3XA 1O4MA 3TL0A 2PTKA 1O4OA 2DVJA 1F2FA 4LUEA 4DGXA 3S8NA 2HMHA 1AYAA 3ZNIA 1TCEA 1IJRA 3VS1A 3VS0A 2AOAA 1O4AA 1Y1UA 4K44A 5BO4A 3CBLA 1O48A 1O4DA 4H1OA 2FO0A 3HIZB 4H34A 4F59A 1A1BA 2EYYA 4L1BB 3PFVA 2RORA 4F5BA 1SPRA 2GE9A 3MXYA 1NZLA 2YU7A 1OO4A 3CWGA 2C9WA 3PSJA 4GWFA 3S8LA 4FL2A 2JYQA 2IUGA 1A1CA 1QADA 2LNWA 1O44A 5GJHA 4F5AA 2CBLA 5HKYA 3QWXX 2MQIA 1RJAA 1R1SA 2CI9A 1ZFPE 2CS0A 3T04A 3PJPA 1RQQC 4D8KA 3IN7A 2LQNA 1CJ1A 3GXWA 2XP1A 4K45A 2CR4A 3IN8A 1A08A 2SRCA 3CXLA 1BFIA 1IS0A 1QG1E 2C0IA 2ETZA 2RVFA 4A4BA 3VROA 1O4KA 3S8OA 1Y57A 2AUGA 1H9OA 2CIAA 2IUHA 3BUWB 2C0OA 1CWDL 3KFJA 3VS6A 2MC1A 3GXXA 3OVEA 1AOTF 4M4ZA 2QMSA 2MRKA 1GRIA 4LUDA 1KC2A 1BKMA 3VGOA 3US4A 2DX0A 2IUIA 5AULA 1LKLA 3VRPA 1GHUA 1UUSA 1O4EA 1O4NA 1QCFA 1PICA 1RPYA 2SHPA 2FCIA 5D0JA 1NRVA 3VRRA 2EYZA 1LUKA 1BFJA 5HKWA 1O4CA 2DLZA 2B3OA 3BUNB 1O42A 3VS3A 5EELA 1JYUA 1HCTB 4U17A 2GSBA 2Y1MA 2Y3AB 4JE4A 5CDWA 1D4TA 2HCKA 2K7AB 1AOUF 3N8MA 3VS5A 4P9VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1A81 A;  5GJI A;  1M27 A;  2EYV A;  5I6V A;  1BLJ A;  3WA4 A;  1MW4 A;  4OHE A;  1LUI A;  5EG3 B;  1M61 A;  4FL3 A;  4EIH A;  3OB2 B;  1BF5 A;  1BHH A;  1A07 A;  1R1Q A;  5DC9 A;  2DM0 A;  1LUN A;  2YSX A;  1CSY A;  4JGH A;  1Z3K A;  1O4R A;  1KSW A;  3PSK A;  4DGP A;  2H8H A;  1AD5 A;  4X6S A;  3PLF B;  1XA6 A;  3N84 A;  1MIL A;  4JEG A;  4NWF A;  3HCK A;  2L6K A;  1O43 A;  5IBS A;  3VRN A;  1SHB A;  1BHH B;  1HCS B;  1X27 A;  5EEQ A;  4NWG A;  1O4I A;  4U1P A;  1KA7 A;  1JYR A;  2OQ1 A;  1CSZ A;  2LNX A;  1FU5 A;  1BHF A;  4K11 A;  1I3Z A;  1D4W A;  2L4K A;  4GL9 E;  4QSY A;  4ROJ A;  3BUM B;  3S9K A;  1O45 A;  2MRJ A;  1AYC A;  2HDX A;  2MK2 A;  1A1E A;  1O46 A;  1D1Z A;  2H5K A;  1LCJ A;  1FU6 A;  2PNB A;  3IMJ A;  3K2M A;  1BG1 A;  1UUR A;  2EO3 A;  2CRH A;  1F1W A;  1X6C A;  1SKJ A;  4XZ0 A;  1P13 A;  5EHR A;  2ECD A;  1K9A A;  4XZ1 A;  2PLD A;  1WQU A;  2DLY A;  1B47 A;  1NZV A;  2EOB A;  4OHH A;  1AYD A;  3BUX B;  4GPL B;  1SHD A;  1OPL A;  3VS4 A;  1BM2 A;  2EO6 A;  3HHM B;  3C7I A;  3BKB A;  1CWE A;  3UYO A;  5DC4 A;  2LQW A;  4EY0 A;  2H46 E;  2RMX A;  1JWO A;  3PQZ A;  1BLK A;  1O4F A;  3VS7 A;  1O4Q A;  1YVH A;  1O4J A;  1O4G A;  2VIF A;  1AB2 A;  1AYB A;  5KAZ A;  1TZE E;  4A4C A;  1O4B A;  2PLE A;  3PS5 A;  2AOB A;  3MAZ A;  5IBM A;  3VRY A;  2EU0 A;  2L3T A;  1LKK A;  1LUM A;  2RSY A;  3M7F A;  2PNA A;  1JYQ A;  1KA6 A;  1O4H A;  4E93 A;  4E68 A;  2K79 B;  3UF4 A;  3OB1 B;  1JU5 A;  2ABL A;  5EHP A;  2HUW A;  3OP0 A;  1FMK A;  1A1A A;  1LCK A;  3OV1 A;  1BKL A;  4OHD A;  3EAZ A;  1FHS A;  4K2R A;  3QWY A;  1OO3 A;  2EL8 A;  4OHI A;  1FYR A;  3EAC A;  5DC0 B;  3TKZ A;  1O49 A;  3CD3 A;  1FBV A;  1O4L A;  3VRQ A;  4WWQ A;  3VRZ A;  2DCR A;  2OZO A;  1SHA A;  3BUO B;  1SPS A;  3NHN A;  1R1P A;  3MXC A;  3VS2 A;  1O47 A;  5DF6 A;  1G83 A;  1BMB A;  1X0N A;  1O4P A;  2C0T A;  2IZV A;  2CI8 A;  1A09 A;  2BBU A;  3IMD A;  2KNO A;  2KK6 A;  2Y1N A;  3N7Y A;  1OPK A;  5AXI A;  5HKZ A;  2LCT A;  2HDV A;  1FBZ A;  4TZI A;  1O41 A;  2EKX A;  4FBN A;  3GQI B;  4OHL A;  1YVL A;  4P9Z A;  5J3X A;  1O4M A;  3TL0 A;  2PTK A;  1O4O A;  2DVJ A;  1F2F A;  4LUE A;  4DGX A;  3S8N A;  2HMH A;  1AYA A;  3ZNI A;  1TCE A;  1IJR A;  3VS1 A;  3VS0 A;  2AOA A;  1O4A A;  1Y1U A;  4K44 A;  5BO4 A;  3CBL A;  1O48 A;  1O4D A;  4H1O A;  2FO0 A;  3HIZ B;  4H34 A;  4F59 A;  1A1B A;  2EYY A;  4L1B B;  3PFV A;  2ROR A;  4F5B A;  1SPR A;  2GE9 A;  3MXY A;  1NZL A;  2YU7 A;  1OO4 A;  3CWG A;  2C9W A;  3PSJ A;  4GWF A;  3S8L A;  4FL2 A;  2JYQ A;  2IUG A;  1A1C A;  1QAD A;  2LNW A;  1O44 A;  5GJH A;  4F5A A;  2CBL A;  5HKY A;  3QWX X;  2MQI A;  1RJA A;  1R1S A;  2CI9 A;  1ZFP E;  2CS0 A;  3T04 A;  3PJP A;  1RQQ C;  4D8K A;  3IN7 A;  2LQN A;  1CJ1 A;  3GXW A;  2XP1 A;  4K45 A;  2CR4 A;  3IN8 A;  1A08 A;  2SRC A;  3CXL A;  1BFI A;  1IS0 A;  1QG1 E;  2C0I A;  2ETZ A;  2RVF A;  4A4B A;  3VRO A;  1O4K A;  3S8O A;  1Y57 A;  2AUG A;  1H9O A;  2CIA A;  2IUH A;  3BUW B;  2C0O A;  1CWD L;  3KFJ A;  3VS6 A;  2MC1 A;  3GXX A;  3OVE A;  1AOT F;  4M4Z A;  2QMS A;  2MRK A;  1GRI A;  4LUD A;  1KC2 A;  1BKM A;  3VGO A;  3US4 A;  2DX0 A;  2IUI A;  5AUL A;  1LKL A;  3VRP A;  1GHU A;  1UUS A;  1O4E A;  1O4N A;  1QCF A;  1PIC A;  1RPY A;  2SHP A;  2FCI A;  5D0J A;  1NRV A;  3VRR A;  2EYZ A;  1LUK A;  1BFJ A;  5HKW A;  1O4C A;  2DLZ A;  2B3O A;  3BUN B;  1O42 A;  3VS3 A;  5EEL A;  1JYU A;  1HCT B;  4U17 A;  2GSB A;  2Y1M A;  2Y3A B;  4JE4 A;  5CDW A;  1D4T A;  2HCK A;  2K7A B;  1AOU F;  3N8M A;  3VS5 A;  4P9V A; 
#chains in the Genus database with same CATH topology
 1A81 A;  5GJI A;  1M27 A;  2EYV A;  5I6V A;  1BLJ A;  3WA4 A;  1MW4 A;  4OHE A;  1LUI A;  5EG3 B;  1M61 A;  4FL3 A;  4EIH A;  3OB2 B;  1BF5 A;  1BHH A;  1A07 A;  1R1Q A;  5DC9 A;  2DM0 A;  1LUN A;  2YSX A;  1CSY A;  4JGH A;  1Z3K A;  1O4R A;  1KSW A;  3PSK A;  4DGP A;  2H8H A;  1AD5 A;  4X6S A;  3PLF B;  1XA6 A;  3N84 A;  1MIL A;  4JEG A;  4NWF A;  3HCK A;  2L6K A;  1O43 A;  5IBS A;  3VRN A;  1SHB A;  1BHH B;  1HCS B;  1X27 A;  5EEQ A;  4NWG A;  1O4I A;  4U1P A;  1KA7 A;  1JYR A;  2OQ1 A;  1CSZ A;  2LNX A;  1FU5 A;  1BHF A;  4K11 A;  1I3Z A;  1D4W A;  2L4K A;  4GL9 E;  4QSY A;  4ROJ A;  3BUM B;  3S9K A;  1O45 A;  2MRJ A;  1AYC A;  2HDX A;  2MK2 A;  1A1E A;  1O46 A;  1D1Z A;  2H5K A;  1LCJ A;  1FU6 A;  2PNB A;  3IMJ A;  3K2M A;  1BG1 A;  1UUR A;  2EO3 A;  2CRH A;  1F1W A;  1X6C A;  1SKJ A;  4XZ0 A;  1P13 A;  5EHR A;  2ECD A;  1K9A A;  4XZ1 A;  2PLD A;  1WQU A;  2DLY A;  1B47 A;  2KGY A;  1NZV A;  2EOB A;  4OHH A;  1AYD A;  3BUX B;  4GPL B;  1SHD A;  1OPL A;  3VS4 A;  1BM2 A;  2EO6 A;  3HHM B;  3C7I A;  3BKB A;  1CWE A;  3UYO A;  5DC4 A;  2LQW A;  4EY0 A;  2H46 E;  2RMX A;  1JWO A;  3PQZ A;  1BLK A;  1O4F A;  3VS7 A;  1O4Q A;  1YVH A;  1O4J A;  1O4G A;  2VIF A;  1AB2 A;  1AYB A;  5KAZ A;  1TZE E;  4A4C A;  1O4B A;  2PLE A;  3PS5 A;  2AOB A;  3MAZ A;  5IBM A;  3VRY A;  2EU0 A;  2L3T A;  1LKK A;  1LUM A;  2RSY A;  3M7F A;  2PNA A;  1JYQ A;  1KA6 A;  1O4H A;  4E93 A;  4E68 A;  2K79 B;  3UF4 A;  3OB1 B;  1JU5 A;  2ABL A;  5EHP A;  2HUW A;  3OP0 A;  1FMK A;  1A1A A;  1LCK A;  3OV1 A;  1BKL A;  4OHD A;  3EAZ A;  1FHS A;  4K2R A;  3QWY A;  1OO3 A;  2EL8 A;  4OHI A;  1FYR A;  3EAC A;  5DC0 B;  3TKZ A;  1O49 A;  3CD3 A;  1FBV A;  1O4L A;  3VRQ A;  4WWQ A;  3VRZ A;  2DCR A;  2OZO A;  1SHA A;  3BUO B;  1SPS A;  3NHN A;  1R1P A;  3MXC A;  3VS2 A;  1O47 A;  5DF6 A;  1G83 A;  1BMB A;  1X0N A;  1O4P A;  2C0T A;  2IZV A;  2CI8 A;  1A09 A;  2BBU A;  3IMD A;  2KNO A;  2KK6 A;  2Y1N A;  3N7Y A;  1OPK A;  5AXI A;  5HKZ A;  2LCT A;  2HDV A;  1FBZ A;  4TZI A;  1O41 A;  2EKX A;  4FBN A;  3GQI B;  4OHL A;  1YVL A;  4P9Z A;  5J3X A;  1O4M A;  3TL0 A;  2PTK A;  1O4O A;  2DVJ A;  1F2F A;  4LUE A;  4DGX A;  3S8N A;  2HMH A;  1AYA A;  3ZNI A;  1TCE A;  1IJR A;  3VS1 A;  3VS0 A;  2AOA A;  1O4A A;  1Y1U A;  4K44 A;  5BO4 A;  3CBL A;  1O48 A;  1O4D A;  4H1O A;  2FO0 A;  3HIZ B;  4H34 A;  4F59 A;  1A1B A;  2EYY A;  4L1B B;  3PFV A;  2ROR A;  2LRA A;  4F5B A;  1SPR A;  2GE9 A;  3MXY A;  1NZL A;  2YU7 A;  1OO4 A;  3CWG A;  2C9W A;  3PSJ A;  4GWF A;  3S8L A;  4FL2 A;  2JYQ A;  2IUG A;  1A1C A;  1QAD A;  2LNW A;  1O44 A;  5GJH A;  4F5A A;  2CBL A;  5HKY A;  3QWX X;  2MQI A;  1RJA A;  1R1S A;  2CI9 A;  1ZFP E;  2CS0 A;  3T04 A;  3PJP A;  1RQQ C;  4D8K A;  3IN7 A;  2LQN A;  1CJ1 A;  3GXW A;  2XP1 A;  4K45 A;  2CR4 A;  3LYV A;  3IN8 A;  1A08 A;  2SRC A;  3CXL A;  1BFI A;  1IS0 A;  1QG1 E;  2C0I A;  2ETZ A;  2RVF A;  4A4B A;  3VRO A;  1O4K A;  3S8O A;  1Y57 A;  2AUG A;  1H9O A;  2CIA A;  2IUH A;  3BUW B;  2C0O A;  1CWD L;  3KFJ A;  3VS6 A;  2MC1 A;  3GXX A;  3OVE A;  1AOT F;  4M4Z A;  2QMS A;  2MRK A;  1GRI A;  4LUD A;  1KC2 A;  1BKM A;  3VGO A;  3US4 A;  2DX0 A;  2IUI A;  5AUL A;  1LKL A;  3VRP A;  1GHU A;  1UUS A;  1O4E A;  1O4N A;  1QCF A;  1PIC A;  1RPY A;  2SHP A;  2FCI A;  5D0J A;  1NRV A;  3VRR A;  2EYZ A;  1LUK A;  1BFJ A;  5HKW A;  1O4C A;  2DLZ A;  2B3O A;  3BUN B;  1O42 A;  3VS3 A;  5EEL A;  3K2T A;  1JYU A;  1HCT B;  4U17 A;  2GSB A;  2Y1M A;  2Y3A B;  4JE4 A;  5CDW A;  1D4T A;  2HCK A;  2K7A B;  1AOU F;  3N8M A;  3VS5 A;  4P9V A; 
#chains in the Genus database with same CATH homology
 1A81 A;  5GJI A;  1M27 A;  2EYV A;  5I6V A;  1BLJ A;  3WA4 A;  1MW4 A;  4OHE A;  1LUI A;  5EG3 B;  1M61 A;  4FL3 A;  4EIH A;  3OB2 B;  1BF5 A;  1BHH A;  1A07 A;  1R1Q A;  5DC9 A;  2DM0 A;  1LUN A;  2YSX A;  1CSY A;  4JGH A;  1Z3K A;  1O4R A;  1KSW A;  3PSK A;  4DGP A;  2H8H A;  1AD5 A;  4X6S A;  3PLF B;  1XA6 A;  3N84 A;  1MIL A;  4JEG A;  4NWF A;  3HCK A;  2L6K A;  1O43 A;  5IBS A;  3VRN A;  1SHB A;  1BHH B;  1HCS B;  1X27 A;  5EEQ A;  4NWG A;  1O4I A;  4U1P A;  1KA7 A;  1JYR A;  2OQ1 A;  1CSZ A;  2LNX A;  1FU5 A;  1BHF A;  4K11 A;  1I3Z A;  1D4W A;  2L4K A;  4GL9 E;  4QSY A;  4ROJ A;  3BUM B;  3S9K A;  1O45 A;  2MRJ A;  1AYC A;  2HDX A;  2MK2 A;  1A1E A;  1O46 A;  1D1Z A;  2H5K A;  1LCJ A;  1FU6 A;  2PNB A;  3IMJ A;  3K2M A;  1BG1 A;  1UUR A;  2EO3 A;  2CRH A;  1F1W A;  1X6C A;  1SKJ A;  4XZ0 A;  1P13 A;  5EHR A;  2ECD A;  1K9A A;  4XZ1 A;  2PLD A;  1WQU A;  2DLY A;  1B47 A;  1NZV A;  2EOB A;  4OHH A;  1AYD A;  3BUX B;  4GPL B;  1SHD A;  1OPL A;  3VS4 A;  1BM2 A;  2EO6 A;  3HHM B;  3C7I A;  3BKB A;  1CWE A;  3UYO A;  5DC4 A;  2LQW A;  4EY0 A;  2H46 E;  2RMX A;  1JWO A;  3PQZ A;  1BLK A;  1O4F A;  3VS7 A;  1O4Q A;  1YVH A;  1O4J A;  1O4G A;  2VIF A;  1AB2 A;  1AYB A;  5KAZ A;  1TZE E;  4A4C A;  1O4B A;  2PLE A;  3PS5 A;  2AOB A;  3MAZ A;  5IBM A;  3VRY A;  2EU0 A;  2L3T A;  1LKK A;  1LUM A;  2RSY A;  3M7F A;  2PNA A;  1JYQ A;  1KA6 A;  1O4H A;  4E93 A;  4E68 A;  2K79 B;  3UF4 A;  3OB1 B;  1JU5 A;  2ABL A;  5EHP A;  2HUW A;  3OP0 A;  1FMK A;  1A1A A;  1LCK A;  3OV1 A;  1BKL A;  4OHD A;  3EAZ A;  1FHS A;  4K2R A;  3QWY A;  1OO3 A;  2EL8 A;  4OHI A;  1FYR A;  3EAC A;  5DC0 B;  3TKZ A;  1O49 A;  3CD3 A;  1FBV A;  1O4L A;  3VRQ A;  4WWQ A;  3VRZ A;  2DCR A;  2OZO A;  1SHA A;  3BUO B;  1SPS A;  3NHN A;  1R1P A;  3MXC A;  3VS2 A;  1O47 A;  5DF6 A;  1G83 A;  1BMB A;  1X0N A;  1O4P A;  2C0T A;  2IZV A;  2CI8 A;  1A09 A;  2BBU A;  3IMD A;  2KNO A;  2KK6 A;  2Y1N A;  3N7Y A;  1OPK A;  5AXI A;  5HKZ A;  2LCT A;  2HDV A;  1FBZ A;  4TZI A;  1O41 A;  2EKX A;  4FBN A;  3GQI B;  4OHL A;  1YVL A;  4P9Z A;  5J3X A;  1O4M A;  3TL0 A;  2PTK A;  1O4O A;  2DVJ A;  1F2F A;  4LUE A;  4DGX A;  3S8N A;  2HMH A;  1AYA A;  3ZNI A;  1TCE A;  1IJR A;  3VS1 A;  3VS0 A;  2AOA A;  1O4A A;  1Y1U A;  4K44 A;  5BO4 A;  3CBL A;  1O48 A;  1O4D A;  4H1O A;  2FO0 A;  3HIZ B;  4H34 A;  4F59 A;  1A1B A;  2EYY A;  4L1B B;  3PFV A;  2ROR A;  4F5B A;  1SPR A;  2GE9 A;  3MXY A;  1NZL A;  2YU7 A;  1OO4 A;  3CWG A;  2C9W A;  3PSJ A;  4GWF A;  3S8L A;  4FL2 A;  2JYQ A;  2IUG A;  1A1C A;  1QAD A;  2LNW A;  1O44 A;  5GJH A;  4F5A A;  2CBL A;  5HKY A;  3QWX X;  2MQI A;  1RJA A;  1R1S A;  2CI9 A;  1ZFP E;  2CS0 A;  3T04 A;  3PJP A;  1RQQ C;  4D8K A;  3IN7 A;  2LQN A;  1CJ1 A;  3GXW A;  2XP1 A;  4K45 A;  2CR4 A;  3IN8 A;  1A08 A;  2SRC A;  3CXL A;  1BFI A;  1IS0 A;  1QG1 E;  2C0I A;  2ETZ A;  2RVF A;  4A4B A;  3VRO A;  1O4K A;  3S8O A;  1Y57 A;  2AUG A;  1H9O A;  2CIA A;  2IUH A;  3BUW B;  2C0O A;  1CWD L;  3KFJ A;  3VS6 A;  2MC1 A;  3GXX A;  3OVE A;  1AOT F;  4M4Z A;  2QMS A;  2MRK A;  1GRI A;  4LUD A;  1KC2 A;  1BKM A;  3VGO A;  3US4 A;  2DX0 A;  2IUI A;  5AUL A;  1LKL A;  3VRP A;  1GHU A;  1UUS A;  1O4E A;  1O4N A;  1QCF A;  1PIC A;  1RPY A;  2SHP A;  2FCI A;  5D0J A;  1NRV A;  3VRR A;  2EYZ A;  1LUK A;  1BFJ A;  5HKW A;  1O4C A;  2DLZ A;  2B3O A;  3BUN B;  1O42 A;  3VS3 A;  5EEL A;  1JYU A;  1HCT B;  4U17 A;  2GSB A;  2Y1M A;  2Y3A B;  4JE4 A;  5CDW A;  1D4T A;  2HCK A;  2K7A B;  1AOU F;  3N8M A;  3VS5 A;  4P9V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...