1O42A

Crystal structure of sh2 in complex with ru81843.
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
106
structure length
106
Chain Sequence
b'SIQAEEWYFGKITRRESERLLLNAENPRGTFLVRESETTKGAYCLSVSDFDNAKGLNVKHYKIRKLDSGGFYITSRTQFNSLQQLVAYYSKHADGLCHRLTTVCPT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTO-ONCOGENE TYROSINE-PROTEIN KINASE SRC
publication title Requirements for specific binding of low affinity inhibitor fragments to the SH2 domain of (pp60)Src are identical to those for high affinity binding of full length inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 27
structure length 106
sequence length 106
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2003-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00017 SH2 SH2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.505.10 Alpha Beta 2-Layer Sandwich SHC Adaptor Protein SH2 domain 1o42A00
3GXXA 2C9WA 1MW4A 2K7AB 2B3OA 2L6KA 3VROA 1RJAA 1LCKA 5KAZA 1NZLA 1FU6A 3TL0A 1NRVA 3PS5A 3IN7A 3QWXX 5GJIA 1LUIA 1FBZA 3OB1B 2HDXA 5AULA 1GRIA 4U1PA 2HMHA 3IMDA 2DVJA 1AD5A 3PFVA 1CWEA 1BM2A 1O43A 1JYUA 2EO6A 3BUWB 3GXWA 1IS0A 3VS5A 3IMJA 3HCKA 2ETZA 3MXYA 1O4PA 2QMSA 3VS6A 1M61A 1SHBA 1BF5A 4A4BA 5EG3B 2EYZA 5IBMA 4OHLA 2RMXA 2KK6A 1JU5A 1A1BA 1CJ1A 2LNXA 1QCFA 2YU7A 3OV1A 1BKLA 1TZEE 5BO4A 1O4LA 1CWDL 3OVEA 2Y3AB 2IUHA 4QSYA 1O4OA 2RORA 3N8MA 2CR4A 1JYRA 1O4QA 5DC0B 5IBSA 4FL2A 1OO3A 3VRYA 4H34A 1O4CA 4OHIA 3TKZA 2HDVA 2DM0A 2CS0A 3VRNA 4U17A 3VS3A 1O4GA 4OHEA 3PSKA 4K45A 2CIAA 1O44A 3N7YA 2C0TA 2EU0A 1O4NA 3PLFB 3QWYA 1A07A 4FBNA 4X6SA 1KSWA 1AOUF 5GJHA 3VS0A 1BLJA 1AOTF 1O4HA 1SHAA 4NWFA 4GL9E 1FMKA 4JGHA 1BKMA 3PJPA 3K2MA 1D4WA 1O4DA 1KC2A 4OHDA 2EYYA 3KFJA 3OP0A 1OO4A 3BUXB 3S8OA 1CSZA 1A1AA 1Z3KA 3T04A 4L1BB 3VS7A 1O4IA 3CWGA 1LUKA 2BBUA 3OB2B 4JEGA 1AYCA 3HHMB 5AXIA 1P13A 2C0OA 2L4KA 1LCJA 4F5BA 1QG1E 2EOBA 1QADA 5DF6A 1SKJA 1D4TA 1RPYA 3CXLA 1LUMA 2EYVA 1F1WA 1YVHA 3BKBA 2AOBA 1LKLA 3C7IA 1K9AA 1Y57A 5EEQA 1NZVA 1ZFPE 2HCKA 5DC4A 1H9OA 1O46A 1O49A 1O4BA 1O42A 1OPKA 1RQQC 2ECDA 2MC1A 3UF4A 3IN8A 4LUDA 1O4JA 5EHPA 3PSJA 1O48A 2LNWA 1GHUA 3S8NA 2MRJA 2MK2A 3VRPA 2H8HA 2L3TA 1FU5A 2ABLA 5J3XA 1UUSA 1UURA 1A09A 1BHHB 1TCEA 2AOAA 1O4FA 2HUWA 5EHRA 1A1EA 2FO0A 1AYBA 1JWOA 1BFJA 1LKKA 2VIFA 2DLZA 4P9VA 2DCRA 2EKXA 2CI8A 2H5KA 1X0NA 2EL8A 1FBVA 2C0IA 5CDWA 2CRHA 2CBLA 4K11A 1B47A 4FL3A 4F5AA 1BHFA 2IUIA 4EY0A 1HCTB 4GPLB 1O41A 2PNBA 1FHSA 1SHDA 3BUNB 1R1QA 3ZNIA 2MRKA 2SRCA 4DGPA 3VGOA 2MQIA 1X6CA 2IUGA 4DGXA 5HKWA 1YVLA 5HKZA 3EAZA 4P9ZA 4NWGA 4F59A 1X27A 1HCSB 3MAZA 4K2RA 3N84A 2Y1NA 2K79B 2RSYA 5I6VA 4ROJA 1FYRA 1A81A 2DLYA 2SHPA 4GWFA 5D0JA 1AYDA 2PTKA 1BMBA 2IZVA 4M4ZA 1LUNA 1JYQA 3S9KA 2LCTA 1BLKA 1IJRA 4JE4A 1O4EA 3PQZA 3VS2A 4H1OA 2Y1MA 2DX0A 2AUGA 2GSBA 2PLDA 1R1SA 2FCIA 3BUOB 1O47A 1O45A 1BG1A 2XP1A 2YSXA 2GE9A 3M7FA 1R1PA 3CBLA 2PNAA 4E93A 2PLEA 1MILA 2KNOA 1O4MA 1WQUA 3VRRA 2RVFA 2OQ1A 1KA7A 1SPSA 5HKYA 3EACA 3CD3A 2LQNA 3HIZB 3GQIB 3NHNA 4XZ1A 2CI9A 1OPLA 3S8LA 2H46E 3VS4A 1BHHA 3BUMB 4XZ0A 4K44A 3MXCA 4A4CA 3US4A 2EO3A 1A08A 4OHHA 1BFIA 1I3ZA 2JYQA 3WA4A 1F2FA 4EIHA 1CSYA 1D1ZA 3VRZA 1SPRA 1KA6A 3UYOA 3VS1A 1PICA 2LQWA 1A1CA 1O4RA 2OZOA 1O4KA 1AB2A 1XA6A 1O4AA 4WWQA 5EELA 4D8KA 1AYAA 4E68A 1G83A 1M27A 4TZIA 3VRQA 5DC9A 1Y1UA 4LUEA
chains in the Genus database with same CATH superfamily
3GXXA 2C9WA 1MW4A 2K7AB 2B3OA 2L6KA 3VROA 1RJAA 1LCKA 5KAZA 1NZLA 1FU6A 3TL0A 1NRVA 3PS5A 3IN7A 3QWXX 5GJIA 1LUIA 1FBZA 3OB1B 2HDXA 5AULA 1GRIA 4U1PA 2HMHA 3IMDA 2DVJA 1AD5A 3PFVA 1CWEA 1BM2A 1O43A 1JYUA 2EO6A 3BUWB 3GXWA 1IS0A 3VS5A 3IMJA 3HCKA 2ETZA 3MXYA 1O4PA 2QMSA 3VS6A 1M61A 1SHBA 1BF5A 4A4BA 5EG3B 2EYZA 5IBMA 4OHLA 2RMXA 2KGYA 2KK6A 1JU5A 1A1BA 1CJ1A 2LNXA 1QCFA 2YU7A 3OV1A 1BKLA 1TZEE 5BO4A 1O4LA 1CWDL 3OVEA 2Y3AB 2IUHA 4QSYA 1O4OA 2RORA 3N8MA 2CR4A 1JYRA 1O4QA 5DC0B 5IBSA 4FL2A 1OO3A 3VRYA 4H34A 1O4CA 4OHIA 3TKZA 2HDVA 2DM0A 2CS0A 3VRNA 4U17A 3VS3A 1O4GA 4OHEA 3PSKA 4K45A 2CIAA 1O44A 3N7YA 2C0TA 2EU0A 1O4NA 3PLFB 3LYVA 3QWYA 1A07A 4FBNA 4X6SA 1KSWA 1AOUF 5GJHA 3VS0A 1BLJA 1AOTF 1O4HA 1SHAA 4NWFA 4GL9E 1FMKA 4JGHA 1BKMA 3PJPA 3K2MA 1D4WA 1O4DA 1KC2A 4OHDA 2EYYA 3KFJA 3OP0A 1OO4A 3BUXB 3S8OA 1CSZA 1A1AA 1Z3KA 3T04A 4L1BB 3VS7A 1O4IA 3CWGA 1LUKA 2BBUA 3OB2B 4JEGA 1AYCA 3HHMB 5AXIA 1P13A 2C0OA 2L4KA 1LCJA 4F5BA 1QG1E 2EOBA 1QADA 5DF6A 1SKJA 1D4TA 1RPYA 3CXLA 1LUMA 2EYVA 1F1WA 1YVHA 3BKBA 2AOBA 1LKLA 3C7IA 1K9AA 1Y57A 5EEQA 1NZVA 1ZFPE 2HCKA 5DC4A 1H9OA 1O46A 1O49A 1O4BA 1O42A 1OPKA 1RQQC 2LRAA 2ECDA 2MC1A 3UF4A 3IN8A 4LUDA 1O4JA 5EHPA 3PSJA 1O48A 2LNWA 1GHUA 3S8NA 2MRJA 2MK2A 3VRPA 2H8HA 2L3TA 1FU5A 2ABLA 5J3XA 1UUSA 1UURA 1A09A 1BHHB 1TCEA 2AOAA 1O4FA 2HUWA 5EHRA 3K2TA 1A1EA 2FO0A 1AYBA 1JWOA 1BFJA 1LKKA 2VIFA 2DLZA 4P9VA 2DCRA 2EKXA 2CI8A 2H5KA 1X0NA 2EL8A 1FBVA 2C0IA 5CDWA 2CRHA 2CBLA 4K11A 1B47A 4FL3A 4F5AA 1BHFA 2IUIA 4EY0A 1HCTB 4GPLB 1O41A 2PNBA 1FHSA 5DC9A 1SHDA 3BUNB 1R1QA 3ZNIA 2MRKA 2SRCA 4DGPA 3VGOA 2MQIA 1X6CA 2IUGA 4DGXA 5HKWA 1YVLA 5HKZA 3EAZA 4P9ZA 4NWGA 4F59A 1X27A 1HCSB 3MAZA 4K2RA 3N84A 2Y1NA 2K79B 2RSYA 5I6VA 4ROJA 1FYRA 1A81A 2DLYA 2SHPA 4GWFA 5D0JA 1AYDA 2PTKA 1BMBA 2IZVA 4M4ZA 1LUNA 1JYQA 3S9KA 2LCTA 1BLKA 1IJRA 4JE4A 1O4EA 3PQZA 3VS2A 4H1OA 2Y1MA 2DX0A 2AUGA 2GSBA 2PLDA 1R1SA 2FCIA 3BUOB 1O47A 1O45A 1BG1A 2XP1A 2YSXA 2GE9A 3M7FA 1R1PA 3CBLA 2PNAA 4E93A 2PLEA 1MILA 2KNOA 1O4MA 1WQUA 3VRRA 2RVFA 2OQ1A 1KA7A 1SPSA 5HKYA 3CD3A 2LQNA 3HIZB 3GQIB 3NHNA 4XZ1A 2CI9A 1OPLA 3S8LA 2H46E 3VS4A 1BHHA 3BUMB 4XZ0A 4K44A 3MXCA 4A4CA 3US4A 2EO3A 1A08A 4OHHA 1BFIA 1I3ZA 2JYQA 3WA4A 1F2FA 4EIHA 1CSYA 1D1ZA 3VRZA 1SPRA 1KA6A 3UYOA 3VS1A 1PICA 2LQWA 1A1CA 1O4RA 2OZOA 1O4KA 1AB2A 1XA6A 1O4AA 4WWQA 5EELA 4D8KA 1AYAA 4E68A 1G83A 1M27A 4TZIA 3VRQA 3EACA 1Y1UA 4LUEA
chains in the Genus database with same CATH topology
3GXXA 2C9WA 1MW4A 2K7AB 2B3OA 2L6KA 3VROA 1RJAA 1LCKA 5KAZA 1NZLA 1FU6A 3TL0A 1NRVA 3PS5A 3IN7A 3QWXX 5GJIA 1LUIA 1FBZA 3OB1B 2HDXA 5AULA 1GRIA 4U1PA 2HMHA 3IMDA 2DVJA 1AD5A 3PFVA 1CWEA 1BM2A 1O43A 1JYUA 2EO6A 3BUWB 3GXWA 1IS0A 3VS5A 3IMJA 3HCKA 2ETZA 3MXYA 1O4PA 2QMSA 3VS6A 1M61A 1SHBA 1BF5A 4A4BA 5EG3B 2EYZA 5IBMA 4OHLA 2RMXA 2KK6A 1JU5A 1A1BA 1CJ1A 2LNXA 1QCFA 2YU7A 3OV1A 1BKLA 1TZEE 5BO4A 1O4LA 1CWDL 3OVEA 2Y3AB 2IUHA 4QSYA 1O4OA 2RORA 3N8MA 2CR4A 1JYRA 1O4QA 5DC0B 5IBSA 4FL2A 1OO3A 3VRYA 4H34A 1O4CA 4OHIA 3TKZA 2HDVA 2DM0A 2CS0A 3VRNA 4U17A 3VS3A 1O4GA 4OHEA 3PSKA 4K45A 2CIAA 1O44A 3N7YA 2C0TA 2EU0A 1O4NA 3PLFB 3QWYA 1A07A 4FBNA 4X6SA 1KSWA 1AOUF 5GJHA 3VS0A 1BLJA 1AOTF 1O4HA 1SHAA 4NWFA 4GL9E 1FMKA 4JGHA 1BKMA 3PJPA 3K2MA 1D4WA 1O4DA 1KC2A 4OHDA 2EYYA 3KFJA 3OP0A 1OO4A 3BUXB 3S8OA 1CSZA 1A1AA 1Z3KA 3T04A 4L1BB 3VS7A 1O4IA 3CWGA 1LUKA 2BBUA 3OB2B 4JEGA 1AYCA 3HHMB 5AXIA 1P13A 2C0OA 2L4KA 1LCJA 4F5BA 1QG1E 2EOBA 1QADA 5DF6A 1SKJA 1D4TA 1RPYA 3CXLA 1LUMA 2EYVA 1F1WA 1YVHA 3BKBA 2AOBA 1LKLA 3C7IA 1K9AA 1Y57A 5EEQA 1NZVA 1ZFPE 2HCKA 5DC4A 1H9OA 1O46A 1O49A 1O4BA 1O42A 1OPKA 1RQQC 2ECDA 2MC1A 3UF4A 3IN8A 4LUDA 1O4JA 5EHPA 3PSJA 1O48A 2LNWA 1GHUA 3S8NA 2MRJA 2MK2A 3VRPA 2H8HA 2L3TA 1FU5A 2ABLA 5J3XA 1UUSA 1UURA 1A09A 1BHHB 1TCEA 2AOAA 1O4FA 2HUWA 5EHRA 1A1EA 2FO0A 1AYBA 1JWOA 1BFJA 1LKKA 2VIFA 2DLZA 4P9VA 2DCRA 2EKXA 2CI8A 2H5KA 1X0NA 2EL8A 1FBVA 2C0IA 5CDWA 2CRHA 2CBLA 4K11A 1B47A 4FL3A 4F5AA 1BHFA 2IUIA 4EY0A 1HCTB 4GPLB 1O41A 2PNBA 1FHSA 1SHDA 3BUNB 1R1QA 3ZNIA 2MRKA 2SRCA 4DGPA 3VGOA 2MQIA 1X6CA 2IUGA 4DGXA 5HKWA 1YVLA 5HKZA 3EAZA 4P9ZA 4NWGA 4F59A 1X27A 1HCSB 3MAZA 4K2RA 3N84A 2Y1NA 2K79B 2RSYA 5I6VA 4ROJA 1FYRA 1A81A 2DLYA 2SHPA 4GWFA 5D0JA 1AYDA 2PTKA 1BMBA 2IZVA 4M4ZA 1LUNA 1JYQA 3S9KA 2LCTA 1BLKA 1IJRA 4JE4A 1O4EA 3PQZA 3VS2A 4H1OA 2Y1MA 2DX0A 2AUGA 2GSBA 2PLDA 1R1SA 2FCIA 3BUOB 1O47A 1O45A 1BG1A 2XP1A 2YSXA 2GE9A 3M7FA 1R1PA 3CBLA 2PNAA 4E93A 2PLEA 1MILA 2KNOA 1O4MA 1WQUA 3VRRA 2RVFA 2OQ1A 1KA7A 1SPSA 5HKYA 3EACA 3CD3A 2LQNA 3HIZB 3GQIB 3NHNA 4XZ1A 2CI9A 1OPLA 3S8LA 2H46E 3VS4A 1BHHA 3BUMB 4XZ0A 4K44A 3MXCA 4A4CA 3US4A 2EO3A 1A08A 4OHHA 1BFIA 1I3ZA 2JYQA 3WA4A 1F2FA 4EIHA 1CSYA 1D1ZA 3VRZA 1SPRA 1KA6A 3UYOA 3VS1A 1PICA 2LQWA 1A1CA 1O4RA 2OZOA 1O4KA 1AB2A 1XA6A 1O4AA 4WWQA 5EELA 4D8KA 1AYAA 4E68A 1G83A 1M27A 4TZIA 3VRQA 5DC9A 1Y1UA 4LUEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GXX A;  2C9W A;  1MW4 A;  2K7A B;  2B3O A;  2L6K A;  3VRO A;  1RJA A;  1LCK A;  5KAZ A;  1NZL A;  1FU6 A;  3TL0 A;  1NRV A;  3PS5 A;  3IN7 A;  3QWX X;  5GJI A;  1LUI A;  1FBZ A;  3OB1 B;  2HDX A;  5AUL A;  1GRI A;  4U1P A;  2HMH A;  3IMD A;  2DVJ A;  1AD5 A;  3PFV A;  1CWE A;  1BM2 A;  1O43 A;  1JYU A;  2EO6 A;  3BUW B;  3GXW A;  1IS0 A;  3VS5 A;  3IMJ A;  3HCK A;  2ETZ A;  3MXY A;  1O4P A;  2QMS A;  3VS6 A;  1M61 A;  1SHB A;  1BF5 A;  4A4B A;  5EG3 B;  2EYZ A;  5IBM A;  4OHL A;  2RMX A;  2KK6 A;  1JU5 A;  1A1B A;  1CJ1 A;  2LNX A;  1QCF A;  2YU7 A;  3OV1 A;  1BKL A;  1TZE E;  5BO4 A;  1O4L A;  1CWD L;  3OVE A;  2Y3A B;  2IUH A;  4QSY A;  1O4O A;  2ROR A;  3N8M A;  2CR4 A;  1JYR A;  1O4Q A;  5DC0 B;  5IBS A;  4FL2 A;  1OO3 A;  3VRY A;  4H34 A;  1O4C A;  4OHI A;  3TKZ A;  2HDV A;  2DM0 A;  2CS0 A;  3VRN A;  4U17 A;  3VS3 A;  1O4G A;  4OHE A;  3PSK A;  4K45 A;  2CIA A;  1O44 A;  3N7Y A;  2C0T A;  2EU0 A;  1O4N A;  3PLF B;  3QWY A;  1A07 A;  4FBN A;  4X6S A;  1KSW A;  1AOU F;  5GJH A;  3VS0 A;  1BLJ A;  1AOT F;  1O4H A;  1SHA A;  4NWF A;  4GL9 E;  1FMK A;  4JGH A;  1BKM A;  3PJP A;  3K2M A;  1D4W A;  1O4D A;  1KC2 A;  4OHD A;  2EYY A;  3KFJ A;  3OP0 A;  1OO4 A;  3BUX B;  3S8O A;  1CSZ A;  1A1A A;  1Z3K A;  3T04 A;  4L1B B;  3VS7 A;  1O4I A;  3CWG A;  1LUK A;  2BBU A;  3OB2 B;  4JEG A;  1AYC A;  3HHM B;  5AXI A;  1P13 A;  2C0O A;  2L4K A;  1LCJ A;  4F5B A;  1QG1 E;  2EOB A;  1QAD A;  5DF6 A;  1SKJ A;  1D4T A;  1RPY A;  3CXL A;  1LUM A;  2EYV A;  1F1W A;  1YVH A;  3BKB A;  2AOB A;  1LKL A;  3C7I A;  1K9A A;  1Y57 A;  5EEQ A;  1NZV A;  1ZFP E;  2HCK A;  5DC4 A;  1H9O A;  1O46 A;  1O49 A;  1O4B A;  1O42 A;  1OPK A;  1RQQ C;  2ECD A;  2MC1 A;  3UF4 A;  3IN8 A;  4LUD A;  1O4J A;  5EHP A;  3PSJ A;  1O48 A;  2LNW A;  1GHU A;  3S8N A;  2MRJ A;  2MK2 A;  3VRP A;  2H8H A;  2L3T A;  1FU5 A;  2ABL A;  5J3X A;  1UUS A;  1UUR A;  1A09 A;  1BHH B;  1TCE A;  2AOA A;  1O4F A;  2HUW A;  5EHR A;  1A1E A;  2FO0 A;  1AYB A;  1JWO A;  1BFJ A;  1LKK A;  2VIF A;  2DLZ A;  4P9V A;  2DCR A;  2EKX A;  2CI8 A;  2H5K A;  1X0N A;  2EL8 A;  1FBV A;  2C0I A;  5CDW A;  2CRH A;  2CBL A;  4K11 A;  1B47 A;  4FL3 A;  4F5A A;  1BHF A;  2IUI A;  4EY0 A;  1HCT B;  4GPL B;  1O41 A;  2PNB A;  1FHS A;  1SHD A;  3BUN B;  1R1Q A;  3ZNI A;  2MRK A;  2SRC A;  4DGP A;  3VGO A;  2MQI A;  1X6C A;  2IUG A;  4DGX A;  5HKW A;  1YVL A;  5HKZ A;  3EAZ A;  4P9Z A;  4NWG A;  4F59 A;  1X27 A;  1HCS B;  3MAZ A;  4K2R A;  3N84 A;  2Y1N A;  2K79 B;  2RSY A;  5I6V A;  4ROJ A;  1FYR A;  1A81 A;  2DLY A;  2SHP A;  4GWF A;  5D0J A;  1AYD A;  2PTK A;  1BMB A;  2IZV A;  4M4Z A;  1LUN A;  1JYQ A;  3S9K A;  2LCT A;  1BLK A;  1IJR A;  4JE4 A;  1O4E A;  3PQZ A;  3VS2 A;  4H1O A;  2Y1M A;  2DX0 A;  2AUG A;  2GSB A;  2PLD A;  1R1S A;  2FCI A;  3BUO B;  1O47 A;  1O45 A;  1BG1 A;  2XP1 A;  2YSX A;  2GE9 A;  3M7F A;  1R1P A;  3CBL A;  2PNA A;  4E93 A;  2PLE A;  1MIL A;  2KNO A;  1O4M A;  1WQU A;  3VRR A;  2RVF A;  2OQ1 A;  1KA7 A;  1SPS A;  5HKY A;  3EAC A;  3CD3 A;  2LQN A;  3HIZ B;  3GQI B;  3NHN A;  4XZ1 A;  2CI9 A;  1OPL A;  3S8L A;  2H46 E;  3VS4 A;  1BHH A;  3BUM B;  4XZ0 A;  4K44 A;  3MXC A;  4A4C A;  3US4 A;  2EO3 A;  1A08 A;  4OHH A;  1BFI A;  1I3Z A;  2JYQ A;  3WA4 A;  1F2F A;  4EIH A;  1CSY A;  1D1Z A;  3VRZ A;  1SPR A;  1KA6 A;  3UYO A;  3VS1 A;  1PIC A;  2LQW A;  1A1C A;  1O4R A;  2OZO A;  1O4K A;  1AB2 A;  1XA6 A;  1O4A A;  4WWQ A;  5EEL A;  4D8K A;  1AYA A;  4E68 A;  1G83 A;  1M27 A;  4TZI A;  3VRQ A;  5DC9 A;  1Y1U A;  4LUE A; 
#chains in the Genus database with same CATH topology
 3GXX A;  2C9W A;  1MW4 A;  2K7A B;  2B3O A;  2L6K A;  3VRO A;  1RJA A;  1LCK A;  5KAZ A;  1NZL A;  1FU6 A;  3TL0 A;  1NRV A;  3PS5 A;  3IN7 A;  3QWX X;  5GJI A;  1LUI A;  1FBZ A;  3OB1 B;  2HDX A;  5AUL A;  1GRI A;  4U1P A;  2HMH A;  3IMD A;  2DVJ A;  1AD5 A;  3PFV A;  1CWE A;  1BM2 A;  1O43 A;  1JYU A;  2EO6 A;  3BUW B;  3GXW A;  1IS0 A;  3VS5 A;  3IMJ A;  3HCK A;  2ETZ A;  3MXY A;  1O4P A;  2QMS A;  3VS6 A;  1M61 A;  1SHB A;  1BF5 A;  4A4B A;  5EG3 B;  2EYZ A;  5IBM A;  4OHL A;  2RMX A;  2KGY A;  2KK6 A;  1JU5 A;  1A1B A;  1CJ1 A;  2LNX A;  1QCF A;  2YU7 A;  3OV1 A;  1BKL A;  1TZE E;  5BO4 A;  1O4L A;  1CWD L;  3OVE A;  2Y3A B;  2IUH A;  4QSY A;  1O4O A;  2ROR A;  3N8M A;  2CR4 A;  1JYR A;  1O4Q A;  5DC0 B;  5IBS A;  4FL2 A;  1OO3 A;  3VRY A;  4H34 A;  1O4C A;  4OHI A;  3TKZ A;  2HDV A;  2DM0 A;  2CS0 A;  3VRN A;  4U17 A;  3VS3 A;  1O4G A;  4OHE A;  3PSK A;  4K45 A;  2CIA A;  1O44 A;  3N7Y A;  2C0T A;  2EU0 A;  1O4N A;  3PLF B;  3LYV A;  3QWY A;  1A07 A;  4FBN A;  4X6S A;  1KSW A;  1AOU F;  5GJH A;  3VS0 A;  1BLJ A;  1AOT F;  1O4H A;  1SHA A;  4NWF A;  4GL9 E;  1FMK A;  4JGH A;  1BKM A;  3PJP A;  3K2M A;  1D4W A;  1O4D A;  1KC2 A;  4OHD A;  2EYY A;  3KFJ A;  3OP0 A;  1OO4 A;  3BUX B;  3S8O A;  1CSZ A;  1A1A A;  1Z3K A;  3T04 A;  4L1B B;  3VS7 A;  1O4I A;  3CWG A;  1LUK A;  2BBU A;  3OB2 B;  4JEG A;  1AYC A;  3HHM B;  5AXI A;  1P13 A;  2C0O A;  2L4K A;  1LCJ A;  4F5B A;  1QG1 E;  2EOB A;  1QAD A;  5DF6 A;  1SKJ A;  1D4T A;  1RPY A;  3CXL A;  1LUM A;  2EYV A;  1F1W A;  1YVH A;  3BKB A;  2AOB A;  1LKL A;  3C7I A;  1K9A A;  1Y57 A;  5EEQ A;  1NZV A;  1ZFP E;  2HCK A;  5DC4 A;  1H9O A;  1O46 A;  1O49 A;  1O4B A;  1O42 A;  1OPK A;  1RQQ C;  2LRA A;  2ECD A;  2MC1 A;  3UF4 A;  3IN8 A;  4LUD A;  1O4J A;  5EHP A;  3PSJ A;  1O48 A;  2LNW A;  1GHU A;  3S8N A;  2MRJ A;  2MK2 A;  3VRP A;  2H8H A;  2L3T A;  1FU5 A;  2ABL A;  5J3X A;  1UUS A;  1UUR A;  1A09 A;  1BHH B;  1TCE A;  2AOA A;  1O4F A;  2HUW A;  5EHR A;  3K2T A;  1A1E A;  2FO0 A;  1AYB A;  1JWO A;  1BFJ A;  1LKK A;  2VIF A;  2DLZ A;  4P9V A;  2DCR A;  2EKX A;  2CI8 A;  2H5K A;  1X0N A;  2EL8 A;  1FBV A;  2C0I A;  5CDW A;  2CRH A;  2CBL A;  4K11 A;  1B47 A;  4FL3 A;  4F5A A;  1BHF A;  2IUI A;  4EY0 A;  1HCT B;  4GPL B;  1O41 A;  2PNB A;  1FHS A;  5DC9 A;  1SHD A;  3BUN B;  1R1Q A;  3ZNI A;  2MRK A;  2SRC A;  4DGP A;  3VGO A;  2MQI A;  1X6C A;  2IUG A;  4DGX A;  5HKW A;  1YVL A;  5HKZ A;  3EAZ A;  4P9Z A;  4NWG A;  4F59 A;  1X27 A;  1HCS B;  3MAZ A;  4K2R A;  3N84 A;  2Y1N A;  2K79 B;  2RSY A;  5I6V A;  4ROJ A;  1FYR A;  1A81 A;  2DLY A;  2SHP A;  4GWF A;  5D0J A;  1AYD A;  2PTK A;  1BMB A;  2IZV A;  4M4Z A;  1LUN A;  1JYQ A;  3S9K A;  2LCT A;  1BLK A;  1IJR A;  4JE4 A;  1O4E A;  3PQZ A;  3VS2 A;  4H1O A;  2Y1M A;  2DX0 A;  2AUG A;  2GSB A;  2PLD A;  1R1S A;  2FCI A;  3BUO B;  1O47 A;  1O45 A;  1BG1 A;  2XP1 A;  2YSX A;  2GE9 A;  3M7F A;  1R1P A;  3CBL A;  2PNA A;  4E93 A;  2PLE A;  1MIL A;  2KNO A;  1O4M A;  1WQU A;  3VRR A;  2RVF A;  2OQ1 A;  1KA7 A;  1SPS A;  5HKY A;  3CD3 A;  2LQN A;  3HIZ B;  3GQI B;  3NHN A;  4XZ1 A;  2CI9 A;  1OPL A;  3S8L A;  2H46 E;  3VS4 A;  1BHH A;  3BUM B;  4XZ0 A;  4K44 A;  3MXC A;  4A4C A;  3US4 A;  2EO3 A;  1A08 A;  4OHH A;  1BFI A;  1I3Z A;  2JYQ A;  3WA4 A;  1F2F A;  4EIH A;  1CSY A;  1D1Z A;  3VRZ A;  1SPR A;  1KA6 A;  3UYO A;  3VS1 A;  1PIC A;  2LQW A;  1A1C A;  1O4R A;  2OZO A;  1O4K A;  1AB2 A;  1XA6 A;  1O4A A;  4WWQ A;  5EEL A;  4D8K A;  1AYA A;  4E68 A;  1G83 A;  1M27 A;  4TZI A;  3VRQ A;  3EAC A;  1Y1U A;  4LUE A; 
#chains in the Genus database with same CATH homology
 3GXX A;  2C9W A;  1MW4 A;  2K7A B;  2B3O A;  2L6K A;  3VRO A;  1RJA A;  1LCK A;  5KAZ A;  1NZL A;  1FU6 A;  3TL0 A;  1NRV A;  3PS5 A;  3IN7 A;  3QWX X;  5GJI A;  1LUI A;  1FBZ A;  3OB1 B;  2HDX A;  5AUL A;  1GRI A;  4U1P A;  2HMH A;  3IMD A;  2DVJ A;  1AD5 A;  3PFV A;  1CWE A;  1BM2 A;  1O43 A;  1JYU A;  2EO6 A;  3BUW B;  3GXW A;  1IS0 A;  3VS5 A;  3IMJ A;  3HCK A;  2ETZ A;  3MXY A;  1O4P A;  2QMS A;  3VS6 A;  1M61 A;  1SHB A;  1BF5 A;  4A4B A;  5EG3 B;  2EYZ A;  5IBM A;  4OHL A;  2RMX A;  2KK6 A;  1JU5 A;  1A1B A;  1CJ1 A;  2LNX A;  1QCF A;  2YU7 A;  3OV1 A;  1BKL A;  1TZE E;  5BO4 A;  1O4L A;  1CWD L;  3OVE A;  2Y3A B;  2IUH A;  4QSY A;  1O4O A;  2ROR A;  3N8M A;  2CR4 A;  1JYR A;  1O4Q A;  5DC0 B;  5IBS A;  4FL2 A;  1OO3 A;  3VRY A;  4H34 A;  1O4C A;  4OHI A;  3TKZ A;  2HDV A;  2DM0 A;  2CS0 A;  3VRN A;  4U17 A;  3VS3 A;  1O4G A;  4OHE A;  3PSK A;  4K45 A;  2CIA A;  1O44 A;  3N7Y A;  2C0T A;  2EU0 A;  1O4N A;  3PLF B;  3QWY A;  1A07 A;  4FBN A;  4X6S A;  1KSW A;  1AOU F;  5GJH A;  3VS0 A;  1BLJ A;  1AOT F;  1O4H A;  1SHA A;  4NWF A;  4GL9 E;  1FMK A;  4JGH A;  1BKM A;  3PJP A;  3K2M A;  1D4W A;  1O4D A;  1KC2 A;  4OHD A;  2EYY A;  3KFJ A;  3OP0 A;  1OO4 A;  3BUX B;  3S8O A;  1CSZ A;  1A1A A;  1Z3K A;  3T04 A;  4L1B B;  3VS7 A;  1O4I A;  3CWG A;  1LUK A;  2BBU A;  3OB2 B;  4JEG A;  1AYC A;  3HHM B;  5AXI A;  1P13 A;  2C0O A;  2L4K A;  1LCJ A;  4F5B A;  1QG1 E;  2EOB A;  1QAD A;  5DF6 A;  1SKJ A;  1D4T A;  1RPY A;  3CXL A;  1LUM A;  2EYV A;  1F1W A;  1YVH A;  3BKB A;  2AOB A;  1LKL A;  3C7I A;  1K9A A;  1Y57 A;  5EEQ A;  1NZV A;  1ZFP E;  2HCK A;  5DC4 A;  1H9O A;  1O46 A;  1O49 A;  1O4B A;  1O42 A;  1OPK A;  1RQQ C;  2ECD A;  2MC1 A;  3UF4 A;  3IN8 A;  4LUD A;  1O4J A;  5EHP A;  3PSJ A;  1O48 A;  2LNW A;  1GHU A;  3S8N A;  2MRJ A;  2MK2 A;  3VRP A;  2H8H A;  2L3T A;  1FU5 A;  2ABL A;  5J3X A;  1UUS A;  1UUR A;  1A09 A;  1BHH B;  1TCE A;  2AOA A;  1O4F A;  2HUW A;  5EHR A;  1A1E A;  2FO0 A;  1AYB A;  1JWO A;  1BFJ A;  1LKK A;  2VIF A;  2DLZ A;  4P9V A;  2DCR A;  2EKX A;  2CI8 A;  2H5K A;  1X0N A;  2EL8 A;  1FBV A;  2C0I A;  5CDW A;  2CRH A;  2CBL A;  4K11 A;  1B47 A;  4FL3 A;  4F5A A;  1BHF A;  2IUI A;  4EY0 A;  1HCT B;  4GPL B;  1O41 A;  2PNB A;  1FHS A;  1SHD A;  3BUN B;  1R1Q A;  3ZNI A;  2MRK A;  2SRC A;  4DGP A;  3VGO A;  2MQI A;  1X6C A;  2IUG A;  4DGX A;  5HKW A;  1YVL A;  5HKZ A;  3EAZ A;  4P9Z A;  4NWG A;  4F59 A;  1X27 A;  1HCS B;  3MAZ A;  4K2R A;  3N84 A;  2Y1N A;  2K79 B;  2RSY A;  5I6V A;  4ROJ A;  1FYR A;  1A81 A;  2DLY A;  2SHP A;  4GWF A;  5D0J A;  1AYD A;  2PTK A;  1BMB A;  2IZV A;  4M4Z A;  1LUN A;  1JYQ A;  3S9K A;  2LCT A;  1BLK A;  1IJR A;  4JE4 A;  1O4E A;  3PQZ A;  3VS2 A;  4H1O A;  2Y1M A;  2DX0 A;  2AUG A;  2GSB A;  2PLD A;  1R1S A;  2FCI A;  3BUO B;  1O47 A;  1O45 A;  1BG1 A;  2XP1 A;  2YSX A;  2GE9 A;  3M7F A;  1R1P A;  3CBL A;  2PNA A;  4E93 A;  2PLE A;  1MIL A;  2KNO A;  1O4M A;  1WQU A;  3VRR A;  2RVF A;  2OQ1 A;  1KA7 A;  1SPS A;  5HKY A;  3EAC A;  3CD3 A;  2LQN A;  3HIZ B;  3GQI B;  3NHN A;  4XZ1 A;  2CI9 A;  1OPL A;  3S8L A;  2H46 E;  3VS4 A;  1BHH A;  3BUM B;  4XZ0 A;  4K44 A;  3MXC A;  4A4C A;  3US4 A;  2EO3 A;  1A08 A;  4OHH A;  1BFI A;  1I3Z A;  2JYQ A;  3WA4 A;  1F2F A;  4EIH A;  1CSY A;  1D1Z A;  3VRZ A;  1SPR A;  1KA6 A;  3UYO A;  3VS1 A;  1PIC A;  2LQW A;  1A1C A;  1O4R A;  2OZO A;  1O4K A;  1AB2 A;  1XA6 A;  1O4A A;  4WWQ A;  5EEL A;  4D8K A;  1AYA A;  4E68 A;  1G83 A;  1M27 A;  4TZI A;  3VRQ A;  5DC9 A;  1Y1U A;  4LUE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...